F471726

General Info

Members Datasets Scaffolds Average Seq Length
640 245 640 144

Family's Representative Sequence

Representative Sequence 3300048909|Ga0496106_1545080|Ga0496106_1545080_11_436
Length 136
Sequence MIAALLVTIGVIAGAQSGSSAGVHVDPAKVAAALAKGGPLVTRPDLLVSGSHRETGGKVEVHDKETDVLYVVDGEATFVFGGKMEGGKVTSPGQWQGGESHRIAKGDVFVIPAGVPHWFKEVPKSVSYFVVKVLKP

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
163 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
164 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
165 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
166 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
167 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
168 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
169 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
170 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
171 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
172 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
174 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
176 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
177 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
178 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
179 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
180 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
181 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
182 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
183 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
184 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
185 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
186 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
188 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
194 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
195 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
196 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
197 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
198 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
199 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
200 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
201 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
202 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
203 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
204 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
205 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
206 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
207 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
208 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
209 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
210 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
211 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
212 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
213 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
214 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
215 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
216 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
217 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
218 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
219 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
220 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
221 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
222 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
223 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
224 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
225 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
226 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
227 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
231 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
232 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
233 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
234 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
235 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
236 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
237 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
238 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
239 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
240 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
241 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
242 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
243 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
244 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
245 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.25
Rhizosphere 98.75
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10366233 3300005290 Bacteria 769
2 Ga0065715_10373781 3300005293 Bacteria 905
3 Ga0065715_10403299 3300005293 Bacteria 879
4 Ga0065715_10623254 3300005293 Unclassified 694
5 Ga0065715_10918578 3300005293 Bacteria 569
6 Ga0065707_10211202 3300005295 Bacteria 1265
7 Ga0065707_10278551 3300005295 Bacteria 1042
8 Ga0065707_10289751 3300005295 Unclassified 1028
9 Ga0065707_10569422 3300005295 Unclassified 709
10 Ga0070676_10475747 3300005328 Unclassified 883
11 Ga0070676_10684261 3300005328 Bacteria 748
12 Ga0070683_100003365 3300005329 Bacteria 12956
13 Ga0070683_100014059 3300005329 Bacteria 6991
14 Ga0070690_100001755 3300005330 Bacteria 11469
15 Ga0070670_100587073 3300005331 Bacteria 996
16 Ga0068869_100008192 3300005334 Bacteria 6725
17 Ga0068869_100130371 3300005334 Bacteria 1932
18 Ga0070666_10055332 3300005335 Bacteria 2678
19 Ga0070666_10247735 3300005335 Bacteria 1261
20 Ga0068868_100218052 3300005338 Bacteria 1596
21 Ga0068868_100912128 3300005338 Unclassified 799
22 Ga0070689_100029468 3300005340 Unclassified 4155
23 Ga0070689_100135028 3300005340 Bacteria 1981
24 Ga0070689_100408222 3300005340 Bacteria 1149
25 Ga0070691_10044838 3300005341 Unclassified 2097
26 Ga0070687_100062705 3300005343 Bacteria 1969
27 Ga0070687_100450186 3300005343 Unclassified 856
28 Ga0070687_100950881 3300005343 Bacteria 619
29 Ga0070668_100012081 3300005347 Bacteria 6432
30 Ga0070669_100058228 3300005353 Unclassified 2835
31 Ga0070669_100062239 3300005353 Bacteria 2743
32 Ga0070669_100168850 3300005353 Bacteria 1704
33 Ga0070669_100258026 3300005353 Bacteria 1390
34 Ga0070675_100476974 3300005354 Bacteria 1121
35 Ga0070671_100292907 3300005355 Bacteria 1385
36 Ga0070674_100206181 3300005356 Unclassified 1521
37 Ga0070674_100404639 3300005356 Bacteria 1116
38 Ga0070674_100748271 3300005356 Bacteria 840
39 Ga0070673_100245054 3300005364 Archaea 1560
40 Ga0070673_100407212 3300005364 Unclassified 1217
41 Ga0070673_100842734 3300005364 Unclassified 848
42 Ga0070673_101622710 3300005364 Bacteria 611
43 Ga0070688_100269429 3300005365 Unclassified 1219
44 Ga0070688_100306881 3300005365 Bacteria 1149
45 Ga0070688_100515902 3300005365 Bacteria 904
46 Ga0070688_100594654 3300005365 Unclassified 846
47 Ga0070659_100726945 3300005366 Unclassified 860
48 Ga0070659_100948145 3300005366 Bacteria 754
49 Ga0070667_100092099 3300005367 Unclassified 2607
50 Ga0070667_101108837 3300005367 Unclassified 740
51 Ga0070667_101260587 3300005367 Unclassified 692
52 Ga0070709_10077086 3300005434 Bacteria 2166
53 Ga0070713_100203812 3300005436 Bacteria 1788
54 Ga0070701_10163892 3300005438 Bacteria 1290
55 Ga0070701_10324189 3300005438 Archaea 954
56 Ga0070711_100364229 3300005439 Bacteria 1165
57 Ga0070705_100043384 3300005440 Unclassified 2577
58 Ga0070705_100117159 3300005440 Bacteria 1713
59 Ga0070705_100618811 3300005440 Unclassified 840
60 Ga0070694_100156012 3300005444 Unclassified 1671
61 Ga0070708_100078357 3300005445 Bacteria 2987
62 Ga0070708_100590953 3300005445 Bacteria 1047
63 Ga0070708_101405681 3300005445 Unclassified 651
64 Ga0070678_101329351 3300005456 Unclassified 669
65 Ga0070662_100031314 3300005457 Bacteria 3733
66 Ga0070662_100660953 3300005457 Bacteria 882
67 Ga0070681_10008049 3300005458 Bacteria 10318
68 Ga0068867_100021152 3300005459 Bacteria 4640
69 Ga0068867_100116402 3300005459 Unclassified 2060
70 Ga0068867_100216295 3300005459 Unclassified 1542
71 Ga0068867_100676905 3300005459 Unclassified 908
72 Ga0070685_10107744 3300005466 Bacteria 1711
73 Ga0070706_100848094 3300005467 Bacteria 845
74 Ga0070706_101752069 3300005467 Bacteria 565
75 Ga0070707_100136306 3300005468 Bacteria 2388
76 Ga0070707_100436139 3300005468 Bacteria 1270
77 Ga0070707_101561885 3300005468 Unclassified 627
78 Ga0070698_100610759 3300005471 Bacteria 1031
79 Ga0070698_101644408 3300005471 Unclassified 594
80 Ga0070699_100008658 3300005518 Bacteria 8819
81 Ga0070699_101315383 3300005518 Bacteria 663
82 Ga0070679_100087579 3300005530 Bacteria 3101
83 Ga0070684_100002184 3300005535 Bacteria 14445
84 Ga0070684_100012534 3300005535 Bacteria 6801
85 Ga0070684_100014590 3300005535 Bacteria 6369
86 Ga0070684_100036326 3300005535 Bacteria 4222
87 Ga0070684_100130643 3300005535 Bacteria 2265
88 Ga0070697_100265016 3300005536 Bacteria 1472
89 Ga0070697_100323285 3300005536 Unclassified 1329
90 Ga0070697_100650934 3300005536 Unclassified 928
91 Ga0070697_101432588 3300005536 Unclassified 617
92 Ga0070697_101848318 3300005536 Bacteria 540
93 Ga0068853_100042327 3300005539 Bacteria 3894
94 Ga0068853_100122531 3300005539 Bacteria 2321
95 Ga0068853_100249309 3300005539 Unclassified 1629
96 Ga0068853_100647525 3300005539 Bacteria 1005
97 Ga0068853_100727509 3300005539 Bacteria 948
98 Ga0070672_100081477 3300005543 Unclassified 2595
99 Ga0070672_100285364 3300005543 Bacteria 1397
100 Ga0070672_100579204 3300005543 Bacteria 976
101 Ga0070686_100011840 3300005544 Bacteria 4956
102 Ga0070686_100352569 3300005544 Archaea 1106
103 Ga0070686_100537869 3300005544 Unclassified 912
104 Ga0070695_100023533 3300005545 Bacteria 3787
105 Ga0070695_100453422 3300005545 Unclassified 983
106 Ga0070696_100036659 3300005546 Bacteria 3382
107 Ga0070696_100116865 3300005546 Bacteria 1927
108 Ga0070696_100409188 3300005546 Unclassified 1063
109 Ga0070696_100549520 3300005546 Unclassified 925
110 Ga0070693_100095233 3300005547 Bacteria 1803
111 Ga0070665_101150885 3300005548 Bacteria 787
112 Ga0070704_100001980 3300005549 Bacteria 11327
113 Ga0070704_100019169 3300005549 Bacteria 4392
114 Ga0070704_101428023 3300005549 Unclassified 635
115 Ga0068855_100205625 3300005563 Bacteria 2215
116 Ga0070664_100514559 3300005564 Unclassified 1104
117 Ga0070664_101295072 3300005564 Unclassified 688
118 Ga0068857_100002231 3300005577 Bacteria 15779
119 Ga0068857_100004743 3300005577 Bacteria 11517
120 Ga0068857_101620971 3300005577 Unclassified 632
121 Ga0068854_100041576 3300005578 Unclassified 3249
122 Ga0068854_101018312 3300005578 Bacteria 734
123 Ga0068854_101349318 3300005578 Bacteria 643
124 Ga0068856_100004931 3300005614 Bacteria 13214
125 Ga0068856_100041233 3300005614 Bacteria 4536
126 Ga0068856_100283614 3300005614 Bacteria 1673
127 Ga0068856_100474978 3300005614 Bacteria 1271
128 Ga0070702_100013446 3300005615 Bacteria 4132
129 Ga0070702_100402232 3300005615 Bacteria 980
130 Ga0068852_100036789 3300005616 Bacteria 4100
131 Ga0068859_100004436 3300005617 Bacteria 14320
132 Ga0068859_100389662 3300005617 Bacteria 1489
133 Ga0068859_100586946 3300005617 Unclassified 1208
134 Ga0068859_100736249 3300005617 Unclassified 1075
135 Ga0068859_101806942 3300005617 Bacteria 675
136 Ga0068866_10012669 3300005718 Bacteria 3680
137 Ga0068866_10341741 3300005718 Bacteria 948
138 Ga0068861_100052494 3300005719 Bacteria 3098
139 Ga0068861_100365336 3300005719 Bacteria 1270
140 Ga0068861_100413314 3300005719 Bacteria 1200
141 Ga0068861_100740753 3300005719 Unclassified 917
142 Ga0068863_100002248 3300005841 Bacteria 19175
143 Ga0068863_101030875 3300005841 Unclassified 826
144 Ga0068858_100126868 3300005842 Bacteria 2390
145 Ga0068858_100162156 3300005842 Bacteria 2105
146 Ga0068858_100331342 3300005842 Unclassified 1456
147 Ga0068858_100358703 3300005842 Bacteria 1397
148 Ga0068858_101459531 3300005842 Unclassified 674
149 Ga0068858_102269423 3300005842 Unclassified 536
150 Ga0068860_100016588 3300005843 Bacteria 7183
151 Ga0068860_100360332 3300005843 Bacteria 1432
152 Ga0068860_100824612 3300005843 Bacteria 941
153 Ga0068860_101174248 3300005843 Unclassified 788
154 Ga0068860_101218713 3300005843 Unclassified 773
155 Ga0068860_101230597 3300005843 Bacteria 769
156 Ga0068862_100025381 3300005844 Bacteria 4975
157 Ga0068862_100039769 3300005844 Bacteria 3996
158 Ga0068862_100168875 3300005844 Bacteria 1957
159 Ga0068862_100238312 3300005844 Unclassified 1653
160 Ga0068862_100382905 3300005844 Bacteria 1312
161 Ga0081455_10039863 3300005937 Bacteria 4146
162 Ga0075432_10148080 3300006058 Unclassified 900
163 Ga0097621_100015072 3300006237 Bacteria 5804
164 Ga0097621_100053718 3300006237 Bacteria 3284
165 Ga0097621_100315775 3300006237 Bacteria 1383
166 Ga0068871_100043737 3300006358 Bacteria 3599
167 Ga0068871_100232540 3300006358 Bacteria 1600
168 Ga0075428_100194367 3300006844 Bacteria 2194
169 Ga0075428_100210920 3300006844 Bacteria 2099
170 Ga0075428_101146298 3300006844 Bacteria 820
171 Ga0075430_100149681 3300006846 Bacteria 1944
172 Ga0075431_100316434 3300006847 Unclassified 1574
173 Ga0075431_100551023 3300006847 Bacteria 1140
174 Ga0075433_10038933 3300006852 Bacteria 4109
175 Ga0075433_10055981 3300006852 Bacteria 3444
176 Ga0075433_10143621 3300006852 Bacteria 2121
177 Ga0075433_10176595 3300006852 Bacteria 1901
178 Ga0075433_10292478 3300006852 Bacteria 1442
179 Ga0075433_10347596 3300006852 Bacteria 1311
180 Ga0075433_10827124 3300006852 Bacteria 809
181 Ga0075434_100000008 3300006871 Bacteria 92859
182 Ga0075434_100027537 3300006871 Bacteria 5582
183 Ga0075434_100055477 3300006871 Unclassified 3937
184 Ga0075434_100477790 3300006871 Bacteria 1267
185 Ga0075434_102260752 3300006871 Bacteria 547
186 Ga0075429_100120831 3300006880 Bacteria 2290
187 Ga0075429_100392232 3300006880 Bacteria 1216
188 Ga0075429_100647350 3300006880 Bacteria 926
189 Ga0075429_100946899 3300006880 Bacteria 753
190 Ga0068865_100080099 3300006881 Bacteria 2341
191 Ga0068865_100244775 3300006881 Bacteria 1412
192 Ga0075436_100000027 3300006914 Bacteria 97947
193 Ga0075436_100011040 3300006914 Bacteria 6197
194 Ga0075436_100045390 3300006914 Bacteria 3031
195 Ga0075436_100057458 3300006914 Unclassified 2687
196 Ga0075436_100122217 3300006914 Bacteria 1822
197 Ga0075436_100206366 3300006914 Bacteria 1392
198 Ga0075436_101138981 3300006914 Unclassified 588
199 Ga0097620_100004436 3300006931 Bacteria 14320
200 Ga0097620_100389638 3300006931 Bacteria 1489
201 Ga0097620_100586928 3300006931 Bacteria 1208
202 Ga0097620_100736330 3300006931 Unclassified 1075
203 Ga0097620_101806034 3300006931 Bacteria 675
204 Ga0075435_100000003 3300007076 Bacteria 124953
205 Ga0075435_100013881 3300007076 Bacteria 6007
206 Ga0075435_100141099 3300007076 Unclassified 2022
207 Ga0075435_100175645 3300007076 Bacteria 1809
208 Ga0075435_100193404 3300007076 Bacteria 1722
209 Ga0099794_10031037 3300007265 Bacteria 2499
210 Ga0105240_10059431 3300009093 Bacteria 4771
211 Ga0105240_10150780 3300009093 Unclassified 2769
212 Ga0105240_10216496 3300009093 Bacteria 2234
213 Ga0105240_10265781 3300009093 Bacteria 1977
214 Ga0105240_10494925 3300009093 Bacteria 1360
215 Ga0105240_10626738 3300009093 Bacteria 1181
216 Ga0105240_11020135 3300009093 Unclassified 884
217 Ga0111539_10009890 3300009094 Bacteria 12033
218 Ga0111539_10123852 3300009094 Bacteria 3030
219 Ga0111539_10183180 3300009094 Bacteria 2446
220 Ga0111539_10419571 3300009094 Bacteria 1558
221 Ga0111539_10566272 3300009094 Bacteria 1323
222 Ga0111539_10882244 3300009094 Unclassified 1040
223 Ga0111539_11306255 3300009094 Bacteria 842
224 Ga0105245_10000995 3300009098 Bacteria 25730
225 Ga0105245_10010053 3300009098 Bacteria 8243
226 Ga0105245_10016474 3300009098 Bacteria 6449
227 Ga0105245_10280874 3300009098 Unclassified 1627
228 Ga0105245_10342415 3300009098 Unclassified 1479
229 Ga0105245_10386342 3300009098 Bacteria 1395
230 Ga0105245_10518402 3300009098 Unclassified 1210
231 Ga0105245_10576985 3300009098 Bacteria 1149
232 Ga0105245_11288328 3300009098 Unclassified 780
233 Ga0114129_10002259 3300009147 Bacteria 26632
234 Ga0114129_10013616 3300009147 Bacteria 11587
235 Ga0114129_10020088 3300009147 Bacteria 9508
236 Ga0114129_10080667 3300009147 Bacteria 4522
237 Ga0114129_10158846 3300009147 Bacteria 3090
238 Ga0114129_10250487 3300009147 Bacteria 2378
239 Ga0114129_10639343 3300009147 Bacteria 1374
240 Ga0114129_10660927 3300009147 Bacteria 1348
241 Ga0114129_10711046 3300009147 Unclassified 1290
242 Ga0114129_11190981 3300009147 Unclassified 949
243 Ga0114129_12166573 3300009147 Unclassified 669
244 Ga0105243_10026001 3300009148 Bacteria 4479
245 Ga0105243_10028709 3300009148 Bacteria 4272
246 Ga0105243_10250631 3300009148 Bacteria 1580
247 Ga0105243_10333544 3300009148 Unclassified 1386
248 Ga0105241_10003993 3300009174 Bacteria 10905
249 Ga0105241_10004427 3300009174 Bacteria 10388
250 Ga0105241_10052491 3300009174 Bacteria 3113
251 Ga0105241_10090756 3300009174 Bacteria 2410
252 Ga0105241_10185185 3300009174 Bacteria 1730
253 Ga0105242_10021225 3300009176 Bacteria 5096
254 Ga0105242_10213542 3300009176 Bacteria 1721
255 Ga0105242_10361157 3300009176 Bacteria 1344
256 Ga0105242_10387470 3300009176 Bacteria 1301
257 Ga0105242_10421655 3300009176 Unclassified 1251
258 Ga0105242_11199483 3300009176 Bacteria 778
259 Ga0105242_11353167 3300009176 Bacteria 738
260 Ga0105248_10002352 3300009177 Bacteria 20987
261 Ga0105248_10044053 3300009177 Bacteria 5004
262 Ga0105248_10061746 3300009177 Bacteria 4208
263 Ga0105248_10122096 3300009177 Unclassified 2938
264 Ga0105248_10263057 3300009177 Bacteria 1942
265 Ga0105248_10595851 3300009177 Bacteria 1247
266 Ga0105248_10698211 3300009177 Bacteria 1145
267 Ga0105248_10731291 3300009177 Bacteria 1117
268 Ga0105248_11235203 3300009177 Unclassified 845
269 Ga0105248_11386353 3300009177 Unclassified 795
270 Ga0105248_11691672 3300009177 Unclassified 717
271 Ga0105237_10003834 3300009545 Bacteria 17679
272 Ga0105237_10050866 3300009545 Bacteria 4164
273 Ga0105237_10080424 3300009545 Bacteria 3249
274 Ga0105237_10330756 3300009545 Bacteria 1528
275 Ga0105237_10802424 3300009545 Bacteria 948
276 Ga0105238_10003582 3300009551 Bacteria 15484
277 Ga0105238_10008583 3300009551 Bacteria 10221
278 Ga0105238_10008740 3300009551 Bacteria 10133
279 Ga0105238_10040342 3300009551 Bacteria 4731
280 Ga0105238_11036808 3300009551 Unclassified 842
281 Ga0105249_10010002 3300009553 Bacteria 8322
282 Ga0105249_10082274 3300009553 Bacteria 2996
283 Ga0105249_10140243 3300009553 Unclassified 2317
284 Ga0105249_10252921 3300009553 Bacteria 1748
285 Ga0105249_10512227 3300009553 Bacteria 1246
286 Ga0105239_10001560 3300010375 Bacteria 30320
287 Ga0105239_10003467 3300010375 Bacteria 19300
288 Ga0105239_10005119 3300010375 Bacteria 15475
289 Ga0105239_10177067 3300010375 Bacteria 2385
290 Ga0105246_10007724 3300011119 Bacteria 6599
291 Ga0105246_10016536 3300011119 Bacteria 4671
292 Ga0105246_10022428 3300011119 Bacteria 4073
293 Ga0105246_10440855 3300011119 Unclassified 1092
294 Ga0157373_10397864 3300013100 Unclassified 987
295 Ga0157370_10012271 3300013104 Bacteria 8894
296 Ga0157369_10139285 3300013105 Bacteria 2568
297 Ga0157369_11102366 3300013105 Unclassified 811
298 Ga0157374_10058634 3300013296 Bacteria 3598
299 Ga0157374_10084437 3300013296 Bacteria 3018
300 Ga0157378_10003102 3300013297 Bacteria 14775
301 Ga0157378_10574705 3300013297 Archaea 1135
302 Ga0157378_10797341 3300013297 Unclassified 970
303 Ga0157378_11142677 3300013297 Unclassified 817
304 Ga0163162_10168635 3300013306 Bacteria 2313
305 Ga0163162_10890422 3300013306 Bacteria 1004
306 Ga0163162_11809243 3300013306 Bacteria 698
307 Ga0157372_10010127 3300013307 Bacteria 10015
308 Ga0157372_10028028 3300013307 Bacteria 6143
309 Ga0157372_10044505 3300013307 Bacteria 4919
310 Ga0157372_10356130 3300013307 Bacteria 1705
311 Ga0157375_10022810 3300013308 Bacteria 5765
312 Ga0157375_10173308 3300013308 Unclassified 2306
313 Ga0157375_10646228 3300013308 Bacteria 1214
314 Ga0163163_10011957 3300014325 Bacteria 7897
315 Ga0163163_10050827 3300014325 Bacteria 4083
316 Ga0163163_10061557 3300014325 Bacteria 3719
317 Ga0163163_10532008 3300014325 Bacteria 1238
318 Ga0163163_10563800 3300014325 Unclassified 1202
319 Ga0163163_11297927 3300014325 Bacteria 790
320 Ga0157380_10022436 3300014326 Bacteria 4752
321 Ga0157380_10396070 3300014326 Bacteria 1308
322 Ga0157380_10431496 3300014326 Bacteria 1260
323 Ga0157379_10036385 3300014968 Bacteria 4390
324 Ga0157379_10036482 3300014968 Bacteria 4382
325 Ga0157379_10037219 3300014968 Unclassified 4338
326 Ga0157379_10150448 3300014968 Bacteria 2099
327 Ga0157379_10307717 3300014968 Unclassified 1445
328 Ga0157376_10203321 3300014969 Bacteria 1824
329 Ga0157376_10218689 3300014969 Bacteria 1763
330 Ga0157376_10281898 3300014969 Bacteria 1565
331 Ga0163161_10411377 3300017792 Unclassified 1086
332 Ga0163161_10638212 3300017792 Bacteria 881
333 Ga0207697_10049771 3300025315 Unclassified 1730
334 Ga0207653_10238454 3300025885 Bacteria 694
335 Ga0207692_10830205 3300025898 Bacteria 605
336 Ga0207642_10050838 3300025899 Bacteria 1872
337 Ga0207642_10075643 3300025899 Unclassified 1618
338 Ga0207642_10449358 3300025899 Unclassified 781
339 Ga0207688_10207309 3300025901 Bacteria 1177
340 Ga0207680_10159721 3300025903 Unclassified 1510
341 Ga0207680_10163236 3300025903 Bacteria 1496
342 Ga0207685_10693485 3300025905 Unclassified 554
343 Ga0207699_10386857 3300025906 Unclassified 994
344 Ga0207645_10025740 3300025907 Unclassified 3806
345 Ga0207645_10037955 3300025907 Bacteria 3091
346 Ga0207645_10144208 3300025907 Bacteria 1552
347 Ga0207645_10541892 3300025907 Unclassified 789
348 Ga0207684_10773072 3300025910 Bacteria 813
349 Ga0207654_10004365 3300025911 Bacteria 7128
350 Ga0207654_10008452 3300025911 Bacteria 5205
351 Ga0207654_10073794 3300025911 Bacteria 2034
352 Ga0207654_10428409 3300025911 Unclassified 924
353 Ga0207654_10661438 3300025911 Unclassified 749
354 Ga0207707_10001082 3300025912 Bacteria 26051
355 Ga0207707_11361760 3300025912 Unclassified 568
356 Ga0207695_10001264 3300025913 Bacteria 43057
357 Ga0207695_10177848 3300025913 Bacteria 2049
358 Ga0207695_10304252 3300025913 Unclassified 1485
359 Ga0207695_10355257 3300025913 Bacteria 1352
360 Ga0207695_10948776 3300025913 Bacteria 740
361 Ga0207671_10003366 3300025914 Bacteria 16036
362 Ga0207671_10004291 3300025914 Bacteria 13713
363 Ga0207671_10636530 3300025914 Bacteria 849
364 Ga0207663_10036173 3300025916 Bacteria 2969
365 Ga0207663_10553727 3300025916 Bacteria 899
366 Ga0207660_10039300 3300025917 Bacteria 3307
367 Ga0207662_10165925 3300025918 Unclassified 1414
368 Ga0207662_11160315 3300025918 Bacteria 549
369 Ga0207657_11195673 3300025919 Unclassified 578
370 Ga0207649_10525386 3300025920 Bacteria 903
371 Ga0207652_10006515 3300025921 Bacteria 9413
372 Ga0207646_10386952 3300025922 Bacteria 1263
373 Ga0207646_10464150 3300025922 Bacteria 1142
374 Ga0207646_10681486 3300025922 Unclassified 920
375 Ga0207646_11936896 3300025922 Bacteria 502
376 Ga0207681_10043546 3300025923 Unclassified 3005
377 Ga0207681_10172124 3300025923 Bacteria 1642
378 Ga0207681_10256114 3300025923 Bacteria 1368
379 Ga0207681_10699549 3300025923 Unclassified 843
380 Ga0207694_10000985 3300025924 Bacteria 24968
381 Ga0207694_10088360 3300025924 Unclassified 2443
382 Ga0207694_11438090 3300025924 Unclassified 582
383 Ga0207659_10138714 3300025926 Bacteria 1885
384 Ga0207687_10001118 3300025927 Bacteria 18248
385 Ga0207687_10013555 3300025927 Bacteria 5321
386 Ga0207687_10185179 3300025927 Bacteria 1616
387 Ga0207687_11281435 3300025927 Unclassified 630
388 Ga0207700_10055679 3300025928 Bacteria 2973
389 Ga0207644_10049191 3300025931 Bacteria 3017
390 Ga0207644_10194493 3300025931 Unclassified 1596
391 Ga0207644_10286280 3300025931 Bacteria 1324
392 Ga0207706_10103492 3300025933 Bacteria 2505
393 Ga0207686_10002961 3300025934 Bacteria 9155
394 Ga0207686_10044422 3300025934 Bacteria 2728
395 Ga0207686_10052381 3300025934 Bacteria 2547
396 Ga0207686_10229808 3300025934 Bacteria 1344
397 Ga0207686_10874442 3300025934 Archaea 724
398 Ga0207709_10081823 3300025935 Bacteria 2083
399 Ga0207709_10252965 3300025935 Unclassified 1288
400 Ga0207709_11055297 3300025935 Archaea 666
401 Ga0207709_11292282 3300025935 Unclassified 603
402 Ga0207670_10037852 3300025936 Unclassified 3146
403 Ga0207670_10247515 3300025936 Bacteria 1376
404 Ga0207670_10259592 3300025936 Bacteria 1346
405 Ga0207670_10947687 3300025936 Unclassified 722
406 Ga0207670_11669161 3300025936 Bacteria 542
407 Ga0207670_11728033 3300025936 Unclassified 532
408 Ga0207669_10084910 3300025937 Bacteria 2042
409 Ga0207669_11458449 3300025937 Unclassified 583
410 Ga0207704_10038582 3300025938 Bacteria 2772
411 Ga0207704_10965880 3300025938 Bacteria 719
412 Ga0207665_10088056 3300025939 Bacteria 2147
413 Ga0207691_10032228 3300025940 Unclassified 4887
414 Ga0207711_10038447 3300025941 Unclassified 4069
415 Ga0207711_10116322 3300025941 Bacteria 2384
416 Ga0207711_10299374 3300025941 Unclassified 1483
417 Ga0207711_10614462 3300025941 Bacteria 1014
418 Ga0207711_11123535 3300025941 Unclassified 727
419 Ga0207689_10021246 3300025942 Bacteria 5457
420 Ga0207689_10113291 3300025942 Bacteria 2230
421 Ga0207661_10000365 3300025944 Bacteria 29025
422 Ga0207661_10003386 3300025944 Bacteria 11073
423 Ga0207661_10285687 3300025944 Bacteria 1475
424 Ga0207661_10395542 3300025944 Bacteria 1252
425 Ga0207667_10002201 3300025949 Bacteria 24454
426 Ga0207651_10217939 3300025960 Archaea 1541
427 Ga0207651_10309662 3300025960 Bacteria 1316
428 Ga0207712_10122621 3300025961 Unclassified 1969
429 Ga0207712_10378796 3300025961 Bacteria 1184
430 Ga0207712_11006337 3300025961 Bacteria 740
431 Ga0207712_11028681 3300025961 Bacteria 731
432 Ga0207712_11309766 3300025961 Unclassified 647
433 Ga0207668_10768899 3300025972 Unclassified 851
434 Ga0207668_10769373 3300025972 Bacteria 850
435 Ga0207640_10859119 3300025981 Unclassified 790
436 Ga0207640_10964881 3300025981 Unclassified 748
437 Ga0207658_10314454 3300025986 Bacteria 1354
438 Ga0207677_10178308 3300026023 Bacteria 1669
439 Ga0207677_10449299 3300026023 Bacteria 1104
440 Ga0207677_10964686 3300026023 Bacteria 771
441 Ga0207703_10120667 3300026035 Bacteria 2250
442 Ga0207703_10385184 3300026035 Unclassified 1298
443 Ga0207703_10436162 3300026035 Bacteria 1221
444 Ga0207703_11273595 3300026035 Unclassified 707
445 Ga0207703_11283445 3300026035 Bacteria 704
446 Ga0207639_10032444 3300026041 Bacteria 3845
447 Ga0207639_10248516 3300026041 Bacteria 1550
448 Ga0207639_10465975 3300026041 Bacteria 1149
449 Ga0207639_11300627 3300026041 Unclassified 682
450 Ga0207708_10011567 3300026075 Bacteria 6576
451 Ga0207708_10026291 3300026075 Bacteria 4404
452 Ga0207708_10125138 3300026075 Bacteria 2006
453 Ga0207702_10705357 3300026078 Bacteria 994
454 Ga0207641_10002063 3300026088 Bacteria 19079
455 Ga0207641_10878293 3300026088 Unclassified 890
456 Ga0207641_11254359 3300026088 Bacteria 741
457 Ga0207641_11861595 3300026088 Bacteria 603
458 Ga0207648_10031143 3300026089 Bacteria 4716
459 Ga0207648_10047304 3300026089 Unclassified 3771
460 Ga0207648_10138703 3300026089 Bacteria 2143
461 Ga0207648_10651937 3300026089 Bacteria 973
462 Ga0207674_10000042 3300026116 Bacteria 126790
463 Ga0207674_10004196 3300026116 Bacteria 17388
464 Ga0207674_10725777 3300026116 Unclassified 959
465 Ga0207675_100122073 3300026118 Unclassified 2466
466 Ga0207675_100211171 3300026118 Bacteria 1867
467 Ga0207675_100217770 3300026118 Bacteria 1839
468 Ga0207675_100231408 3300026118 Unclassified 1783
469 Ga0207675_100590974 3300026118 Bacteria 1112
470 Ga0207675_102478749 3300026118 Unclassified 530
471 Ga0268265_10009546 3300028380 Bacteria 6553
472 Ga0268265_10035070 3300028380 Unclassified 3662
473 Ga0268265_10181899 3300028380 Unclassified 1807
474 Ga0268265_10586421 3300028380 Bacteria 1063
475 Ga0268265_10665752 3300028380 Bacteria 1002
476 Ga0268265_11743442 3300028380 Unclassified 629
477 Ga0268264_10247806 3300028381 Unclassified 1653
478 Ga0268264_10394032 3300028381 Bacteria 1329
479 Ga0268264_10522970 3300028381 Unclassified 1160
480 Ga0268264_11301584 3300028381 Unclassified 737
481 Ga0265318_10313029 3300028577 Bacteria 573
482 Ga0307408_102052516 3300031548 Bacteria 550
483 Ga0265313_10006767 3300031595 Bacteria 8019
484 Ga0373948_0113580 3300034817 Unclassified 649
485 Ga0373958_0000467 3300034819 Bacteria 4954
486 Ga0373959_0000365 3300034820 Bacteria 9011
487 Ga0373928_0004057 3300035084 Bacteria 2795
488 Ga0373929_0002432 3300035085 Bacteria 3420
489 Ga0373934_0002765 3300035086 Bacteria 6432
490 Ga0373934_0240822 3300035086 Bacteria 747
491 Ga0373940_0000042 3300035088 Bacteria 13879
492 Ga0373951_0004493 3300035091 Bacteria 3309
493 Ga0373952_0001618 3300035092 Bacteria 4097
494 Ga0373923_0076298 3300035111 Bacteria 1447
495 Ga0373932_0000932 3300035112 Bacteria 8556
496 Ga0373936_0094527 3300035113 Bacteria 1256
497 Ga0373936_0108637 3300035113 Bacteria 1176
498 Ga0373939_0194113 3300035114 Unclassified 764
499 Ga0373941_0009794 3300035115 Bacteria 2423
500 Ga0373941_0147089 3300035115 Bacteria 861
501 Ga0373953_0014028 3300035117 Unclassified 2875
502 Ga0373953_0044960 3300035117 Bacteria 1768
503 Ga0373954_0005904 3300035118 Bacteria 5322
504 Ga0373954_0494466 3300035118 Bacteria 606
505 Ga0373956_0616574 3300035119 Bacteria 518
506 Ga0373960_0014458 3300035121 Bacteria 2000
507 Ga0373943_0288074 3300035170 Unclassified 930
508 Ga0373955_0003733 3300035172 Bacteria 6708
509 Ga0373955_0024298 3300035172 Bacteria 3098
510 Ga0373955_0100013 3300035172 Bacteria 1663
511 Ga0373955_0425656 3300035172 Unclassified 808
512 Ga0373961_0003447 3300035241 Bacteria 3912
513 Ga0373924_0033660 3300035410 Bacteria 2070
514 Ga0373924_0236576 3300035410 Bacteria 808
515 Ga0373931_0001065 3300035691 Bacteria 11607
516 Ga0373935_0123876 3300035692 Bacteria 1730
517 Ga0373935_0143489 3300035692 Bacteria 1615
518 Ga0373927_0341039 3300035695 Unclassified 987
519 Ga0373933_0008593 3300035724 Bacteria 5570
520 Ga0373933_0064300 3300035724 Bacteria 2219
521 Ga0373937_0005019 3300036401 Bacteria 11262
522 Ga0373937_0010310 3300036401 Bacteria 8156
523 Ga0373937_0026597 3300036401 Bacteria 5228
524 Ga0373937_0145960 3300036401 Bacteria 2215
525 Ga0373937_0725743 3300036401 Bacteria 941
526 Ga0373937_1278156 3300036401 Unclassified 682
527 Ga0373937_1585673 3300036401 Unclassified 602
528 Ga0373925_1160086 3300037068 Unclassified 635
529 Ga0395898_1130371 3300037466 Unclassified 716
530 Ga0395901_0740811 3300038443 Bacteria 977
531 Ga0439455_0254181 3300042012 Unclassified 515
532 Ga0451576_0005340 3300045051 Bacteria 16151
533 Ga0451576_0151111 3300045051 Unclassified 2422
534 Ga0495592_0290259 3300046454 Bacteria 1066
535 Ga0495651_0449080 3300046462 Unclassified 833
536 Ga0495651_0475942 3300046462 Unclassified 803
537 Ga0495653_0307631 3300046463 Bacteria 1032
538 Ga0495580_0137993 3300046472 Bacteria 1691
539 Ga0495639_0424335 3300046475 Unclassified 673
540 Ga0495664_0033136 3300046477 Bacteria 3036
541 Ga0495594_0467512 3300046499 Unclassified 717
542 Ga0495608_0133456 3300046511 Bacteria 1588
543 Ga0495628_0249933 3300046516 Unclassified 1324
544 Ga0495630_0383536 3300046517 Unclassified 1077
545 Ga0495666_0080436 3300046526 Bacteria 1542
546 Ga0495652_0026824 3300046529 Bacteria 5083
547 Ga0495652_0200045 3300046529 Unclassified 1517
548 Ga0495665_0048124 3300046531 Bacteria 2261
549 Ga0495640_0023882 3300046533 Bacteria 4448
550 Ga0495586_0022817 3300046535 Bacteria 3340
551 Ga0495586_0035520 3300046535 Unclassified 2678
552 Ga0495586_0104367 3300046535 Bacteria 1575
553 Ga0495586_0323360 3300046535 Bacteria 885
554 Ga0495587_0069604 3300046536 Unclassified 2049
555 Ga0495587_0102177 3300046536 Bacteria 1651
556 Ga0495598_0358009 3300046537 Unclassified 563
557 Ga0495645_0187300 3300046543 Bacteria 1413
558 Ga0495645_0524007 3300046543 Bacteria 738
559 Ga0495645_0701014 3300046543 Unclassified 615
560 Ga0495667_0598797 3300046559 Bacteria 687
561 Ga0495656_0634522 3300046615 Unclassified 573
562 Ga0495634_0043856 3300046642 Bacteria 3030
563 Ga0495657_0557734 3300046675 Bacteria 665
564 Ga0495599_0015319 3300046678 Bacteria 4757
565 Ga0495658_0009241 3300046683 Bacteria 4903
566 Ga0495658_0765601 3300046683 Unclassified 618
567 Ga0495613_0235160 3300046689 Bacteria 1282
568 Ga0495624_0461651 3300046690 Bacteria 761
569 Ga0495604_0420209 3300047317 Unclassified 878
570 Ga0495604_0606565 3300047317 Unclassified 701
571 Ga0495674_0010765 3300047319 Bacteria 8652
572 Ga0495680_0239275 3300047322 Bacteria 1290
573 Ga0495680_0965715 3300047322 Bacteria 546
574 Ga0495675_0034828 3300047444 Unclassified 3215
575 Ga0495684_0018073 3300047471 Bacteria 5433
576 Ga0495684_0628237 3300047471 Bacteria 721
577 Ga0495684_0698594 3300047471 Unclassified 673
578 Ga0495593_0470703 3300047673 Unclassified 629
579 Ga0495602_0104389 3300048088 Bacteria 2318
580 Ga0495602_0837345 3300048088 Unclassified 616
581 Ga0495602_0893765 3300048088 Unclassified 591
582 Ga0496101_0180416 3300048904 Unclassified 1626
583 Ga0496102_0092827 3300048905 Bacteria 2796
584 Ga0496102_1030270 3300048905 Bacteria 743
585 Ga0496104_0070864 3300048907 Unclassified 3315
586 Ga0496106_0242260 3300048909 Bacteria 1441
587 Ga0496106_1545080 3300048909 Unclassified 510
588 Ga0496107_0432121 3300048910 Unclassified 979
589 Ga0496112_0455489 3300048915 Unclassified 1217
590 nmdc:mga05p37_1363594_c1 3300050507 Unclassified 717
591 nmdc:mga05p37_191440_c1 3300050507 Bacteria 2483
592 nmdc:mga05p37_2297_c1 3300050507 Bacteria 22293
593 nmdc:mga05p37_271227_c1 3300050507 Unclassified 2027
594 nmdc:mga05p37_29151_c1 3300050507 Bacteria 6737
595 nmdc:mga05p37_30104_c1 3300050507 Bacteria 6624
596 nmdc:mga05p37_371285_c1 3300050507 Bacteria 1679
597 nmdc:mga05p37_37360_c1 3300050507 Bacteria 5954
598 nmdc:mga05p37_39838_c1 3300050507 Bacteria 5770
599 nmdc:mga09592_1567812_c1 3300050508 Unclassified 534
600 nmdc:mga09592_592880_c1 3300050508 Bacteria 950
601 nmdc:mga09592_763997_c1 3300050508 Bacteria 819
602 nmdc:mga0qj67_153642_c1 3300050509 Bacteria 1867
603 nmdc:mga06r32_17814_c1 3300050510 Bacteria 6490
604 nmdc:mga06r32_868900_c1 3300050510 Unclassified 860
605 nmdc:mga08y16_339184_c1 3300050511 Unclassified 1545
606 nmdc:mga08y16_485559_c1 3300050511 Bacteria 1257
607 nmdc:mga08y16_518139_c1 3300050511 Bacteria 1210
608 nmdc:mga08y16_66734_c1 3300050511 Bacteria 3755
609 nmdc:mga08y16_697457_c1 3300050511 Unclassified 1015
610 nmdc:mga0n895_1223632_c1 3300050512 Bacteria 724
611 nmdc:mga0n895_123345_c1 3300050512 Bacteria 2613
612 nmdc:mga0n895_125649_c1 3300050512 Bacteria 2589
613 nmdc:mga0n895_3651_c1 3300050512 Bacteria 12443
614 nmdc:mga0n895_40_c1 3300050512 Bacteria 75471
615 nmdc:mga0n895_579955_c1 3300050512 Unclassified 1125
616 nmdc:mga0rr50_101519_c1 3300050513 Bacteria 2262
617 nmdc:mga0rr50_154265_c1 3300050513 Bacteria 1859
618 nmdc:mga0rr50_189094_c1 3300050513 Bacteria 1686
619 nmdc:mga0rr50_205034_c1 3300050513 Unclassified 1622
620 nmdc:mga0rr50_45958_c1 3300050513 Bacteria 3213
621 nmdc:mga0rr50_7_c1 3300050513 Bacteria 297175
622 nmdc:mga08x19_1023369_c1 3300050514 Unclassified 587
623 nmdc:mga08x19_14795_c1 3300050514 Bacteria 4738
624 nmdc:mga08x19_163365_c1 3300050514 Bacteria 1513
625 nmdc:mga08x19_25613_c1 3300050514 Bacteria 3676
626 nmdc:mga08x19_386379_c1 3300050514 Bacteria 981
627 nmdc:mga08x19_521435_c1 3300050514 Unclassified 840
628 nmdc:mga08x19_60_c1 3300050514 Bacteria 116399
629 nmdc:mga0a205_125561_c1 3300050515 Bacteria 2465
630 nmdc:mga0a205_155034_c1 3300050515 Unclassified 2189
631 nmdc:mga0a205_189126_c1 3300050515 Bacteria 1951
632 nmdc:mga0a205_22891_c1 3300050515 Bacteria 5924
633 nmdc:mga0a205_35320_c1 3300050515 Bacteria 4799
634 nmdc:mga0a205_388808_c1 3300050515 Unclassified 1259
635 nmdc:mga0a205_61187_c1 3300050515 Bacteria 3636
636 Ga0495601_0048766 3300053077 Bacteria 2668
637 Ga0495601_0690615 3300053077 Unclassified 652
638 Ga0495595_0208898 3300053084 Unclassified 973
639 Ga0495595_0678147 3300053084 Unclassified 528
640 Ga0495619_0026818 3300053085 Bacteria 3709

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037466 Ga0395898_1130371 Ga0395898_1130371_216_626 136
2 3300047317 Ga0495604_0606565 Ga0495604_0606565_23_433 136
3 3300048909 Ga0496106_1545080 Ga0496106_1545080_11_436 136
4 3300046537 Ga0495598_0358009 Ga0495598_0358009_19_432 137
5 3300035118 Ga0373954_0494466 Ga0373954_0494466_131_547 138
6 3300046675 Ga0495657_0557734 Ga0495657_0557734_228_644 138
7 3300009176 Ga0105242_11353167 Ga0105242_113531671 139
8 3300031548 Ga0307408_102052516 Ga0307408_1020525161 139
9 3300005468 Ga0070707_101561885 Ga0070707_1015618851 140
10 3300005564 Ga0070664_101295072 Ga0070664_1012950721 140
11 3300006847 Ga0075431_100316434 Ga0075431_1003164343 140
12 3300006852 Ga0075433_10143621 Ga0075433_101436212 140
13 3300006880 Ga0075429_100392232 Ga0075429_1003922322 140
14 3300025912 Ga0207707_11361760 Ga0207707_113617601 140
15 3300025972 Ga0207668_10768899 Ga0207668_107688992 140
16 3300036401 Ga0373937_0145960 Ga0373937_0145960_1214_1651 140
17 3300036401 Ga0373937_1278156 Ga0373937_1278156_158_580 140
18 3300046543 Ga0495645_0524007 Ga0495645_0524007_188_625 140
19 3300050507 nmdc:mga05p37_371285_c1 nmdc:mga05p37_371285_c1_474_935 140
20 3300050508 nmdc:mga09592_1567812_c1 nmdc:mga09592_1567812_c1_53_514 140
21 3300050510 nmdc:mga06r32_868900_c1 nmdc:mga06r32_868900_c1_151_612 140
22 3300050512 nmdc:mga0n895_579955_c1 nmdc:mga0n895_579955_c1_577_1038 140
23 3300050515 nmdc:mga0a205_189126_c1 nmdc:mga0a205_189126_c1_1249_1710 140
24 3300005329 Ga0070683_100003365 Ga0070683_10000336511 141
25 3300005329 Ga0070683_100014059 Ga0070683_1000140593 141
26 3300005334 Ga0068869_100008192 Ga0068869_1000081924 141
27 3300005334 Ga0068869_100130371 Ga0068869_1001303712 141
28 3300005338 Ga0068868_100218052 Ga0068868_1002180522 141
29 3300005340 Ga0070689_100029468 Ga0070689_1000294685 141
30 3300005340 Ga0070689_100408222 Ga0070689_1004082222 141
31 3300005343 Ga0070687_100950881 Ga0070687_1009508811 141
32 3300005364 Ga0070673_100407212 Ga0070673_1004072122 141
33 3300005365 Ga0070688_100269429 Ga0070688_1002694292 141
34 3300005366 Ga0070659_100726945 Ga0070659_1007269452 141
35 3300005436 Ga0070713_100203812 Ga0070713_1002038123 141
36 3300005439 Ga0070711_100364229 Ga0070711_1003642292 141
37 3300005457 Ga0070662_100031314 Ga0070662_1000313143 141
38 3300005458 Ga0070681_10008049 Ga0070681_100080493 141
39 3300005459 Ga0068867_100021152 Ga0068867_1000211522 141
40 3300005471 Ga0070698_101644408 Ga0070698_1016444081 141
41 3300005530 Ga0070679_100087579 Ga0070679_1000875793 141
42 3300005535 Ga0070684_100002184 Ga0070684_10000218410 141
43 3300005535 Ga0070684_100012534 Ga0070684_1000125345 141
44 3300005535 Ga0070684_100014590 Ga0070684_1000145906 141
45 3300005535 Ga0070684_100036326 Ga0070684_1000363263 141
46 3300005535 Ga0070684_100130643 Ga0070684_1001306433 141
47 3300005539 Ga0068853_100042327 Ga0068853_1000423274 141
48 3300005539 Ga0068853_100122531 Ga0068853_1001225313 141
49 3300005539 Ga0068853_100647525 Ga0068853_1006475252 141
50 3300005539 Ga0068853_100727509 Ga0068853_1007275092 141
51 3300005543 Ga0070672_100285364 Ga0070672_1002853642 141
52 3300005544 Ga0070686_100537869 Ga0070686_1005378691 141
53 3300005547 Ga0070693_100095233 Ga0070693_1000952332 141
54 3300005563 Ga0068855_100205625 Ga0068855_1002056253 141
55 3300005564 Ga0070664_100514559 Ga0070664_1005145592 141
56 3300005577 Ga0068857_100002231 Ga0068857_1000022317 141
57 3300005577 Ga0068857_100004743 Ga0068857_1000047434 141
58 3300005578 Ga0068854_101018312 Ga0068854_1010183122 141
59 3300005614 Ga0068856_100004931 Ga0068856_10000493111 141
60 3300005614 Ga0068856_100041233 Ga0068856_1000412335 141
61 3300005614 Ga0068856_100283614 Ga0068856_1002836142 141
62 3300005614 Ga0068856_100474978 Ga0068856_1004749782 141
63 3300005616 Ga0068852_100036789 Ga0068852_1000367895 141
64 3300005617 Ga0068859_100004436 Ga0068859_1000044366 141
65 3300005617 Ga0068859_100389662 Ga0068859_1003896622 141
66 3300005617 Ga0068859_100736249 Ga0068859_1007362492 141
67 3300005718 Ga0068866_10341741 Ga0068866_103417412 141
68 3300005719 Ga0068861_100413314 Ga0068861_1004133142 141
69 3300005841 Ga0068863_101030875 Ga0068863_1010308752 141
70 3300005842 Ga0068858_100126868 Ga0068858_1001268683 141
71 3300005842 Ga0068858_100331342 Ga0068858_1003313422 141
72 3300005842 Ga0068858_101459531 Ga0068858_1014595312 141
73 3300005843 Ga0068860_100016588 Ga0068860_1000165881 141
74 3300005843 Ga0068860_100360332 Ga0068860_1003603322 141
75 3300005843 Ga0068860_101218713 Ga0068860_1012187132 141
76 3300005843 Ga0068860_101230597 Ga0068860_1012305972 141
77 3300006237 Ga0097621_100015072 Ga0097621_1000150723 141
78 3300006237 Ga0097621_100053718 Ga0097621_1000537184 141
79 3300006358 Ga0068871_100043737 Ga0068871_1000437373 141
80 3300006358 Ga0068871_100232540 Ga0068871_1002325402 141
81 3300006846 Ga0075430_100149681 Ga0075430_1001496812 141
82 3300006847 Ga0075431_100551023 Ga0075431_1005510232 141
83 3300006881 Ga0068865_100080099 Ga0068865_1000800992 141
84 3300006881 Ga0068865_100244775 Ga0068865_1002447752 141
85 3300006931 Ga0097620_100004436 Ga0097620_1000044366 141
86 3300006931 Ga0097620_100389638 Ga0097620_1003896382 141
87 3300006931 Ga0097620_100736330 Ga0097620_1007363302 141
88 3300009093 Ga0105240_10059431 Ga0105240_100594313 141
89 3300009093 Ga0105240_10216496 Ga0105240_102164961 141
90 3300009093 Ga0105240_10265781 Ga0105240_102657812 141
91 3300009093 Ga0105240_10626738 Ga0105240_106267382 141
92 3300009093 Ga0105240_11020135 Ga0105240_110201351 141
93 3300009098 Ga0105245_10000995 Ga0105245_1000099512 141
94 3300009098 Ga0105245_10010053 Ga0105245_100100533 141
95 3300009098 Ga0105245_10016474 Ga0105245_100164744 141
96 3300009098 Ga0105245_10386342 Ga0105245_103863422 141
97 3300009098 Ga0105245_10518402 Ga0105245_105184022 141
98 3300009098 Ga0105245_10576985 Ga0105245_105769852 141
99 3300009098 Ga0105245_11288328 Ga0105245_112883282 141
100 3300009147 Ga0114129_10250487 Ga0114129_102504872 141
101 3300009147 Ga0114129_12166573 Ga0114129_121665731 141
102 3300009148 Ga0105243_10250631 Ga0105243_102506312 141
103 3300009148 Ga0105243_10333544 Ga0105243_103335442 141
104 3300009174 Ga0105241_10003993 Ga0105241_100039935 141
105 3300009174 Ga0105241_10004427 Ga0105241_100044276 141
106 3300009174 Ga0105241_10090756 Ga0105241_100907562 141
107 3300009174 Ga0105241_10185185 Ga0105241_101851852 141
108 3300009176 Ga0105242_10021225 Ga0105242_100212256 141
109 3300009176 Ga0105242_10213542 Ga0105242_102135421 141
110 3300009176 Ga0105242_10361157 Ga0105242_103611572 141
111 3300009176 Ga0105242_10421655 Ga0105242_104216552 141
112 3300009177 Ga0105248_10002352 Ga0105248_1000235215 141
113 3300009177 Ga0105248_10044053 Ga0105248_100440537 141
114 3300009177 Ga0105248_10595851 Ga0105248_105958512 141
115 3300009177 Ga0105248_10698211 Ga0105248_106982112 141
116 3300009545 Ga0105237_10003834 Ga0105237_1000383412 141
117 3300009545 Ga0105237_10050866 Ga0105237_100508661 141
118 3300009545 Ga0105237_10080424 Ga0105237_100804242 141
119 3300009545 Ga0105237_10330756 Ga0105237_103307562 141
120 3300009545 Ga0105237_10802424 Ga0105237_108024242 141
121 3300009551 Ga0105238_10003582 Ga0105238_100035826 141
122 3300009551 Ga0105238_10008583 Ga0105238_100085834 141
123 3300009551 Ga0105238_10008740 Ga0105238_100087403 141
124 3300009551 Ga0105238_10040342 Ga0105238_100403424 141
125 3300009553 Ga0105249_10010002 Ga0105249_100100024 141
126 3300009553 Ga0105249_10252921 Ga0105249_102529212 141
127 3300010375 Ga0105239_10001560 Ga0105239_1000156014 141
128 3300010375 Ga0105239_10003467 Ga0105239_1000346712 141
129 3300010375 Ga0105239_10005119 Ga0105239_100051194 141
130 3300010375 Ga0105239_10177067 Ga0105239_101770673 141
131 3300011119 Ga0105246_10007724 Ga0105246_100077242 141
132 3300011119 Ga0105246_10016536 Ga0105246_100165363 141
133 3300011119 Ga0105246_10022428 Ga0105246_100224282 141
134 3300011119 Ga0105246_10440855 Ga0105246_104408551 141
135 3300013100 Ga0157373_10397864 Ga0157373_103978642 141
136 3300013104 Ga0157370_10012271 Ga0157370_100122712 141
137 3300013105 Ga0157369_10139285 Ga0157369_101392853 141
138 3300013105 Ga0157369_11102366 Ga0157369_111023662 141
139 3300013296 Ga0157374_10058634 Ga0157374_100586343 141
140 3300013296 Ga0157374_10084437 Ga0157374_100844372 141
141 3300013297 Ga0157378_10003102 Ga0157378_100031029 141
142 3300013297 Ga0157378_10797341 Ga0157378_107973412 141
143 3300013306 Ga0163162_11809243 Ga0163162_118092431 141
144 3300013307 Ga0157372_10010127 Ga0157372_100101274 141
145 3300013307 Ga0157372_10028028 Ga0157372_100280286 141
146 3300013307 Ga0157372_10044505 Ga0157372_100445051 141
147 3300013307 Ga0157372_10356130 Ga0157372_103561302 141
148 3300013308 Ga0157375_10022810 Ga0157375_100228103 141
149 3300013308 Ga0157375_10646228 Ga0157375_106462282 141
150 3300014325 Ga0163163_10011957 Ga0163163_100119572 141
151 3300014325 Ga0163163_10050827 Ga0163163_100508274 141
152 3300014325 Ga0163163_10532008 Ga0163163_105320082 141
153 3300014325 Ga0163163_10563800 Ga0163163_105638002 141
154 3300014325 Ga0163163_11297927 Ga0163163_112979272 141
155 3300014968 Ga0157379_10036385 Ga0157379_100363854 141
156 3300014968 Ga0157379_10150448 Ga0157379_101504482 141
157 3300014968 Ga0157379_10307717 Ga0157379_103077172 141
158 3300014969 Ga0157376_10203321 Ga0157376_102033212 141
159 3300014969 Ga0157376_10218689 Ga0157376_102186891 141
160 3300014969 Ga0157376_10281898 Ga0157376_102818982 141
161 3300025898 Ga0207692_10830205 Ga0207692_108302051 141
162 3300025899 Ga0207642_10050838 Ga0207642_100508383 141
163 3300025899 Ga0207642_10449358 Ga0207642_104493581 141
164 3300025905 Ga0207685_10693485 Ga0207685_106934851 141
165 3300025907 Ga0207645_10541892 Ga0207645_105418921 141
166 3300025911 Ga0207654_10004365 Ga0207654_100043651 141
167 3300025911 Ga0207654_10008452 Ga0207654_100084524 141
168 3300025911 Ga0207654_10073794 Ga0207654_100737942 141
169 3300025911 Ga0207654_10428409 Ga0207654_104284091 141
170 3300025911 Ga0207654_10661438 Ga0207654_106614382 141
171 3300025912 Ga0207707_10001082 Ga0207707_100010824 141
172 3300025913 Ga0207695_10001264 Ga0207695_1000126422 141
173 3300025913 Ga0207695_10177848 Ga0207695_101778482 141
174 3300025913 Ga0207695_10948776 Ga0207695_109487761 141
175 3300025914 Ga0207671_10003366 Ga0207671_1000336611 141
176 3300025914 Ga0207671_10004291 Ga0207671_100042918 141
177 3300025914 Ga0207671_10636530 Ga0207671_106365302 141
178 3300025916 Ga0207663_10036173 Ga0207663_100361733 141
179 3300025916 Ga0207663_10553727 Ga0207663_105537272 141
180 3300025917 Ga0207660_10039300 Ga0207660_100393002 141
181 3300025918 Ga0207662_11160315 Ga0207662_111603151 141
182 3300025919 Ga0207657_11195673 Ga0207657_111956731 141
183 3300025920 Ga0207649_10525386 Ga0207649_105253862 141
184 3300025921 Ga0207652_10006515 Ga0207652_1000651510 141
185 3300025922 Ga0207646_11936896 Ga0207646_119368961 141
186 3300025924 Ga0207694_10000985 Ga0207694_1000098521 141
187 3300025924 Ga0207694_10088360 Ga0207694_100883602 141
188 3300025924 Ga0207694_11438090 Ga0207694_114380902 141
189 3300025927 Ga0207687_10001118 Ga0207687_100011188 141
190 3300025927 Ga0207687_10013555 Ga0207687_100135552 141
191 3300025927 Ga0207687_10185179 Ga0207687_101851792 141
192 3300025927 Ga0207687_11281435 Ga0207687_112814351 141
193 3300025928 Ga0207700_10055679 Ga0207700_100556792 141
194 3300025931 Ga0207644_10049191 Ga0207644_100491913 141
195 3300025934 Ga0207686_10002961 Ga0207686_100029616 141
196 3300025934 Ga0207686_10052381 Ga0207686_100523812 141
197 3300025934 Ga0207686_10229808 Ga0207686_102298081 141
198 3300025935 Ga0207709_10081823 Ga0207709_100818232 141
199 3300025935 Ga0207709_10252965 Ga0207709_102529652 141
200 3300025935 Ga0207709_11292282 Ga0207709_112922822 141
201 3300025936 Ga0207670_10037852 Ga0207670_100378524 141
202 3300025936 Ga0207670_10947687 Ga0207670_109476872 141
203 3300025936 Ga0207670_11669161 Ga0207670_116691611 141
204 3300025938 Ga0207704_10038582 Ga0207704_100385822 141
205 3300025938 Ga0207704_10965880 Ga0207704_109658802 141
206 3300025941 Ga0207711_10116322 Ga0207711_101163223 141
207 3300025941 Ga0207711_11123535 Ga0207711_111235352 141
208 3300025942 Ga0207689_10021246 Ga0207689_100212463 141
209 3300025942 Ga0207689_10113291 Ga0207689_101132912 141
210 3300025944 Ga0207661_10000365 Ga0207661_1000036520 141
211 3300025944 Ga0207661_10003386 Ga0207661_100033863 141
212 3300025944 Ga0207661_10285687 Ga0207661_102856871 141
213 3300025944 Ga0207661_10395542 Ga0207661_103955422 141
214 3300025949 Ga0207667_10002201 Ga0207667_1000220122 141
215 3300025961 Ga0207712_11006337 Ga0207712_110063372 141
216 3300025961 Ga0207712_11309766 Ga0207712_113097661 141
217 3300025981 Ga0207640_10964881 Ga0207640_109648812 141
218 3300026023 Ga0207677_10449299 Ga0207677_104492992 141
219 3300026023 Ga0207677_10964686 Ga0207677_109646861 141
220 3300026035 Ga0207703_10120667 Ga0207703_101206673 141
221 3300026035 Ga0207703_10436162 Ga0207703_104361622 141
222 3300026035 Ga0207703_11273595 Ga0207703_112735951 141
223 3300026041 Ga0207639_10032444 Ga0207639_100324444 141
224 3300026041 Ga0207639_10465975 Ga0207639_104659752 141
225 3300026041 Ga0207639_11300627 Ga0207639_113006272 141
226 3300026075 Ga0207708_10125138 Ga0207708_101251383 141
227 3300026078 Ga0207702_10705357 Ga0207702_107053572 141
228 3300026088 Ga0207641_10878293 Ga0207641_108782932 141
229 3300026089 Ga0207648_10031143 Ga0207648_100311432 141
230 3300026116 Ga0207674_10000042 Ga0207674_1000004222 141
231 3300026116 Ga0207674_10004196 Ga0207674_100041968 141
232 3300026118 Ga0207675_100590974 Ga0207675_1005909741 141
233 3300028381 Ga0268264_10247806 Ga0268264_102478062 141
234 3300028381 Ga0268264_10394032 Ga0268264_103940322 141
235 3300028381 Ga0268264_11301584 Ga0268264_113015842 141
236 3300028577 Ga0265318_10313029 Ga0265318_103130292 141
237 3300031595 Ga0265313_10006767 Ga0265313_100067675 141
238 3300035086 Ga0373934_0002765 Ga0373934_0002765_1357_1782 141
239 3300035086 Ga0373934_0240822 Ga0373934_0240822_154_579 141
240 3300035111 Ga0373923_0076298 Ga0373923_0076298_637_1062 141
241 3300035113 Ga0373936_0094527 Ga0373936_0094527_812_1237 141
242 3300035117 Ga0373953_0014028 Ga0373953_0014028_1347_1772 141
243 3300035118 Ga0373954_0005904 Ga0373954_0005904_2764_3189 141
244 3300035119 Ga0373956_0616574 Ga0373956_0616574_72_497 141
245 3300035172 Ga0373955_0003733 Ga0373955_0003733_3383_3808 141
246 3300035172 Ga0373955_0024298 Ga0373955_0024298_1051_1476 141
247 3300035172 Ga0373955_0100013 Ga0373955_0100013_1096_1521 141
248 3300035410 Ga0373924_0236576 Ga0373924_0236576_325_750 141
249 3300035692 Ga0373935_0123876 Ga0373935_0123876_1176_1601 141
250 3300035695 Ga0373927_0341039 Ga0373927_0341039_178_603 141
251 3300035724 Ga0373933_0008593 Ga0373933_0008593_4755_5180 141
252 3300035724 Ga0373933_0064300 Ga0373933_0064300_287_712 141
253 3300036401 Ga0373937_0005019 Ga0373937_0005019_5181_5606 141
254 3300036401 Ga0373937_0010310 Ga0373937_0010310_5534_5959 141
255 3300036401 Ga0373937_0026597 Ga0373937_0026597_4735_5160 141
256 3300036401 Ga0373937_0725743 Ga0373937_0725743_430_855 141
257 3300037068 Ga0373925_1160086 Ga0373925_1160086_193_618 141
258 3300046454 Ga0495592_0290259 Ga0495592_0290259_190_615 141
259 3300046462 Ga0495651_0449080 Ga0495651_0449080_349_774 141
260 3300046462 Ga0495651_0475942 Ga0495651_0475942_32_457 141
261 3300046472 Ga0495580_0137993 Ga0495580_0137993_968_1393 141
262 3300046475 Ga0495639_0424335 Ga0495639_0424335_169_594 141
263 3300046511 Ga0495608_0133456 Ga0495608_0133456_644_1069 141
264 3300046526 Ga0495666_0080436 Ga0495666_0080436_481_906 141
265 3300046529 Ga0495652_0026824 Ga0495652_0026824_1506_1931 141
266 3300046529 Ga0495652_0200045 Ga0495652_0200045_977_1402 141
267 3300046531 Ga0495665_0048124 Ga0495665_0048124_1510_1935 141
268 3300046535 Ga0495586_0022817 Ga0495586_0022817_1368_1793 141
269 3300046535 Ga0495586_0035520 Ga0495586_0035520_2193_2618 141
270 3300046535 Ga0495586_0323360 Ga0495586_0323360_127_552 141
271 3300046536 Ga0495587_0102177 Ga0495587_0102177_122_547 141
272 3300046543 Ga0495645_0187300 Ga0495645_0187300_312_737 141
273 3300046642 Ga0495634_0043856 Ga0495634_0043856_212_637 141
274 3300046678 Ga0495599_0015319 Ga0495599_0015319_2042_2467 141
275 3300046683 Ga0495658_0765601 Ga0495658_0765601_30_455 141
276 3300046689 Ga0495613_0235160 Ga0495613_0235160_24_449 141
277 3300046690 Ga0495624_0461651 Ga0495624_0461651_40_465 141
278 3300047317 Ga0495604_0420209 Ga0495604_0420209_343_768 141
279 3300047322 Ga0495680_0239275 Ga0495680_0239275_120_545 141
280 3300047322 Ga0495680_0965715 Ga0495680_0965715_58_483 141
281 3300047444 Ga0495675_0034828 Ga0495675_0034828_34_459 141
282 3300047471 Ga0495684_0018073 Ga0495684_0018073_3235_3660 141
283 3300047673 Ga0495593_0470703 Ga0495593_0470703_60_485 141
284 3300048088 Ga0495602_0104389 Ga0495602_0104389_191_616 141
285 3300048907 Ga0496104_0070864 Ga0496104_0070864_485_910 141
286 3300050507 nmdc:mga05p37_1363594_c1 nmdc:mga05p37_1363594_c1_127_552 141
287 3300050509 nmdc:mga0qj67_153642_c1 nmdc:mga0qj67_153642_c1_1091_1516 141
288 3300050510 nmdc:mga06r32_17814_c1 nmdc:mga06r32_17814_c1_596_1021 141
289 3300050515 nmdc:mga0a205_388808_c1 nmdc:mga0a205_388808_c1_472_897 141
290 3300053077 Ga0495601_0690615 Ga0495601_0690615_116_541 141
291 3300005466 Ga0070685_10107744 Ga0070685_101077442 142
292 3300025936 Ga0207670_10247515 Ga0207670_102475152 142
293 3300005842 Ga0068858_100358703 Ga0068858_1003587033 143
294 3300009147 Ga0114129_10639343 Ga0114129_106393431 143
295 3300009177 Ga0105248_11235203 Ga0105248_112352031 143
296 3300014968 Ga0157379_10036482 Ga0157379_100364825 143
297 3300026088 Ga0207641_11254359 Ga0207641_112543592 143
298 3300035172 Ga0373955_0425656 Ga0373955_0425656_135_566 143
299 3300036401 Ga0373937_1585673 Ga0373937_1585673_44_475 143
300 3300046517 Ga0495630_0383536 Ga0495630_0383536_416_847 143
301 3300053084 Ga0495595_0678147 Ga0495595_0678147_75_506 143
302 3300005295 Ga0065707_10569422 Ga0065707_105694222 144
303 3300005330 Ga0070690_100001755 Ga0070690_1000017555 144
304 3300005335 Ga0070666_10055332 Ga0070666_100553323 144
305 3300005341 Ga0070691_10044838 Ga0070691_100448381 144
306 3300005343 Ga0070687_100062705 Ga0070687_1000627052 144
307 3300005353 Ga0070669_100058228 Ga0070669_1000582282 144
308 3300005355 Ga0070671_100292907 Ga0070671_1002929071 144
309 3300005364 Ga0070673_100245054 Ga0070673_1002450541 144
310 3300005364 Ga0070673_100842734 Ga0070673_1008427341 144
311 3300005367 Ga0070667_101260587 Ga0070667_1012605872 144
312 3300005434 Ga0070709_10077086 Ga0070709_100770862 144
313 3300005438 Ga0070701_10324189 Ga0070701_103241891 144
314 3300005440 Ga0070705_100618811 Ga0070705_1006188111 144
315 3300005445 Ga0070708_100590953 Ga0070708_1005909532 144
316 3300005459 Ga0068867_100216295 Ga0068867_1002162951 144
317 3300005468 Ga0070707_100436139 Ga0070707_1004361392 144
318 3300005536 Ga0070697_100265016 Ga0070697_1002650162 144
319 3300005539 Ga0068853_100249309 Ga0068853_1002493092 144
320 3300005544 Ga0070686_100011840 Ga0070686_1000118405 144
321 3300005544 Ga0070686_100352569 Ga0070686_1003525692 144
322 3300005545 Ga0070695_100023533 Ga0070695_1000235332 144
323 3300005549 Ga0070704_100001980 Ga0070704_10000198014 144
324 3300005549 Ga0070704_101428023 Ga0070704_1014280231 144
325 3300005578 Ga0068854_100041576 Ga0068854_1000415763 144
326 3300005615 Ga0070702_100013446 Ga0070702_1000134462 144
327 3300005719 Ga0068861_100052494 Ga0068861_1000524942 144
328 3300005719 Ga0068861_100740753 Ga0068861_1007407531 144
329 3300005842 Ga0068858_100162156 Ga0068858_1001621561 144
330 3300005842 Ga0068858_102269423 Ga0068858_1022694231 144
331 3300006058 Ga0075432_10148080 Ga0075432_101480801 144
332 3300006852 Ga0075433_10176595 Ga0075433_101765952 144
333 3300006852 Ga0075433_10347596 Ga0075433_103475962 144
334 3300006871 Ga0075434_100000008 Ga0075434_10000000867 144
335 3300006871 Ga0075434_100055477 Ga0075434_1000554772 144
336 3300006871 Ga0075434_100477790 Ga0075434_1004777901 144
337 3300006914 Ga0075436_100000027 Ga0075436_10000002746 144
338 3300006914 Ga0075436_100057458 Ga0075436_1000574582 144
339 3300006914 Ga0075436_100122217 Ga0075436_1001222172 144
340 3300006914 Ga0075436_100206366 Ga0075436_1002063662 144
341 3300007076 Ga0075435_100000003 Ga0075435_10000000346 144
342 3300007076 Ga0075435_100013881 Ga0075435_1000138813 144
343 3300007076 Ga0075435_100193404 Ga0075435_1001934042 144
344 3300009093 Ga0105240_10150780 Ga0105240_101507802 144
345 3300009093 Ga0105240_10494925 Ga0105240_104949252 144
346 3300009094 Ga0111539_10009890 Ga0111539_1000989012 144
347 3300009098 Ga0105245_10280874 Ga0105245_102808742 144
348 3300009147 Ga0114129_10080667 Ga0114129_100806672 144
349 3300009148 Ga0105243_10026001 Ga0105243_100260013 144
350 3300009174 Ga0105241_10052491 Ga0105241_100524913 144
351 3300009176 Ga0105242_10387470 Ga0105242_103874702 144
352 3300009177 Ga0105248_10061746 Ga0105248_100617463 144
353 3300009177 Ga0105248_10263057 Ga0105248_102630574 144
354 3300009551 Ga0105238_11036808 Ga0105238_110368082 144
355 3300013297 Ga0157378_10574705 Ga0157378_105747052 144
356 3300025903 Ga0207680_10159721 Ga0207680_101597211 144
357 3300025906 Ga0207699_10386857 Ga0207699_103868572 144
358 3300025907 Ga0207645_10037955 Ga0207645_100379553 144
359 3300025907 Ga0207645_10144208 Ga0207645_101442082 144
360 3300025913 Ga0207695_10304252 Ga0207695_103042522 144
361 3300025913 Ga0207695_10355257 Ga0207695_103552572 144
362 3300025918 Ga0207662_10165925 Ga0207662_101659252 144
363 3300025923 Ga0207681_10043546 Ga0207681_100435463 144
364 3300025931 Ga0207644_10286280 Ga0207644_102862801 144
365 3300025934 Ga0207686_10044422 Ga0207686_100444222 144
366 3300025934 Ga0207686_10874442 Ga0207686_108744421 144
367 3300025939 Ga0207665_10088056 Ga0207665_100880562 144
368 3300025960 Ga0207651_10217939 Ga0207651_102179392 144
369 3300026035 Ga0207703_10385184 Ga0207703_103851842 144
370 3300026041 Ga0207639_10248516 Ga0207639_102485162 144
371 3300026075 Ga0207708_10026291 Ga0207708_100262914 144
372 3300026089 Ga0207648_10047304 Ga0207648_100473044 144
373 3300026118 Ga0207675_100122073 Ga0207675_1001220732 144
374 3300026118 Ga0207675_100211171 Ga0207675_1002111712 144
375 3300034819 Ga0373958_0000467 Ga0373958_0000467_2540_2974 144
376 3300034820 Ga0373959_0000365 Ga0373959_0000365_1299_1733 144
377 3300035084 Ga0373928_0004057 Ga0373928_0004057_976_1410 144
378 3300035085 Ga0373929_0002432 Ga0373929_0002432_1858_2292 144
379 3300035088 Ga0373940_0000042 Ga0373940_0000042_11770_12204 144
380 3300035091 Ga0373951_0004493 Ga0373951_0004493_1449_1883 144
381 3300035092 Ga0373952_0001618 Ga0373952_0001618_1657_2091 144
382 3300035112 Ga0373932_0000932 Ga0373932_0000932_5214_5648 144
383 3300035113 Ga0373936_0108637 Ga0373936_0108637_297_734 144
384 3300035115 Ga0373941_0009794 Ga0373941_0009794_431_865 144
385 3300035117 Ga0373953_0044960 Ga0373953_0044960_483_920 144
386 3300035121 Ga0373960_0014458 Ga0373960_0014458_199_633 144
387 3300035170 Ga0373943_0288074 Ga0373943_0288074_318_755 144
388 3300035241 Ga0373961_0003447 Ga0373961_0003447_3034_3468 144
389 3300035410 Ga0373924_0033660 Ga0373924_0033660_1410_1847 144
390 3300035691 Ga0373931_0001065 Ga0373931_0001065_5367_5801 144
391 3300035692 Ga0373935_0143489 Ga0373935_0143489_369_806 144
392 3300042012 Ga0439455_0254181 Ga0439455_0254181_14_448 144
393 3300045051 Ga0451576_0005340 Ga0451576_0005340_488_922 144
394 3300045051 Ga0451576_0151111 Ga0451576_0151111_1800_2237 144
395 3300046463 Ga0495653_0307631 Ga0495653_0307631_378_815 144
396 3300046499 Ga0495594_0467512 Ga0495594_0467512_21_458 144
397 3300046535 Ga0495586_0104367 Ga0495586_0104367_864_1301 144
398 3300046543 Ga0495645_0701014 Ga0495645_0701014_35_472 144
399 3300046683 Ga0495658_0009241 Ga0495658_0009241_2734_3171 144
400 3300047471 Ga0495684_0698594 Ga0495684_0698594_90_527 144
401 3300048904 Ga0496101_0180416 Ga0496101_0180416_144_578 144
402 3300048905 Ga0496102_0092827 Ga0496102_0092827_73_510 144
403 3300048909 Ga0496106_0242260 Ga0496106_0242260_359_793 144
404 3300048910 Ga0496107_0432121 Ga0496107_0432121_280_717 144
405 3300050507 nmdc:mga05p37_271227_c1 nmdc:mga05p37_271227_c1_639_1097 144
406 3300050511 nmdc:mga08y16_485559_c1 nmdc:mga08y16_485559_c1_735_1172 144
407 3300050512 nmdc:mga0n895_123345_c1 nmdc:mga0n895_123345_c1_2146_2583 144
408 3300050512 nmdc:mga0n895_125649_c1 nmdc:mga0n895_125649_c1_1251_1688 144
409 3300050512 nmdc:mga0n895_40_c1 nmdc:mga0n895_40_c1_11296_11733 144
410 3300050513 nmdc:mga0rr50_101519_c1 nmdc:mga0rr50_101519_c1_1789_2226 144
411 3300050513 nmdc:mga0rr50_154265_c1 nmdc:mga0rr50_154265_c1_439_876 144
412 3300050513 nmdc:mga0rr50_45958_c1 nmdc:mga0rr50_45958_c1_2745_3182 144
413 3300050513 nmdc:mga0rr50_7_c1 nmdc:mga0rr50_7_c1_68312_68749 144
414 3300050514 nmdc:mga08x19_1023369_c1 nmdc:mga08x19_1023369_c1_128_565 144
415 3300050514 nmdc:mga08x19_14795_c1 nmdc:mga08x19_14795_c1_3412_3849 144
416 3300050514 nmdc:mga08x19_386379_c1 nmdc:mga08x19_386379_c1_340_777 144
417 3300050514 nmdc:mga08x19_521435_c1 nmdc:mga08x19_521435_c1_378_815 144
418 3300050514 nmdc:mga08x19_60_c1 nmdc:mga08x19_60_c1_52736_53173 144
419 3300050515 nmdc:mga0a205_155034_c1 nmdc:mga0a205_155034_c1_553_990 144
420 3300053077 Ga0495601_0048766 Ga0495601_0048766_721_1158 144
421 3300053084 Ga0495595_0208898 Ga0495595_0208898_110_547 144
422 3300053085 Ga0495619_0026818 Ga0495619_0026818_1350_1787 144
423 3300005290 Ga0065712_10366233 Ga0065712_103662332 145
424 3300005293 Ga0065715_10373781 Ga0065715_103737812 145
425 3300005293 Ga0065715_10403299 Ga0065715_104032991 145
426 3300005293 Ga0065715_10623254 Ga0065715_106232541 145
427 3300005293 Ga0065715_10918578 Ga0065715_109185781 145
428 3300005295 Ga0065707_10211202 Ga0065707_102112021 145
429 3300005295 Ga0065707_10278551 Ga0065707_102785512 145
430 3300005295 Ga0065707_10289751 Ga0065707_102897512 145
431 3300005328 Ga0070676_10475747 Ga0070676_104757472 145
432 3300005328 Ga0070676_10684261 Ga0070676_106842612 145
433 3300005331 Ga0070670_100587073 Ga0070670_1005870732 145
434 3300005335 Ga0070666_10247735 Ga0070666_102477352 145
435 3300005338 Ga0068868_100912128 Ga0068868_1009121281 145
436 3300005340 Ga0070689_100135028 Ga0070689_1001350282 145
437 3300005343 Ga0070687_100450186 Ga0070687_1004501862 145
438 3300005347 Ga0070668_100012081 Ga0070668_1000120814 145
439 3300005353 Ga0070669_100062239 Ga0070669_1000622392 145
440 3300005353 Ga0070669_100168850 Ga0070669_1001688502 145
441 3300005353 Ga0070669_100258026 Ga0070669_1002580263 145
442 3300005354 Ga0070675_100476974 Ga0070675_1004769742 145
443 3300005356 Ga0070674_100206181 Ga0070674_1002061812 145
444 3300005356 Ga0070674_100404639 Ga0070674_1004046391 145
445 3300005356 Ga0070674_100748271 Ga0070674_1007482712 145
446 3300005364 Ga0070673_101622710 Ga0070673_1016227101 145
447 3300005365 Ga0070688_100306881 Ga0070688_1003068812 145
448 3300005365 Ga0070688_100515902 Ga0070688_1005159021 145
449 3300005365 Ga0070688_100594654 Ga0070688_1005946542 145
450 3300005366 Ga0070659_100948145 Ga0070659_1009481451 145
451 3300005367 Ga0070667_100092099 Ga0070667_1000920993 145
452 3300005367 Ga0070667_101108837 Ga0070667_1011088372 145
453 3300005438 Ga0070701_10163892 Ga0070701_101638922 145
454 3300005440 Ga0070705_100043384 Ga0070705_1000433843 145
455 3300005440 Ga0070705_100117159 Ga0070705_1001171593 145
456 3300005444 Ga0070694_100156012 Ga0070694_1001560122 145
457 3300005445 Ga0070708_100078357 Ga0070708_1000783573 145
458 3300005445 Ga0070708_101405681 Ga0070708_1014056811 145
459 3300005456 Ga0070678_101329351 Ga0070678_1013293512 145
460 3300005457 Ga0070662_100660953 Ga0070662_1006609531 145
461 3300005459 Ga0068867_100116402 Ga0068867_1001164022 145
462 3300005459 Ga0068867_100676905 Ga0068867_1006769051 145
463 3300005467 Ga0070706_100848094 Ga0070706_1008480942 145
464 3300005467 Ga0070706_101752069 Ga0070706_1017520691 145
465 3300005468 Ga0070707_100136306 Ga0070707_1001363063 145
466 3300005471 Ga0070698_100610759 Ga0070698_1006107592 145
467 3300005518 Ga0070699_100008658 Ga0070699_1000086588 145
468 3300005518 Ga0070699_101315383 Ga0070699_1013153831 145
469 3300005536 Ga0070697_100323285 Ga0070697_1003232852 145
470 3300005536 Ga0070697_100650934 Ga0070697_1006509342 145
471 3300005536 Ga0070697_101432588 Ga0070697_1014325881 145
472 3300005536 Ga0070697_101848318 Ga0070697_1018483181 145
473 3300005543 Ga0070672_100081477 Ga0070672_1000814772 145
474 3300005543 Ga0070672_100579204 Ga0070672_1005792042 145
475 3300005545 Ga0070695_100453422 Ga0070695_1004534222 145
476 3300005546 Ga0070696_100036659 Ga0070696_1000366593 145
477 3300005546 Ga0070696_100116865 Ga0070696_1001168652 145
478 3300005546 Ga0070696_100409188 Ga0070696_1004091882 145
479 3300005546 Ga0070696_100549520 Ga0070696_1005495201 145
480 3300005548 Ga0070665_101150885 Ga0070665_1011508851 145
481 3300005549 Ga0070704_100019169 Ga0070704_1000191693 145
482 3300005577 Ga0068857_101620971 Ga0068857_1016209712 145
483 3300005578 Ga0068854_101349318 Ga0068854_1013493181 145
484 3300005615 Ga0070702_100402232 Ga0070702_1004022322 145
485 3300005617 Ga0068859_100586946 Ga0068859_1005869461 145
486 3300005617 Ga0068859_101806942 Ga0068859_1018069422 145
487 3300005718 Ga0068866_10012669 Ga0068866_100126693 145
488 3300005719 Ga0068861_100365336 Ga0068861_1003653362 145
489 3300005841 Ga0068863_100002248 Ga0068863_1000022484 145
490 3300005843 Ga0068860_100824612 Ga0068860_1008246122 145
491 3300005843 Ga0068860_101174248 Ga0068860_1011742482 145
492 3300005844 Ga0068862_100025381 Ga0068862_1000253813 145
493 3300005844 Ga0068862_100039769 Ga0068862_1000397693 145
494 3300005844 Ga0068862_100168875 Ga0068862_1001688753 145
495 3300005844 Ga0068862_100238312 Ga0068862_1002383122 145
496 3300005844 Ga0068862_100382905 Ga0068862_1003829052 145
497 3300005937 Ga0081455_10039863 Ga0081455_100398633 145
498 3300006237 Ga0097621_100315775 Ga0097621_1003157752 145
499 3300006844 Ga0075428_100194367 Ga0075428_1001943673 145
500 3300006844 Ga0075428_100210920 Ga0075428_1002109202 145
501 3300006844 Ga0075428_101146298 Ga0075428_1011462981 145
502 3300006852 Ga0075433_10038933 Ga0075433_100389332 145
503 3300006852 Ga0075433_10055981 Ga0075433_100559814 145
504 3300006852 Ga0075433_10292478 Ga0075433_102924782 145
505 3300006852 Ga0075433_10827124 Ga0075433_108271242 145
506 3300006871 Ga0075434_100027537 Ga0075434_1000275372 145
507 3300006871 Ga0075434_102260752 Ga0075434_1022607521 145
508 3300006880 Ga0075429_100120831 Ga0075429_1001208311 145
509 3300006880 Ga0075429_100647350 Ga0075429_1006473501 145
510 3300006880 Ga0075429_100946899 Ga0075429_1009468991 145
511 3300006914 Ga0075436_100011040 Ga0075436_1000110402 145
512 3300006914 Ga0075436_100045390 Ga0075436_1000453902 145
513 3300006914 Ga0075436_101138981 Ga0075436_1011389811 145
514 3300006931 Ga0097620_100586928 Ga0097620_1005869282 145
515 3300006931 Ga0097620_101806034 Ga0097620_1018060342 145
516 3300007076 Ga0075435_100141099 Ga0075435_1001410992 145
517 3300007076 Ga0075435_100175645 Ga0075435_1001756451 145
518 3300007265 Ga0099794_10031037 Ga0099794_100310374 145
519 3300009094 Ga0111539_10123852 Ga0111539_101238522 145
520 3300009094 Ga0111539_10183180 Ga0111539_101831804 145
521 3300009094 Ga0111539_10419571 Ga0111539_104195712 145
522 3300009094 Ga0111539_10566272 Ga0111539_105662722 145
523 3300009094 Ga0111539_10882244 Ga0111539_108822442 145
524 3300009094 Ga0111539_11306255 Ga0111539_113062552 145
525 3300009098 Ga0105245_10342415 Ga0105245_103424152 145
526 3300009147 Ga0114129_10002259 Ga0114129_1000225917 145
527 3300009147 Ga0114129_10013616 Ga0114129_100136169 145
528 3300009147 Ga0114129_10020088 Ga0114129_100200885 145
529 3300009147 Ga0114129_10158846 Ga0114129_101588462 145
530 3300009147 Ga0114129_10660927 Ga0114129_106609272 145
531 3300009147 Ga0114129_10711046 Ga0114129_107110462 145
532 3300009147 Ga0114129_11190981 Ga0114129_111909811 145
533 3300009148 Ga0105243_10028709 Ga0105243_100287094 145
534 3300009176 Ga0105242_11199483 Ga0105242_111994832 145
535 3300009177 Ga0105248_10122096 Ga0105248_101220961 145
536 3300009177 Ga0105248_10731291 Ga0105248_107312912 145
537 3300009177 Ga0105248_11386353 Ga0105248_113863531 145
538 3300009177 Ga0105248_11691672 Ga0105248_116916722 145
539 3300009553 Ga0105249_10082274 Ga0105249_100822742 145
540 3300009553 Ga0105249_10140243 Ga0105249_101402433 145
541 3300009553 Ga0105249_10512227 Ga0105249_105122273 145
542 3300013297 Ga0157378_11142677 Ga0157378_111426771 145
543 3300013306 Ga0163162_10168635 Ga0163162_101686352 145
544 3300013306 Ga0163162_10890422 Ga0163162_108904222 145
545 3300013308 Ga0157375_10173308 Ga0157375_101733082 145
546 3300014325 Ga0163163_10061557 Ga0163163_100615572 145
547 3300014326 Ga0157380_10022436 Ga0157380_100224365 145
548 3300014326 Ga0157380_10396070 Ga0157380_103960702 145
549 3300014326 Ga0157380_10431496 Ga0157380_104314962 145
550 3300014968 Ga0157379_10037219 Ga0157379_100372193 145
551 3300017792 Ga0163161_10411377 Ga0163161_104113772 145
552 3300017792 Ga0163161_10638212 Ga0163161_106382121 145
553 3300025315 Ga0207697_10049771 Ga0207697_100497711 145
554 3300025885 Ga0207653_10238454 Ga0207653_102384542 145
555 3300025899 Ga0207642_10075643 Ga0207642_100756433 145
556 3300025901 Ga0207688_10207309 Ga0207688_102073091 145
557 3300025903 Ga0207680_10163236 Ga0207680_101632362 145
558 3300025907 Ga0207645_10025740 Ga0207645_100257403 145
559 3300025910 Ga0207684_10773072 Ga0207684_107730721 145
560 3300025922 Ga0207646_10386952 Ga0207646_103869522 145
561 3300025922 Ga0207646_10464150 Ga0207646_104641501 145
562 3300025922 Ga0207646_10681486 Ga0207646_106814861 145
563 3300025923 Ga0207681_10172124 Ga0207681_101721242 145
564 3300025923 Ga0207681_10256114 Ga0207681_102561142 145
565 3300025923 Ga0207681_10699549 Ga0207681_106995492 145
566 3300025926 Ga0207659_10138714 Ga0207659_101387142 145
567 3300025931 Ga0207644_10194493 Ga0207644_101944931 145
568 3300025933 Ga0207706_10103492 Ga0207706_101034922 145
569 3300025935 Ga0207709_11055297 Ga0207709_110552971 145
570 3300025936 Ga0207670_10259592 Ga0207670_102595922 145
571 3300025936 Ga0207670_11728033 Ga0207670_117280331 145
572 3300025937 Ga0207669_10084910 Ga0207669_100849102 145
573 3300025937 Ga0207669_11458449 Ga0207669_114584491 145
574 3300025940 Ga0207691_10032228 Ga0207691_100322284 145
575 3300025941 Ga0207711_10038447 Ga0207711_100384473 145
576 3300025941 Ga0207711_10299374 Ga0207711_102993742 145
577 3300025941 Ga0207711_10614462 Ga0207711_106144622 145
578 3300025960 Ga0207651_10309662 Ga0207651_103096621 145
579 3300025961 Ga0207712_10122621 Ga0207712_101226212 145
580 3300025961 Ga0207712_10378796 Ga0207712_103787962 145
581 3300025961 Ga0207712_11028681 Ga0207712_110286812 145
582 3300025972 Ga0207668_10769373 Ga0207668_107693732 145
583 3300025981 Ga0207640_10859119 Ga0207640_108591192 145
584 3300025986 Ga0207658_10314454 Ga0207658_103144542 145
585 3300026023 Ga0207677_10178308 Ga0207677_101783081 145
586 3300026035 Ga0207703_11283445 Ga0207703_112834451 145
587 3300026075 Ga0207708_10011567 Ga0207708_100115676 145
588 3300026088 Ga0207641_10002063 Ga0207641_1000206310 145
589 3300026088 Ga0207641_11861595 Ga0207641_118615951 145
590 3300026089 Ga0207648_10138703 Ga0207648_101387032 145
591 3300026089 Ga0207648_10651937 Ga0207648_106519372 145
592 3300026116 Ga0207674_10725777 Ga0207674_107257772 145
593 3300026118 Ga0207675_100217770 Ga0207675_1002177702 145
594 3300026118 Ga0207675_100231408 Ga0207675_1002314082 145
595 3300026118 Ga0207675_102478749 Ga0207675_1024787491 145
596 3300028380 Ga0268265_10009546 Ga0268265_100095462 145
597 3300028380 Ga0268265_10035070 Ga0268265_100350702 145
598 3300028380 Ga0268265_10181899 Ga0268265_101818992 145
599 3300028380 Ga0268265_10586421 Ga0268265_105864212 145
600 3300028380 Ga0268265_10665752 Ga0268265_106657522 145
601 3300028380 Ga0268265_11743442 Ga0268265_117434421 145
602 3300028381 Ga0268264_10522970 Ga0268264_105229702 145
603 3300034817 Ga0373948_0113580 Ga0373948_0113580_164_601 145
604 3300035114 Ga0373939_0194113 Ga0373939_0194113_97_534 145
605 3300035115 Ga0373941_0147089 Ga0373941_0147089_132_569 145
606 3300038443 Ga0395901_0740811 Ga0395901_0740811_421_858 145
607 3300046477 Ga0495664_0033136 Ga0495664_0033136_2330_2830 145
608 3300046516 Ga0495628_0249933 Ga0495628_0249933_349_786 145
609 3300046533 Ga0495640_0023882 Ga0495640_0023882_1575_2075 145
610 3300046536 Ga0495587_0069604 Ga0495587_0069604_1393_1893 145
611 3300046559 Ga0495667_0598797 Ga0495667_0598797_12_512 145
612 3300046615 Ga0495656_0634522 Ga0495656_0634522_50_487 145
613 3300047319 Ga0495674_0010765 Ga0495674_0010765_1265_1765 145
614 3300047471 Ga0495684_0628237 Ga0495684_0628237_32_469 145
615 3300048088 Ga0495602_0837345 Ga0495602_0837345_90_590 145
616 3300048088 Ga0495602_0893765 Ga0495602_0893765_10_510 145
617 3300048905 Ga0496102_1030270 Ga0496102_1030270_233_670 145
618 3300048915 Ga0496112_0455489 Ga0496112_0455489_311_748 145
619 3300050507 nmdc:mga05p37_191440_c1 nmdc:mga05p37_191440_c1_170_610 145
620 3300050507 nmdc:mga05p37_2297_c1 nmdc:mga05p37_2297_c1_5769_6212 145
621 3300050507 nmdc:mga05p37_29151_c1 nmdc:mga05p37_29151_c1_4943_5380 145
622 3300050507 nmdc:mga05p37_30104_c1 nmdc:mga05p37_30104_c1_580_1017 145
623 3300050507 nmdc:mga05p37_37360_c1 nmdc:mga05p37_37360_c1_3808_4245 145
624 3300050507 nmdc:mga05p37_39838_c1 nmdc:mga05p37_39838_c1_4072_4527 145
625 3300050508 nmdc:mga09592_592880_c1 nmdc:mga09592_592880_c1_23_460 145
626 3300050508 nmdc:mga09592_763997_c1 nmdc:mga09592_763997_c1_162_617 145
627 3300050511 nmdc:mga08y16_339184_c1 nmdc:mga08y16_339184_c1_279_716 145
628 3300050511 nmdc:mga08y16_518139_c1 nmdc:mga08y16_518139_c1_496_933 145
629 3300050511 nmdc:mga08y16_66734_c1 nmdc:mga08y16_66734_c1_625_1062 145
630 3300050511 nmdc:mga08y16_697457_c1 nmdc:mga08y16_697457_c1_259_711 145
631 3300050512 nmdc:mga0n895_1223632_c1 nmdc:mga0n895_1223632_c1_164_607 145
632 3300050512 nmdc:mga0n895_3651_c1 nmdc:mga0n895_3651_c1_8619_9056 145
633 3300050513 nmdc:mga0rr50_189094_c1 nmdc:mga0rr50_189094_c1_1074_1511 145
634 3300050513 nmdc:mga0rr50_205034_c1 nmdc:mga0rr50_205034_c1_1025_1525 145
635 3300050514 nmdc:mga08x19_163365_c1 nmdc:mga08x19_163365_c1_13_450 145
636 3300050514 nmdc:mga08x19_25613_c1 nmdc:mga08x19_25613_c1_85_522 145
637 3300050515 nmdc:mga0a205_125561_c1 nmdc:mga0a205_125561_c1_1508_1963 145
638 3300050515 nmdc:mga0a205_22891_c1 nmdc:mga0a205_22891_c1_4431_4868 145
639 3300050515 nmdc:mga0a205_35320_c1 nmdc:mga0a205_35320_c1_184_621 145
640 3300050515 nmdc:mga0a205_61187_c1 nmdc:mga0a205_61187_c1_555_992 145

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00190

Cupin_1

Cupin

53

136

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6o2d-assembly1.cif.gz_B schizosaccharomyces pombe cnp3 cupin domain 0.8603 42 144
5ooa-assembly1.cif.gz_A streptomyces pac13 (y89f) with uridine 0.8596 45 145
5njn-assembly1.cif.gz_A roll out the beta-barrel: structure and mechanism of pac13, a unique nucleoside dehydratase 0.859 45 145
5oo8-assembly1.cif.gz_A streptomyces pac13 (h42q) with uridine 0.8586 45 145
5oo9-assembly1.cif.gz_A streptomyces pac13 (y55f) with uridine 0.8584 45 145
ID Description Score Start End Superfamily
af_A0A1D8PPZ7_421_512_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8661 42 144 2.60.120.10
3rnsA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8618 43 143 2.60.120.10
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8559 50 142 2.60.120.10
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8549 43 142 2.60.120.10
af_Q9USR9_537_626_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8533 42 142 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A849STV1-F1-model_v4 Cupin domain-containing protein 0.9832 52 144
AF-A0A520HRA1-F1-model_v4 Cupin domain-containing protein 0.973 52 144
AF-A0A534PYC0-F1-model_v4 Cupin domain-containing protein 0.9653 26 142
AF-A0A1H4PAZ8-F1-model_v4 Cupin domain-containing protein 0.9618 48 145
AF-A0A2V9NMQ9-F1-model_v4 Cupin type-1 domain-containing protein 0.9615 19 142

Feature Viewer

pLDDT pTM Quality
89.73 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map