F471726
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 640 | 245 | 640 | 144 |
Family's Representative Sequence
| Representative Sequence | 3300048909|Ga0496106_1545080|Ga0496106_1545080_11_436 |
| Length | 136 |
| Sequence | MIAALLVTIGVIAGAQSGSSAGVHVDPAKVAAALAKGGPLVTRPDLLVSGSHRETGGKVEVHDKETDVLYVVDGEATFVFGGKMEGGKVTSPGQWQGGESHRIAKGDVFVIPAGVPHWFKEVPKSVSYFVVKVLKP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 78 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 161 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 162 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 163 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 164 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 165 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 166 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 167 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 168 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 169 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 170 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 171 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 172 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 173 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 175 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 176 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 177 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 178 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 179 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 180 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 181 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 182 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 183 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 184 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 185 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 186 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 187 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 188 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 189 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 192 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 193 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 194 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 195 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 230 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 231 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 232 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 233 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 234 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.25 |
| Rhizosphere | 98.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10366233 | 3300005290 | Bacteria | 769 |
| 2 | Ga0065715_10373781 | 3300005293 | Bacteria | 905 |
| 3 | Ga0065715_10403299 | 3300005293 | Bacteria | 879 |
| 4 | Ga0065715_10623254 | 3300005293 | Unclassified | 694 |
| 5 | Ga0065715_10918578 | 3300005293 | Bacteria | 569 |
| 6 | Ga0065707_10211202 | 3300005295 | Bacteria | 1265 |
| 7 | Ga0065707_10278551 | 3300005295 | Bacteria | 1042 |
| 8 | Ga0065707_10289751 | 3300005295 | Unclassified | 1028 |
| 9 | Ga0065707_10569422 | 3300005295 | Unclassified | 709 |
| 10 | Ga0070676_10475747 | 3300005328 | Unclassified | 883 |
| 11 | Ga0070676_10684261 | 3300005328 | Bacteria | 748 |
| 12 | Ga0070683_100003365 | 3300005329 | Bacteria | 12956 |
| 13 | Ga0070683_100014059 | 3300005329 | Bacteria | 6991 |
| 14 | Ga0070690_100001755 | 3300005330 | Bacteria | 11469 |
| 15 | Ga0070670_100587073 | 3300005331 | Bacteria | 996 |
| 16 | Ga0068869_100008192 | 3300005334 | Bacteria | 6725 |
| 17 | Ga0068869_100130371 | 3300005334 | Bacteria | 1932 |
| 18 | Ga0070666_10055332 | 3300005335 | Bacteria | 2678 |
| 19 | Ga0070666_10247735 | 3300005335 | Bacteria | 1261 |
| 20 | Ga0068868_100218052 | 3300005338 | Bacteria | 1596 |
| 21 | Ga0068868_100912128 | 3300005338 | Unclassified | 799 |
| 22 | Ga0070689_100029468 | 3300005340 | Unclassified | 4155 |
| 23 | Ga0070689_100135028 | 3300005340 | Bacteria | 1981 |
| 24 | Ga0070689_100408222 | 3300005340 | Bacteria | 1149 |
| 25 | Ga0070691_10044838 | 3300005341 | Unclassified | 2097 |
| 26 | Ga0070687_100062705 | 3300005343 | Bacteria | 1969 |
| 27 | Ga0070687_100450186 | 3300005343 | Unclassified | 856 |
| 28 | Ga0070687_100950881 | 3300005343 | Bacteria | 619 |
| 29 | Ga0070668_100012081 | 3300005347 | Bacteria | 6432 |
| 30 | Ga0070669_100058228 | 3300005353 | Unclassified | 2835 |
| 31 | Ga0070669_100062239 | 3300005353 | Bacteria | 2743 |
| 32 | Ga0070669_100168850 | 3300005353 | Bacteria | 1704 |
| 33 | Ga0070669_100258026 | 3300005353 | Bacteria | 1390 |
| 34 | Ga0070675_100476974 | 3300005354 | Bacteria | 1121 |
| 35 | Ga0070671_100292907 | 3300005355 | Bacteria | 1385 |
| 36 | Ga0070674_100206181 | 3300005356 | Unclassified | 1521 |
| 37 | Ga0070674_100404639 | 3300005356 | Bacteria | 1116 |
| 38 | Ga0070674_100748271 | 3300005356 | Bacteria | 840 |
| 39 | Ga0070673_100245054 | 3300005364 | Archaea | 1560 |
| 40 | Ga0070673_100407212 | 3300005364 | Unclassified | 1217 |
| 41 | Ga0070673_100842734 | 3300005364 | Unclassified | 848 |
| 42 | Ga0070673_101622710 | 3300005364 | Bacteria | 611 |
| 43 | Ga0070688_100269429 | 3300005365 | Unclassified | 1219 |
| 44 | Ga0070688_100306881 | 3300005365 | Bacteria | 1149 |
| 45 | Ga0070688_100515902 | 3300005365 | Bacteria | 904 |
| 46 | Ga0070688_100594654 | 3300005365 | Unclassified | 846 |
| 47 | Ga0070659_100726945 | 3300005366 | Unclassified | 860 |
| 48 | Ga0070659_100948145 | 3300005366 | Bacteria | 754 |
| 49 | Ga0070667_100092099 | 3300005367 | Unclassified | 2607 |
| 50 | Ga0070667_101108837 | 3300005367 | Unclassified | 740 |
| 51 | Ga0070667_101260587 | 3300005367 | Unclassified | 692 |
| 52 | Ga0070709_10077086 | 3300005434 | Bacteria | 2166 |
| 53 | Ga0070713_100203812 | 3300005436 | Bacteria | 1788 |
| 54 | Ga0070701_10163892 | 3300005438 | Bacteria | 1290 |
| 55 | Ga0070701_10324189 | 3300005438 | Archaea | 954 |
| 56 | Ga0070711_100364229 | 3300005439 | Bacteria | 1165 |
| 57 | Ga0070705_100043384 | 3300005440 | Unclassified | 2577 |
| 58 | Ga0070705_100117159 | 3300005440 | Bacteria | 1713 |
| 59 | Ga0070705_100618811 | 3300005440 | Unclassified | 840 |
| 60 | Ga0070694_100156012 | 3300005444 | Unclassified | 1671 |
| 61 | Ga0070708_100078357 | 3300005445 | Bacteria | 2987 |
| 62 | Ga0070708_100590953 | 3300005445 | Bacteria | 1047 |
| 63 | Ga0070708_101405681 | 3300005445 | Unclassified | 651 |
| 64 | Ga0070678_101329351 | 3300005456 | Unclassified | 669 |
| 65 | Ga0070662_100031314 | 3300005457 | Bacteria | 3733 |
| 66 | Ga0070662_100660953 | 3300005457 | Bacteria | 882 |
| 67 | Ga0070681_10008049 | 3300005458 | Bacteria | 10318 |
| 68 | Ga0068867_100021152 | 3300005459 | Bacteria | 4640 |
| 69 | Ga0068867_100116402 | 3300005459 | Unclassified | 2060 |
| 70 | Ga0068867_100216295 | 3300005459 | Unclassified | 1542 |
| 71 | Ga0068867_100676905 | 3300005459 | Unclassified | 908 |
| 72 | Ga0070685_10107744 | 3300005466 | Bacteria | 1711 |
| 73 | Ga0070706_100848094 | 3300005467 | Bacteria | 845 |
| 74 | Ga0070706_101752069 | 3300005467 | Bacteria | 565 |
| 75 | Ga0070707_100136306 | 3300005468 | Bacteria | 2388 |
| 76 | Ga0070707_100436139 | 3300005468 | Bacteria | 1270 |
| 77 | Ga0070707_101561885 | 3300005468 | Unclassified | 627 |
| 78 | Ga0070698_100610759 | 3300005471 | Bacteria | 1031 |
| 79 | Ga0070698_101644408 | 3300005471 | Unclassified | 594 |
| 80 | Ga0070699_100008658 | 3300005518 | Bacteria | 8819 |
| 81 | Ga0070699_101315383 | 3300005518 | Bacteria | 663 |
| 82 | Ga0070679_100087579 | 3300005530 | Bacteria | 3101 |
| 83 | Ga0070684_100002184 | 3300005535 | Bacteria | 14445 |
| 84 | Ga0070684_100012534 | 3300005535 | Bacteria | 6801 |
| 85 | Ga0070684_100014590 | 3300005535 | Bacteria | 6369 |
| 86 | Ga0070684_100036326 | 3300005535 | Bacteria | 4222 |
| 87 | Ga0070684_100130643 | 3300005535 | Bacteria | 2265 |
| 88 | Ga0070697_100265016 | 3300005536 | Bacteria | 1472 |
| 89 | Ga0070697_100323285 | 3300005536 | Unclassified | 1329 |
| 90 | Ga0070697_100650934 | 3300005536 | Unclassified | 928 |
| 91 | Ga0070697_101432588 | 3300005536 | Unclassified | 617 |
| 92 | Ga0070697_101848318 | 3300005536 | Bacteria | 540 |
| 93 | Ga0068853_100042327 | 3300005539 | Bacteria | 3894 |
| 94 | Ga0068853_100122531 | 3300005539 | Bacteria | 2321 |
| 95 | Ga0068853_100249309 | 3300005539 | Unclassified | 1629 |
| 96 | Ga0068853_100647525 | 3300005539 | Bacteria | 1005 |
| 97 | Ga0068853_100727509 | 3300005539 | Bacteria | 948 |
| 98 | Ga0070672_100081477 | 3300005543 | Unclassified | 2595 |
| 99 | Ga0070672_100285364 | 3300005543 | Bacteria | 1397 |
| 100 | Ga0070672_100579204 | 3300005543 | Bacteria | 976 |
| 101 | Ga0070686_100011840 | 3300005544 | Bacteria | 4956 |
| 102 | Ga0070686_100352569 | 3300005544 | Archaea | 1106 |
| 103 | Ga0070686_100537869 | 3300005544 | Unclassified | 912 |
| 104 | Ga0070695_100023533 | 3300005545 | Bacteria | 3787 |
| 105 | Ga0070695_100453422 | 3300005545 | Unclassified | 983 |
| 106 | Ga0070696_100036659 | 3300005546 | Bacteria | 3382 |
| 107 | Ga0070696_100116865 | 3300005546 | Bacteria | 1927 |
| 108 | Ga0070696_100409188 | 3300005546 | Unclassified | 1063 |
| 109 | Ga0070696_100549520 | 3300005546 | Unclassified | 925 |
| 110 | Ga0070693_100095233 | 3300005547 | Bacteria | 1803 |
| 111 | Ga0070665_101150885 | 3300005548 | Bacteria | 787 |
| 112 | Ga0070704_100001980 | 3300005549 | Bacteria | 11327 |
| 113 | Ga0070704_100019169 | 3300005549 | Bacteria | 4392 |
| 114 | Ga0070704_101428023 | 3300005549 | Unclassified | 635 |
| 115 | Ga0068855_100205625 | 3300005563 | Bacteria | 2215 |
| 116 | Ga0070664_100514559 | 3300005564 | Unclassified | 1104 |
| 117 | Ga0070664_101295072 | 3300005564 | Unclassified | 688 |
| 118 | Ga0068857_100002231 | 3300005577 | Bacteria | 15779 |
| 119 | Ga0068857_100004743 | 3300005577 | Bacteria | 11517 |
| 120 | Ga0068857_101620971 | 3300005577 | Unclassified | 632 |
| 121 | Ga0068854_100041576 | 3300005578 | Unclassified | 3249 |
| 122 | Ga0068854_101018312 | 3300005578 | Bacteria | 734 |
| 123 | Ga0068854_101349318 | 3300005578 | Bacteria | 643 |
| 124 | Ga0068856_100004931 | 3300005614 | Bacteria | 13214 |
| 125 | Ga0068856_100041233 | 3300005614 | Bacteria | 4536 |
| 126 | Ga0068856_100283614 | 3300005614 | Bacteria | 1673 |
| 127 | Ga0068856_100474978 | 3300005614 | Bacteria | 1271 |
| 128 | Ga0070702_100013446 | 3300005615 | Bacteria | 4132 |
| 129 | Ga0070702_100402232 | 3300005615 | Bacteria | 980 |
| 130 | Ga0068852_100036789 | 3300005616 | Bacteria | 4100 |
| 131 | Ga0068859_100004436 | 3300005617 | Bacteria | 14320 |
| 132 | Ga0068859_100389662 | 3300005617 | Bacteria | 1489 |
| 133 | Ga0068859_100586946 | 3300005617 | Unclassified | 1208 |
| 134 | Ga0068859_100736249 | 3300005617 | Unclassified | 1075 |
| 135 | Ga0068859_101806942 | 3300005617 | Bacteria | 675 |
| 136 | Ga0068866_10012669 | 3300005718 | Bacteria | 3680 |
| 137 | Ga0068866_10341741 | 3300005718 | Bacteria | 948 |
| 138 | Ga0068861_100052494 | 3300005719 | Bacteria | 3098 |
| 139 | Ga0068861_100365336 | 3300005719 | Bacteria | 1270 |
| 140 | Ga0068861_100413314 | 3300005719 | Bacteria | 1200 |
| 141 | Ga0068861_100740753 | 3300005719 | Unclassified | 917 |
| 142 | Ga0068863_100002248 | 3300005841 | Bacteria | 19175 |
| 143 | Ga0068863_101030875 | 3300005841 | Unclassified | 826 |
| 144 | Ga0068858_100126868 | 3300005842 | Bacteria | 2390 |
| 145 | Ga0068858_100162156 | 3300005842 | Bacteria | 2105 |
| 146 | Ga0068858_100331342 | 3300005842 | Unclassified | 1456 |
| 147 | Ga0068858_100358703 | 3300005842 | Bacteria | 1397 |
| 148 | Ga0068858_101459531 | 3300005842 | Unclassified | 674 |
| 149 | Ga0068858_102269423 | 3300005842 | Unclassified | 536 |
| 150 | Ga0068860_100016588 | 3300005843 | Bacteria | 7183 |
| 151 | Ga0068860_100360332 | 3300005843 | Bacteria | 1432 |
| 152 | Ga0068860_100824612 | 3300005843 | Bacteria | 941 |
| 153 | Ga0068860_101174248 | 3300005843 | Unclassified | 788 |
| 154 | Ga0068860_101218713 | 3300005843 | Unclassified | 773 |
| 155 | Ga0068860_101230597 | 3300005843 | Bacteria | 769 |
| 156 | Ga0068862_100025381 | 3300005844 | Bacteria | 4975 |
| 157 | Ga0068862_100039769 | 3300005844 | Bacteria | 3996 |
| 158 | Ga0068862_100168875 | 3300005844 | Bacteria | 1957 |
| 159 | Ga0068862_100238312 | 3300005844 | Unclassified | 1653 |
| 160 | Ga0068862_100382905 | 3300005844 | Bacteria | 1312 |
| 161 | Ga0081455_10039863 | 3300005937 | Bacteria | 4146 |
| 162 | Ga0075432_10148080 | 3300006058 | Unclassified | 900 |
| 163 | Ga0097621_100015072 | 3300006237 | Bacteria | 5804 |
| 164 | Ga0097621_100053718 | 3300006237 | Bacteria | 3284 |
| 165 | Ga0097621_100315775 | 3300006237 | Bacteria | 1383 |
| 166 | Ga0068871_100043737 | 3300006358 | Bacteria | 3599 |
| 167 | Ga0068871_100232540 | 3300006358 | Bacteria | 1600 |
| 168 | Ga0075428_100194367 | 3300006844 | Bacteria | 2194 |
| 169 | Ga0075428_100210920 | 3300006844 | Bacteria | 2099 |
| 170 | Ga0075428_101146298 | 3300006844 | Bacteria | 820 |
| 171 | Ga0075430_100149681 | 3300006846 | Bacteria | 1944 |
| 172 | Ga0075431_100316434 | 3300006847 | Unclassified | 1574 |
| 173 | Ga0075431_100551023 | 3300006847 | Bacteria | 1140 |
| 174 | Ga0075433_10038933 | 3300006852 | Bacteria | 4109 |
| 175 | Ga0075433_10055981 | 3300006852 | Bacteria | 3444 |
| 176 | Ga0075433_10143621 | 3300006852 | Bacteria | 2121 |
| 177 | Ga0075433_10176595 | 3300006852 | Bacteria | 1901 |
| 178 | Ga0075433_10292478 | 3300006852 | Bacteria | 1442 |
| 179 | Ga0075433_10347596 | 3300006852 | Bacteria | 1311 |
| 180 | Ga0075433_10827124 | 3300006852 | Bacteria | 809 |
| 181 | Ga0075434_100000008 | 3300006871 | Bacteria | 92859 |
| 182 | Ga0075434_100027537 | 3300006871 | Bacteria | 5582 |
| 183 | Ga0075434_100055477 | 3300006871 | Unclassified | 3937 |
| 184 | Ga0075434_100477790 | 3300006871 | Bacteria | 1267 |
| 185 | Ga0075434_102260752 | 3300006871 | Bacteria | 547 |
| 186 | Ga0075429_100120831 | 3300006880 | Bacteria | 2290 |
| 187 | Ga0075429_100392232 | 3300006880 | Bacteria | 1216 |
| 188 | Ga0075429_100647350 | 3300006880 | Bacteria | 926 |
| 189 | Ga0075429_100946899 | 3300006880 | Bacteria | 753 |
| 190 | Ga0068865_100080099 | 3300006881 | Bacteria | 2341 |
| 191 | Ga0068865_100244775 | 3300006881 | Bacteria | 1412 |
| 192 | Ga0075436_100000027 | 3300006914 | Bacteria | 97947 |
| 193 | Ga0075436_100011040 | 3300006914 | Bacteria | 6197 |
| 194 | Ga0075436_100045390 | 3300006914 | Bacteria | 3031 |
| 195 | Ga0075436_100057458 | 3300006914 | Unclassified | 2687 |
| 196 | Ga0075436_100122217 | 3300006914 | Bacteria | 1822 |
| 197 | Ga0075436_100206366 | 3300006914 | Bacteria | 1392 |
| 198 | Ga0075436_101138981 | 3300006914 | Unclassified | 588 |
| 199 | Ga0097620_100004436 | 3300006931 | Bacteria | 14320 |
| 200 | Ga0097620_100389638 | 3300006931 | Bacteria | 1489 |
| 201 | Ga0097620_100586928 | 3300006931 | Bacteria | 1208 |
| 202 | Ga0097620_100736330 | 3300006931 | Unclassified | 1075 |
| 203 | Ga0097620_101806034 | 3300006931 | Bacteria | 675 |
| 204 | Ga0075435_100000003 | 3300007076 | Bacteria | 124953 |
| 205 | Ga0075435_100013881 | 3300007076 | Bacteria | 6007 |
| 206 | Ga0075435_100141099 | 3300007076 | Unclassified | 2022 |
| 207 | Ga0075435_100175645 | 3300007076 | Bacteria | 1809 |
| 208 | Ga0075435_100193404 | 3300007076 | Bacteria | 1722 |
| 209 | Ga0099794_10031037 | 3300007265 | Bacteria | 2499 |
| 210 | Ga0105240_10059431 | 3300009093 | Bacteria | 4771 |
| 211 | Ga0105240_10150780 | 3300009093 | Unclassified | 2769 |
| 212 | Ga0105240_10216496 | 3300009093 | Bacteria | 2234 |
| 213 | Ga0105240_10265781 | 3300009093 | Bacteria | 1977 |
| 214 | Ga0105240_10494925 | 3300009093 | Bacteria | 1360 |
| 215 | Ga0105240_10626738 | 3300009093 | Bacteria | 1181 |
| 216 | Ga0105240_11020135 | 3300009093 | Unclassified | 884 |
| 217 | Ga0111539_10009890 | 3300009094 | Bacteria | 12033 |
| 218 | Ga0111539_10123852 | 3300009094 | Bacteria | 3030 |
| 219 | Ga0111539_10183180 | 3300009094 | Bacteria | 2446 |
| 220 | Ga0111539_10419571 | 3300009094 | Bacteria | 1558 |
| 221 | Ga0111539_10566272 | 3300009094 | Bacteria | 1323 |
| 222 | Ga0111539_10882244 | 3300009094 | Unclassified | 1040 |
| 223 | Ga0111539_11306255 | 3300009094 | Bacteria | 842 |
| 224 | Ga0105245_10000995 | 3300009098 | Bacteria | 25730 |
| 225 | Ga0105245_10010053 | 3300009098 | Bacteria | 8243 |
| 226 | Ga0105245_10016474 | 3300009098 | Bacteria | 6449 |
| 227 | Ga0105245_10280874 | 3300009098 | Unclassified | 1627 |
| 228 | Ga0105245_10342415 | 3300009098 | Unclassified | 1479 |
| 229 | Ga0105245_10386342 | 3300009098 | Bacteria | 1395 |
| 230 | Ga0105245_10518402 | 3300009098 | Unclassified | 1210 |
| 231 | Ga0105245_10576985 | 3300009098 | Bacteria | 1149 |
| 232 | Ga0105245_11288328 | 3300009098 | Unclassified | 780 |
| 233 | Ga0114129_10002259 | 3300009147 | Bacteria | 26632 |
| 234 | Ga0114129_10013616 | 3300009147 | Bacteria | 11587 |
| 235 | Ga0114129_10020088 | 3300009147 | Bacteria | 9508 |
| 236 | Ga0114129_10080667 | 3300009147 | Bacteria | 4522 |
| 237 | Ga0114129_10158846 | 3300009147 | Bacteria | 3090 |
| 238 | Ga0114129_10250487 | 3300009147 | Bacteria | 2378 |
| 239 | Ga0114129_10639343 | 3300009147 | Bacteria | 1374 |
| 240 | Ga0114129_10660927 | 3300009147 | Bacteria | 1348 |
| 241 | Ga0114129_10711046 | 3300009147 | Unclassified | 1290 |
| 242 | Ga0114129_11190981 | 3300009147 | Unclassified | 949 |
| 243 | Ga0114129_12166573 | 3300009147 | Unclassified | 669 |
| 244 | Ga0105243_10026001 | 3300009148 | Bacteria | 4479 |
| 245 | Ga0105243_10028709 | 3300009148 | Bacteria | 4272 |
| 246 | Ga0105243_10250631 | 3300009148 | Bacteria | 1580 |
| 247 | Ga0105243_10333544 | 3300009148 | Unclassified | 1386 |
| 248 | Ga0105241_10003993 | 3300009174 | Bacteria | 10905 |
| 249 | Ga0105241_10004427 | 3300009174 | Bacteria | 10388 |
| 250 | Ga0105241_10052491 | 3300009174 | Bacteria | 3113 |
| 251 | Ga0105241_10090756 | 3300009174 | Bacteria | 2410 |
| 252 | Ga0105241_10185185 | 3300009174 | Bacteria | 1730 |
| 253 | Ga0105242_10021225 | 3300009176 | Bacteria | 5096 |
| 254 | Ga0105242_10213542 | 3300009176 | Bacteria | 1721 |
| 255 | Ga0105242_10361157 | 3300009176 | Bacteria | 1344 |
| 256 | Ga0105242_10387470 | 3300009176 | Bacteria | 1301 |
| 257 | Ga0105242_10421655 | 3300009176 | Unclassified | 1251 |
| 258 | Ga0105242_11199483 | 3300009176 | Bacteria | 778 |
| 259 | Ga0105242_11353167 | 3300009176 | Bacteria | 738 |
| 260 | Ga0105248_10002352 | 3300009177 | Bacteria | 20987 |
| 261 | Ga0105248_10044053 | 3300009177 | Bacteria | 5004 |
| 262 | Ga0105248_10061746 | 3300009177 | Bacteria | 4208 |
| 263 | Ga0105248_10122096 | 3300009177 | Unclassified | 2938 |
| 264 | Ga0105248_10263057 | 3300009177 | Bacteria | 1942 |
| 265 | Ga0105248_10595851 | 3300009177 | Bacteria | 1247 |
| 266 | Ga0105248_10698211 | 3300009177 | Bacteria | 1145 |
| 267 | Ga0105248_10731291 | 3300009177 | Bacteria | 1117 |
| 268 | Ga0105248_11235203 | 3300009177 | Unclassified | 845 |
| 269 | Ga0105248_11386353 | 3300009177 | Unclassified | 795 |
| 270 | Ga0105248_11691672 | 3300009177 | Unclassified | 717 |
| 271 | Ga0105237_10003834 | 3300009545 | Bacteria | 17679 |
| 272 | Ga0105237_10050866 | 3300009545 | Bacteria | 4164 |
| 273 | Ga0105237_10080424 | 3300009545 | Bacteria | 3249 |
| 274 | Ga0105237_10330756 | 3300009545 | Bacteria | 1528 |
| 275 | Ga0105237_10802424 | 3300009545 | Bacteria | 948 |
| 276 | Ga0105238_10003582 | 3300009551 | Bacteria | 15484 |
| 277 | Ga0105238_10008583 | 3300009551 | Bacteria | 10221 |
| 278 | Ga0105238_10008740 | 3300009551 | Bacteria | 10133 |
| 279 | Ga0105238_10040342 | 3300009551 | Bacteria | 4731 |
| 280 | Ga0105238_11036808 | 3300009551 | Unclassified | 842 |
| 281 | Ga0105249_10010002 | 3300009553 | Bacteria | 8322 |
| 282 | Ga0105249_10082274 | 3300009553 | Bacteria | 2996 |
| 283 | Ga0105249_10140243 | 3300009553 | Unclassified | 2317 |
| 284 | Ga0105249_10252921 | 3300009553 | Bacteria | 1748 |
| 285 | Ga0105249_10512227 | 3300009553 | Bacteria | 1246 |
| 286 | Ga0105239_10001560 | 3300010375 | Bacteria | 30320 |
| 287 | Ga0105239_10003467 | 3300010375 | Bacteria | 19300 |
| 288 | Ga0105239_10005119 | 3300010375 | Bacteria | 15475 |
| 289 | Ga0105239_10177067 | 3300010375 | Bacteria | 2385 |
| 290 | Ga0105246_10007724 | 3300011119 | Bacteria | 6599 |
| 291 | Ga0105246_10016536 | 3300011119 | Bacteria | 4671 |
| 292 | Ga0105246_10022428 | 3300011119 | Bacteria | 4073 |
| 293 | Ga0105246_10440855 | 3300011119 | Unclassified | 1092 |
| 294 | Ga0157373_10397864 | 3300013100 | Unclassified | 987 |
| 295 | Ga0157370_10012271 | 3300013104 | Bacteria | 8894 |
| 296 | Ga0157369_10139285 | 3300013105 | Bacteria | 2568 |
| 297 | Ga0157369_11102366 | 3300013105 | Unclassified | 811 |
| 298 | Ga0157374_10058634 | 3300013296 | Bacteria | 3598 |
| 299 | Ga0157374_10084437 | 3300013296 | Bacteria | 3018 |
| 300 | Ga0157378_10003102 | 3300013297 | Bacteria | 14775 |
| 301 | Ga0157378_10574705 | 3300013297 | Archaea | 1135 |
| 302 | Ga0157378_10797341 | 3300013297 | Unclassified | 970 |
| 303 | Ga0157378_11142677 | 3300013297 | Unclassified | 817 |
| 304 | Ga0163162_10168635 | 3300013306 | Bacteria | 2313 |
| 305 | Ga0163162_10890422 | 3300013306 | Bacteria | 1004 |
| 306 | Ga0163162_11809243 | 3300013306 | Bacteria | 698 |
| 307 | Ga0157372_10010127 | 3300013307 | Bacteria | 10015 |
| 308 | Ga0157372_10028028 | 3300013307 | Bacteria | 6143 |
| 309 | Ga0157372_10044505 | 3300013307 | Bacteria | 4919 |
| 310 | Ga0157372_10356130 | 3300013307 | Bacteria | 1705 |
| 311 | Ga0157375_10022810 | 3300013308 | Bacteria | 5765 |
| 312 | Ga0157375_10173308 | 3300013308 | Unclassified | 2306 |
| 313 | Ga0157375_10646228 | 3300013308 | Bacteria | 1214 |
| 314 | Ga0163163_10011957 | 3300014325 | Bacteria | 7897 |
| 315 | Ga0163163_10050827 | 3300014325 | Bacteria | 4083 |
| 316 | Ga0163163_10061557 | 3300014325 | Bacteria | 3719 |
| 317 | Ga0163163_10532008 | 3300014325 | Bacteria | 1238 |
| 318 | Ga0163163_10563800 | 3300014325 | Unclassified | 1202 |
| 319 | Ga0163163_11297927 | 3300014325 | Bacteria | 790 |
| 320 | Ga0157380_10022436 | 3300014326 | Bacteria | 4752 |
| 321 | Ga0157380_10396070 | 3300014326 | Bacteria | 1308 |
| 322 | Ga0157380_10431496 | 3300014326 | Bacteria | 1260 |
| 323 | Ga0157379_10036385 | 3300014968 | Bacteria | 4390 |
| 324 | Ga0157379_10036482 | 3300014968 | Bacteria | 4382 |
| 325 | Ga0157379_10037219 | 3300014968 | Unclassified | 4338 |
| 326 | Ga0157379_10150448 | 3300014968 | Bacteria | 2099 |
| 327 | Ga0157379_10307717 | 3300014968 | Unclassified | 1445 |
| 328 | Ga0157376_10203321 | 3300014969 | Bacteria | 1824 |
| 329 | Ga0157376_10218689 | 3300014969 | Bacteria | 1763 |
| 330 | Ga0157376_10281898 | 3300014969 | Bacteria | 1565 |
| 331 | Ga0163161_10411377 | 3300017792 | Unclassified | 1086 |
| 332 | Ga0163161_10638212 | 3300017792 | Bacteria | 881 |
| 333 | Ga0207697_10049771 | 3300025315 | Unclassified | 1730 |
| 334 | Ga0207653_10238454 | 3300025885 | Bacteria | 694 |
| 335 | Ga0207692_10830205 | 3300025898 | Bacteria | 605 |
| 336 | Ga0207642_10050838 | 3300025899 | Bacteria | 1872 |
| 337 | Ga0207642_10075643 | 3300025899 | Unclassified | 1618 |
| 338 | Ga0207642_10449358 | 3300025899 | Unclassified | 781 |
| 339 | Ga0207688_10207309 | 3300025901 | Bacteria | 1177 |
| 340 | Ga0207680_10159721 | 3300025903 | Unclassified | 1510 |
| 341 | Ga0207680_10163236 | 3300025903 | Bacteria | 1496 |
| 342 | Ga0207685_10693485 | 3300025905 | Unclassified | 554 |
| 343 | Ga0207699_10386857 | 3300025906 | Unclassified | 994 |
| 344 | Ga0207645_10025740 | 3300025907 | Unclassified | 3806 |
| 345 | Ga0207645_10037955 | 3300025907 | Bacteria | 3091 |
| 346 | Ga0207645_10144208 | 3300025907 | Bacteria | 1552 |
| 347 | Ga0207645_10541892 | 3300025907 | Unclassified | 789 |
| 348 | Ga0207684_10773072 | 3300025910 | Bacteria | 813 |
| 349 | Ga0207654_10004365 | 3300025911 | Bacteria | 7128 |
| 350 | Ga0207654_10008452 | 3300025911 | Bacteria | 5205 |
| 351 | Ga0207654_10073794 | 3300025911 | Bacteria | 2034 |
| 352 | Ga0207654_10428409 | 3300025911 | Unclassified | 924 |
| 353 | Ga0207654_10661438 | 3300025911 | Unclassified | 749 |
| 354 | Ga0207707_10001082 | 3300025912 | Bacteria | 26051 |
| 355 | Ga0207707_11361760 | 3300025912 | Unclassified | 568 |
| 356 | Ga0207695_10001264 | 3300025913 | Bacteria | 43057 |
| 357 | Ga0207695_10177848 | 3300025913 | Bacteria | 2049 |
| 358 | Ga0207695_10304252 | 3300025913 | Unclassified | 1485 |
| 359 | Ga0207695_10355257 | 3300025913 | Bacteria | 1352 |
| 360 | Ga0207695_10948776 | 3300025913 | Bacteria | 740 |
| 361 | Ga0207671_10003366 | 3300025914 | Bacteria | 16036 |
| 362 | Ga0207671_10004291 | 3300025914 | Bacteria | 13713 |
| 363 | Ga0207671_10636530 | 3300025914 | Bacteria | 849 |
| 364 | Ga0207663_10036173 | 3300025916 | Bacteria | 2969 |
| 365 | Ga0207663_10553727 | 3300025916 | Bacteria | 899 |
| 366 | Ga0207660_10039300 | 3300025917 | Bacteria | 3307 |
| 367 | Ga0207662_10165925 | 3300025918 | Unclassified | 1414 |
| 368 | Ga0207662_11160315 | 3300025918 | Bacteria | 549 |
| 369 | Ga0207657_11195673 | 3300025919 | Unclassified | 578 |
| 370 | Ga0207649_10525386 | 3300025920 | Bacteria | 903 |
| 371 | Ga0207652_10006515 | 3300025921 | Bacteria | 9413 |
| 372 | Ga0207646_10386952 | 3300025922 | Bacteria | 1263 |
| 373 | Ga0207646_10464150 | 3300025922 | Bacteria | 1142 |
| 374 | Ga0207646_10681486 | 3300025922 | Unclassified | 920 |
| 375 | Ga0207646_11936896 | 3300025922 | Bacteria | 502 |
| 376 | Ga0207681_10043546 | 3300025923 | Unclassified | 3005 |
| 377 | Ga0207681_10172124 | 3300025923 | Bacteria | 1642 |
| 378 | Ga0207681_10256114 | 3300025923 | Bacteria | 1368 |
| 379 | Ga0207681_10699549 | 3300025923 | Unclassified | 843 |
| 380 | Ga0207694_10000985 | 3300025924 | Bacteria | 24968 |
| 381 | Ga0207694_10088360 | 3300025924 | Unclassified | 2443 |
| 382 | Ga0207694_11438090 | 3300025924 | Unclassified | 582 |
| 383 | Ga0207659_10138714 | 3300025926 | Bacteria | 1885 |
| 384 | Ga0207687_10001118 | 3300025927 | Bacteria | 18248 |
| 385 | Ga0207687_10013555 | 3300025927 | Bacteria | 5321 |
| 386 | Ga0207687_10185179 | 3300025927 | Bacteria | 1616 |
| 387 | Ga0207687_11281435 | 3300025927 | Unclassified | 630 |
| 388 | Ga0207700_10055679 | 3300025928 | Bacteria | 2973 |
| 389 | Ga0207644_10049191 | 3300025931 | Bacteria | 3017 |
| 390 | Ga0207644_10194493 | 3300025931 | Unclassified | 1596 |
| 391 | Ga0207644_10286280 | 3300025931 | Bacteria | 1324 |
| 392 | Ga0207706_10103492 | 3300025933 | Bacteria | 2505 |
| 393 | Ga0207686_10002961 | 3300025934 | Bacteria | 9155 |
| 394 | Ga0207686_10044422 | 3300025934 | Bacteria | 2728 |
| 395 | Ga0207686_10052381 | 3300025934 | Bacteria | 2547 |
| 396 | Ga0207686_10229808 | 3300025934 | Bacteria | 1344 |
| 397 | Ga0207686_10874442 | 3300025934 | Archaea | 724 |
| 398 | Ga0207709_10081823 | 3300025935 | Bacteria | 2083 |
| 399 | Ga0207709_10252965 | 3300025935 | Unclassified | 1288 |
| 400 | Ga0207709_11055297 | 3300025935 | Archaea | 666 |
| 401 | Ga0207709_11292282 | 3300025935 | Unclassified | 603 |
| 402 | Ga0207670_10037852 | 3300025936 | Unclassified | 3146 |
| 403 | Ga0207670_10247515 | 3300025936 | Bacteria | 1376 |
| 404 | Ga0207670_10259592 | 3300025936 | Bacteria | 1346 |
| 405 | Ga0207670_10947687 | 3300025936 | Unclassified | 722 |
| 406 | Ga0207670_11669161 | 3300025936 | Bacteria | 542 |
| 407 | Ga0207670_11728033 | 3300025936 | Unclassified | 532 |
| 408 | Ga0207669_10084910 | 3300025937 | Bacteria | 2042 |
| 409 | Ga0207669_11458449 | 3300025937 | Unclassified | 583 |
| 410 | Ga0207704_10038582 | 3300025938 | Bacteria | 2772 |
| 411 | Ga0207704_10965880 | 3300025938 | Bacteria | 719 |
| 412 | Ga0207665_10088056 | 3300025939 | Bacteria | 2147 |
| 413 | Ga0207691_10032228 | 3300025940 | Unclassified | 4887 |
| 414 | Ga0207711_10038447 | 3300025941 | Unclassified | 4069 |
| 415 | Ga0207711_10116322 | 3300025941 | Bacteria | 2384 |
| 416 | Ga0207711_10299374 | 3300025941 | Unclassified | 1483 |
| 417 | Ga0207711_10614462 | 3300025941 | Bacteria | 1014 |
| 418 | Ga0207711_11123535 | 3300025941 | Unclassified | 727 |
| 419 | Ga0207689_10021246 | 3300025942 | Bacteria | 5457 |
| 420 | Ga0207689_10113291 | 3300025942 | Bacteria | 2230 |
| 421 | Ga0207661_10000365 | 3300025944 | Bacteria | 29025 |
| 422 | Ga0207661_10003386 | 3300025944 | Bacteria | 11073 |
| 423 | Ga0207661_10285687 | 3300025944 | Bacteria | 1475 |
| 424 | Ga0207661_10395542 | 3300025944 | Bacteria | 1252 |
| 425 | Ga0207667_10002201 | 3300025949 | Bacteria | 24454 |
| 426 | Ga0207651_10217939 | 3300025960 | Archaea | 1541 |
| 427 | Ga0207651_10309662 | 3300025960 | Bacteria | 1316 |
| 428 | Ga0207712_10122621 | 3300025961 | Unclassified | 1969 |
| 429 | Ga0207712_10378796 | 3300025961 | Bacteria | 1184 |
| 430 | Ga0207712_11006337 | 3300025961 | Bacteria | 740 |
| 431 | Ga0207712_11028681 | 3300025961 | Bacteria | 731 |
| 432 | Ga0207712_11309766 | 3300025961 | Unclassified | 647 |
| 433 | Ga0207668_10768899 | 3300025972 | Unclassified | 851 |
| 434 | Ga0207668_10769373 | 3300025972 | Bacteria | 850 |
| 435 | Ga0207640_10859119 | 3300025981 | Unclassified | 790 |
| 436 | Ga0207640_10964881 | 3300025981 | Unclassified | 748 |
| 437 | Ga0207658_10314454 | 3300025986 | Bacteria | 1354 |
| 438 | Ga0207677_10178308 | 3300026023 | Bacteria | 1669 |
| 439 | Ga0207677_10449299 | 3300026023 | Bacteria | 1104 |
| 440 | Ga0207677_10964686 | 3300026023 | Bacteria | 771 |
| 441 | Ga0207703_10120667 | 3300026035 | Bacteria | 2250 |
| 442 | Ga0207703_10385184 | 3300026035 | Unclassified | 1298 |
| 443 | Ga0207703_10436162 | 3300026035 | Bacteria | 1221 |
| 444 | Ga0207703_11273595 | 3300026035 | Unclassified | 707 |
| 445 | Ga0207703_11283445 | 3300026035 | Bacteria | 704 |
| 446 | Ga0207639_10032444 | 3300026041 | Bacteria | 3845 |
| 447 | Ga0207639_10248516 | 3300026041 | Bacteria | 1550 |
| 448 | Ga0207639_10465975 | 3300026041 | Bacteria | 1149 |
| 449 | Ga0207639_11300627 | 3300026041 | Unclassified | 682 |
| 450 | Ga0207708_10011567 | 3300026075 | Bacteria | 6576 |
| 451 | Ga0207708_10026291 | 3300026075 | Bacteria | 4404 |
| 452 | Ga0207708_10125138 | 3300026075 | Bacteria | 2006 |
| 453 | Ga0207702_10705357 | 3300026078 | Bacteria | 994 |
| 454 | Ga0207641_10002063 | 3300026088 | Bacteria | 19079 |
| 455 | Ga0207641_10878293 | 3300026088 | Unclassified | 890 |
| 456 | Ga0207641_11254359 | 3300026088 | Bacteria | 741 |
| 457 | Ga0207641_11861595 | 3300026088 | Bacteria | 603 |
| 458 | Ga0207648_10031143 | 3300026089 | Bacteria | 4716 |
| 459 | Ga0207648_10047304 | 3300026089 | Unclassified | 3771 |
| 460 | Ga0207648_10138703 | 3300026089 | Bacteria | 2143 |
| 461 | Ga0207648_10651937 | 3300026089 | Bacteria | 973 |
| 462 | Ga0207674_10000042 | 3300026116 | Bacteria | 126790 |
| 463 | Ga0207674_10004196 | 3300026116 | Bacteria | 17388 |
| 464 | Ga0207674_10725777 | 3300026116 | Unclassified | 959 |
| 465 | Ga0207675_100122073 | 3300026118 | Unclassified | 2466 |
| 466 | Ga0207675_100211171 | 3300026118 | Bacteria | 1867 |
| 467 | Ga0207675_100217770 | 3300026118 | Bacteria | 1839 |
| 468 | Ga0207675_100231408 | 3300026118 | Unclassified | 1783 |
| 469 | Ga0207675_100590974 | 3300026118 | Bacteria | 1112 |
| 470 | Ga0207675_102478749 | 3300026118 | Unclassified | 530 |
| 471 | Ga0268265_10009546 | 3300028380 | Bacteria | 6553 |
| 472 | Ga0268265_10035070 | 3300028380 | Unclassified | 3662 |
| 473 | Ga0268265_10181899 | 3300028380 | Unclassified | 1807 |
| 474 | Ga0268265_10586421 | 3300028380 | Bacteria | 1063 |
| 475 | Ga0268265_10665752 | 3300028380 | Bacteria | 1002 |
| 476 | Ga0268265_11743442 | 3300028380 | Unclassified | 629 |
| 477 | Ga0268264_10247806 | 3300028381 | Unclassified | 1653 |
| 478 | Ga0268264_10394032 | 3300028381 | Bacteria | 1329 |
| 479 | Ga0268264_10522970 | 3300028381 | Unclassified | 1160 |
| 480 | Ga0268264_11301584 | 3300028381 | Unclassified | 737 |
| 481 | Ga0265318_10313029 | 3300028577 | Bacteria | 573 |
| 482 | Ga0307408_102052516 | 3300031548 | Bacteria | 550 |
| 483 | Ga0265313_10006767 | 3300031595 | Bacteria | 8019 |
| 484 | Ga0373948_0113580 | 3300034817 | Unclassified | 649 |
| 485 | Ga0373958_0000467 | 3300034819 | Bacteria | 4954 |
| 486 | Ga0373959_0000365 | 3300034820 | Bacteria | 9011 |
| 487 | Ga0373928_0004057 | 3300035084 | Bacteria | 2795 |
| 488 | Ga0373929_0002432 | 3300035085 | Bacteria | 3420 |
| 489 | Ga0373934_0002765 | 3300035086 | Bacteria | 6432 |
| 490 | Ga0373934_0240822 | 3300035086 | Bacteria | 747 |
| 491 | Ga0373940_0000042 | 3300035088 | Bacteria | 13879 |
| 492 | Ga0373951_0004493 | 3300035091 | Bacteria | 3309 |
| 493 | Ga0373952_0001618 | 3300035092 | Bacteria | 4097 |
| 494 | Ga0373923_0076298 | 3300035111 | Bacteria | 1447 |
| 495 | Ga0373932_0000932 | 3300035112 | Bacteria | 8556 |
| 496 | Ga0373936_0094527 | 3300035113 | Bacteria | 1256 |
| 497 | Ga0373936_0108637 | 3300035113 | Bacteria | 1176 |
| 498 | Ga0373939_0194113 | 3300035114 | Unclassified | 764 |
| 499 | Ga0373941_0009794 | 3300035115 | Bacteria | 2423 |
| 500 | Ga0373941_0147089 | 3300035115 | Bacteria | 861 |
| 501 | Ga0373953_0014028 | 3300035117 | Unclassified | 2875 |
| 502 | Ga0373953_0044960 | 3300035117 | Bacteria | 1768 |
| 503 | Ga0373954_0005904 | 3300035118 | Bacteria | 5322 |
| 504 | Ga0373954_0494466 | 3300035118 | Bacteria | 606 |
| 505 | Ga0373956_0616574 | 3300035119 | Bacteria | 518 |
| 506 | Ga0373960_0014458 | 3300035121 | Bacteria | 2000 |
| 507 | Ga0373943_0288074 | 3300035170 | Unclassified | 930 |
| 508 | Ga0373955_0003733 | 3300035172 | Bacteria | 6708 |
| 509 | Ga0373955_0024298 | 3300035172 | Bacteria | 3098 |
| 510 | Ga0373955_0100013 | 3300035172 | Bacteria | 1663 |
| 511 | Ga0373955_0425656 | 3300035172 | Unclassified | 808 |
| 512 | Ga0373961_0003447 | 3300035241 | Bacteria | 3912 |
| 513 | Ga0373924_0033660 | 3300035410 | Bacteria | 2070 |
| 514 | Ga0373924_0236576 | 3300035410 | Bacteria | 808 |
| 515 | Ga0373931_0001065 | 3300035691 | Bacteria | 11607 |
| 516 | Ga0373935_0123876 | 3300035692 | Bacteria | 1730 |
| 517 | Ga0373935_0143489 | 3300035692 | Bacteria | 1615 |
| 518 | Ga0373927_0341039 | 3300035695 | Unclassified | 987 |
| 519 | Ga0373933_0008593 | 3300035724 | Bacteria | 5570 |
| 520 | Ga0373933_0064300 | 3300035724 | Bacteria | 2219 |
| 521 | Ga0373937_0005019 | 3300036401 | Bacteria | 11262 |
| 522 | Ga0373937_0010310 | 3300036401 | Bacteria | 8156 |
| 523 | Ga0373937_0026597 | 3300036401 | Bacteria | 5228 |
| 524 | Ga0373937_0145960 | 3300036401 | Bacteria | 2215 |
| 525 | Ga0373937_0725743 | 3300036401 | Bacteria | 941 |
| 526 | Ga0373937_1278156 | 3300036401 | Unclassified | 682 |
| 527 | Ga0373937_1585673 | 3300036401 | Unclassified | 602 |
| 528 | Ga0373925_1160086 | 3300037068 | Unclassified | 635 |
| 529 | Ga0395898_1130371 | 3300037466 | Unclassified | 716 |
| 530 | Ga0395901_0740811 | 3300038443 | Bacteria | 977 |
| 531 | Ga0439455_0254181 | 3300042012 | Unclassified | 515 |
| 532 | Ga0451576_0005340 | 3300045051 | Bacteria | 16151 |
| 533 | Ga0451576_0151111 | 3300045051 | Unclassified | 2422 |
| 534 | Ga0495592_0290259 | 3300046454 | Bacteria | 1066 |
| 535 | Ga0495651_0449080 | 3300046462 | Unclassified | 833 |
| 536 | Ga0495651_0475942 | 3300046462 | Unclassified | 803 |
| 537 | Ga0495653_0307631 | 3300046463 | Bacteria | 1032 |
| 538 | Ga0495580_0137993 | 3300046472 | Bacteria | 1691 |
| 539 | Ga0495639_0424335 | 3300046475 | Unclassified | 673 |
| 540 | Ga0495664_0033136 | 3300046477 | Bacteria | 3036 |
| 541 | Ga0495594_0467512 | 3300046499 | Unclassified | 717 |
| 542 | Ga0495608_0133456 | 3300046511 | Bacteria | 1588 |
| 543 | Ga0495628_0249933 | 3300046516 | Unclassified | 1324 |
| 544 | Ga0495630_0383536 | 3300046517 | Unclassified | 1077 |
| 545 | Ga0495666_0080436 | 3300046526 | Bacteria | 1542 |
| 546 | Ga0495652_0026824 | 3300046529 | Bacteria | 5083 |
| 547 | Ga0495652_0200045 | 3300046529 | Unclassified | 1517 |
| 548 | Ga0495665_0048124 | 3300046531 | Bacteria | 2261 |
| 549 | Ga0495640_0023882 | 3300046533 | Bacteria | 4448 |
| 550 | Ga0495586_0022817 | 3300046535 | Bacteria | 3340 |
| 551 | Ga0495586_0035520 | 3300046535 | Unclassified | 2678 |
| 552 | Ga0495586_0104367 | 3300046535 | Bacteria | 1575 |
| 553 | Ga0495586_0323360 | 3300046535 | Bacteria | 885 |
| 554 | Ga0495587_0069604 | 3300046536 | Unclassified | 2049 |
| 555 | Ga0495587_0102177 | 3300046536 | Bacteria | 1651 |
| 556 | Ga0495598_0358009 | 3300046537 | Unclassified | 563 |
| 557 | Ga0495645_0187300 | 3300046543 | Bacteria | 1413 |
| 558 | Ga0495645_0524007 | 3300046543 | Bacteria | 738 |
| 559 | Ga0495645_0701014 | 3300046543 | Unclassified | 615 |
| 560 | Ga0495667_0598797 | 3300046559 | Bacteria | 687 |
| 561 | Ga0495656_0634522 | 3300046615 | Unclassified | 573 |
| 562 | Ga0495634_0043856 | 3300046642 | Bacteria | 3030 |
| 563 | Ga0495657_0557734 | 3300046675 | Bacteria | 665 |
| 564 | Ga0495599_0015319 | 3300046678 | Bacteria | 4757 |
| 565 | Ga0495658_0009241 | 3300046683 | Bacteria | 4903 |
| 566 | Ga0495658_0765601 | 3300046683 | Unclassified | 618 |
| 567 | Ga0495613_0235160 | 3300046689 | Bacteria | 1282 |
| 568 | Ga0495624_0461651 | 3300046690 | Bacteria | 761 |
| 569 | Ga0495604_0420209 | 3300047317 | Unclassified | 878 |
| 570 | Ga0495604_0606565 | 3300047317 | Unclassified | 701 |
| 571 | Ga0495674_0010765 | 3300047319 | Bacteria | 8652 |
| 572 | Ga0495680_0239275 | 3300047322 | Bacteria | 1290 |
| 573 | Ga0495680_0965715 | 3300047322 | Bacteria | 546 |
| 574 | Ga0495675_0034828 | 3300047444 | Unclassified | 3215 |
| 575 | Ga0495684_0018073 | 3300047471 | Bacteria | 5433 |
| 576 | Ga0495684_0628237 | 3300047471 | Bacteria | 721 |
| 577 | Ga0495684_0698594 | 3300047471 | Unclassified | 673 |
| 578 | Ga0495593_0470703 | 3300047673 | Unclassified | 629 |
| 579 | Ga0495602_0104389 | 3300048088 | Bacteria | 2318 |
| 580 | Ga0495602_0837345 | 3300048088 | Unclassified | 616 |
| 581 | Ga0495602_0893765 | 3300048088 | Unclassified | 591 |
| 582 | Ga0496101_0180416 | 3300048904 | Unclassified | 1626 |
| 583 | Ga0496102_0092827 | 3300048905 | Bacteria | 2796 |
| 584 | Ga0496102_1030270 | 3300048905 | Bacteria | 743 |
| 585 | Ga0496104_0070864 | 3300048907 | Unclassified | 3315 |
| 586 | Ga0496106_0242260 | 3300048909 | Bacteria | 1441 |
| 587 | Ga0496106_1545080 | 3300048909 | Unclassified | 510 |
| 588 | Ga0496107_0432121 | 3300048910 | Unclassified | 979 |
| 589 | Ga0496112_0455489 | 3300048915 | Unclassified | 1217 |
| 590 | nmdc:mga05p37_1363594_c1 | 3300050507 | Unclassified | 717 |
| 591 | nmdc:mga05p37_191440_c1 | 3300050507 | Bacteria | 2483 |
| 592 | nmdc:mga05p37_2297_c1 | 3300050507 | Bacteria | 22293 |
| 593 | nmdc:mga05p37_271227_c1 | 3300050507 | Unclassified | 2027 |
| 594 | nmdc:mga05p37_29151_c1 | 3300050507 | Bacteria | 6737 |
| 595 | nmdc:mga05p37_30104_c1 | 3300050507 | Bacteria | 6624 |
| 596 | nmdc:mga05p37_371285_c1 | 3300050507 | Bacteria | 1679 |
| 597 | nmdc:mga05p37_37360_c1 | 3300050507 | Bacteria | 5954 |
| 598 | nmdc:mga05p37_39838_c1 | 3300050507 | Bacteria | 5770 |
| 599 | nmdc:mga09592_1567812_c1 | 3300050508 | Unclassified | 534 |
| 600 | nmdc:mga09592_592880_c1 | 3300050508 | Bacteria | 950 |
| 601 | nmdc:mga09592_763997_c1 | 3300050508 | Bacteria | 819 |
| 602 | nmdc:mga0qj67_153642_c1 | 3300050509 | Bacteria | 1867 |
| 603 | nmdc:mga06r32_17814_c1 | 3300050510 | Bacteria | 6490 |
| 604 | nmdc:mga06r32_868900_c1 | 3300050510 | Unclassified | 860 |
| 605 | nmdc:mga08y16_339184_c1 | 3300050511 | Unclassified | 1545 |
| 606 | nmdc:mga08y16_485559_c1 | 3300050511 | Bacteria | 1257 |
| 607 | nmdc:mga08y16_518139_c1 | 3300050511 | Bacteria | 1210 |
| 608 | nmdc:mga08y16_66734_c1 | 3300050511 | Bacteria | 3755 |
| 609 | nmdc:mga08y16_697457_c1 | 3300050511 | Unclassified | 1015 |
| 610 | nmdc:mga0n895_1223632_c1 | 3300050512 | Bacteria | 724 |
| 611 | nmdc:mga0n895_123345_c1 | 3300050512 | Bacteria | 2613 |
| 612 | nmdc:mga0n895_125649_c1 | 3300050512 | Bacteria | 2589 |
| 613 | nmdc:mga0n895_3651_c1 | 3300050512 | Bacteria | 12443 |
| 614 | nmdc:mga0n895_40_c1 | 3300050512 | Bacteria | 75471 |
| 615 | nmdc:mga0n895_579955_c1 | 3300050512 | Unclassified | 1125 |
| 616 | nmdc:mga0rr50_101519_c1 | 3300050513 | Bacteria | 2262 |
| 617 | nmdc:mga0rr50_154265_c1 | 3300050513 | Bacteria | 1859 |
| 618 | nmdc:mga0rr50_189094_c1 | 3300050513 | Bacteria | 1686 |
| 619 | nmdc:mga0rr50_205034_c1 | 3300050513 | Unclassified | 1622 |
| 620 | nmdc:mga0rr50_45958_c1 | 3300050513 | Bacteria | 3213 |
| 621 | nmdc:mga0rr50_7_c1 | 3300050513 | Bacteria | 297175 |
| 622 | nmdc:mga08x19_1023369_c1 | 3300050514 | Unclassified | 587 |
| 623 | nmdc:mga08x19_14795_c1 | 3300050514 | Bacteria | 4738 |
| 624 | nmdc:mga08x19_163365_c1 | 3300050514 | Bacteria | 1513 |
| 625 | nmdc:mga08x19_25613_c1 | 3300050514 | Bacteria | 3676 |
| 626 | nmdc:mga08x19_386379_c1 | 3300050514 | Bacteria | 981 |
| 627 | nmdc:mga08x19_521435_c1 | 3300050514 | Unclassified | 840 |
| 628 | nmdc:mga08x19_60_c1 | 3300050514 | Bacteria | 116399 |
| 629 | nmdc:mga0a205_125561_c1 | 3300050515 | Bacteria | 2465 |
| 630 | nmdc:mga0a205_155034_c1 | 3300050515 | Unclassified | 2189 |
| 631 | nmdc:mga0a205_189126_c1 | 3300050515 | Bacteria | 1951 |
| 632 | nmdc:mga0a205_22891_c1 | 3300050515 | Bacteria | 5924 |
| 633 | nmdc:mga0a205_35320_c1 | 3300050515 | Bacteria | 4799 |
| 634 | nmdc:mga0a205_388808_c1 | 3300050515 | Unclassified | 1259 |
| 635 | nmdc:mga0a205_61187_c1 | 3300050515 | Bacteria | 3636 |
| 636 | Ga0495601_0048766 | 3300053077 | Bacteria | 2668 |
| 637 | Ga0495601_0690615 | 3300053077 | Unclassified | 652 |
| 638 | Ga0495595_0208898 | 3300053084 | Unclassified | 973 |
| 639 | Ga0495595_0678147 | 3300053084 | Unclassified | 528 |
| 640 | Ga0495619_0026818 | 3300053085 | Bacteria | 3709 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037466 | Ga0395898_1130371 | Ga0395898_1130371_216_626 | 136 |
| 2 | 3300047317 | Ga0495604_0606565 | Ga0495604_0606565_23_433 | 136 |
| 3 | 3300048909 | Ga0496106_1545080 | Ga0496106_1545080_11_436 | 136 |
| 4 | 3300046537 | Ga0495598_0358009 | Ga0495598_0358009_19_432 | 137 |
| 5 | 3300035118 | Ga0373954_0494466 | Ga0373954_0494466_131_547 | 138 |
| 6 | 3300046675 | Ga0495657_0557734 | Ga0495657_0557734_228_644 | 138 |
| 7 | 3300009176 | Ga0105242_11353167 | Ga0105242_113531671 | 139 |
| 8 | 3300031548 | Ga0307408_102052516 | Ga0307408_1020525161 | 139 |
| 9 | 3300005468 | Ga0070707_101561885 | Ga0070707_1015618851 | 140 |
| 10 | 3300005564 | Ga0070664_101295072 | Ga0070664_1012950721 | 140 |
| 11 | 3300006847 | Ga0075431_100316434 | Ga0075431_1003164343 | 140 |
| 12 | 3300006852 | Ga0075433_10143621 | Ga0075433_101436212 | 140 |
| 13 | 3300006880 | Ga0075429_100392232 | Ga0075429_1003922322 | 140 |
| 14 | 3300025912 | Ga0207707_11361760 | Ga0207707_113617601 | 140 |
| 15 | 3300025972 | Ga0207668_10768899 | Ga0207668_107688992 | 140 |
| 16 | 3300036401 | Ga0373937_0145960 | Ga0373937_0145960_1214_1651 | 140 |
| 17 | 3300036401 | Ga0373937_1278156 | Ga0373937_1278156_158_580 | 140 |
| 18 | 3300046543 | Ga0495645_0524007 | Ga0495645_0524007_188_625 | 140 |
| 19 | 3300050507 | nmdc:mga05p37_371285_c1 | nmdc:mga05p37_371285_c1_474_935 | 140 |
| 20 | 3300050508 | nmdc:mga09592_1567812_c1 | nmdc:mga09592_1567812_c1_53_514 | 140 |
| 21 | 3300050510 | nmdc:mga06r32_868900_c1 | nmdc:mga06r32_868900_c1_151_612 | 140 |
| 22 | 3300050512 | nmdc:mga0n895_579955_c1 | nmdc:mga0n895_579955_c1_577_1038 | 140 |
| 23 | 3300050515 | nmdc:mga0a205_189126_c1 | nmdc:mga0a205_189126_c1_1249_1710 | 140 |
| 24 | 3300005329 | Ga0070683_100003365 | Ga0070683_10000336511 | 141 |
| 25 | 3300005329 | Ga0070683_100014059 | Ga0070683_1000140593 | 141 |
| 26 | 3300005334 | Ga0068869_100008192 | Ga0068869_1000081924 | 141 |
| 27 | 3300005334 | Ga0068869_100130371 | Ga0068869_1001303712 | 141 |
| 28 | 3300005338 | Ga0068868_100218052 | Ga0068868_1002180522 | 141 |
| 29 | 3300005340 | Ga0070689_100029468 | Ga0070689_1000294685 | 141 |
| 30 | 3300005340 | Ga0070689_100408222 | Ga0070689_1004082222 | 141 |
| 31 | 3300005343 | Ga0070687_100950881 | Ga0070687_1009508811 | 141 |
| 32 | 3300005364 | Ga0070673_100407212 | Ga0070673_1004072122 | 141 |
| 33 | 3300005365 | Ga0070688_100269429 | Ga0070688_1002694292 | 141 |
| 34 | 3300005366 | Ga0070659_100726945 | Ga0070659_1007269452 | 141 |
| 35 | 3300005436 | Ga0070713_100203812 | Ga0070713_1002038123 | 141 |
| 36 | 3300005439 | Ga0070711_100364229 | Ga0070711_1003642292 | 141 |
| 37 | 3300005457 | Ga0070662_100031314 | Ga0070662_1000313143 | 141 |
| 38 | 3300005458 | Ga0070681_10008049 | Ga0070681_100080493 | 141 |
| 39 | 3300005459 | Ga0068867_100021152 | Ga0068867_1000211522 | 141 |
| 40 | 3300005471 | Ga0070698_101644408 | Ga0070698_1016444081 | 141 |
| 41 | 3300005530 | Ga0070679_100087579 | Ga0070679_1000875793 | 141 |
| 42 | 3300005535 | Ga0070684_100002184 | Ga0070684_10000218410 | 141 |
| 43 | 3300005535 | Ga0070684_100012534 | Ga0070684_1000125345 | 141 |
| 44 | 3300005535 | Ga0070684_100014590 | Ga0070684_1000145906 | 141 |
| 45 | 3300005535 | Ga0070684_100036326 | Ga0070684_1000363263 | 141 |
| 46 | 3300005535 | Ga0070684_100130643 | Ga0070684_1001306433 | 141 |
| 47 | 3300005539 | Ga0068853_100042327 | Ga0068853_1000423274 | 141 |
| 48 | 3300005539 | Ga0068853_100122531 | Ga0068853_1001225313 | 141 |
| 49 | 3300005539 | Ga0068853_100647525 | Ga0068853_1006475252 | 141 |
| 50 | 3300005539 | Ga0068853_100727509 | Ga0068853_1007275092 | 141 |
| 51 | 3300005543 | Ga0070672_100285364 | Ga0070672_1002853642 | 141 |
| 52 | 3300005544 | Ga0070686_100537869 | Ga0070686_1005378691 | 141 |
| 53 | 3300005547 | Ga0070693_100095233 | Ga0070693_1000952332 | 141 |
| 54 | 3300005563 | Ga0068855_100205625 | Ga0068855_1002056253 | 141 |
| 55 | 3300005564 | Ga0070664_100514559 | Ga0070664_1005145592 | 141 |
| 56 | 3300005577 | Ga0068857_100002231 | Ga0068857_1000022317 | 141 |
| 57 | 3300005577 | Ga0068857_100004743 | Ga0068857_1000047434 | 141 |
| 58 | 3300005578 | Ga0068854_101018312 | Ga0068854_1010183122 | 141 |
| 59 | 3300005614 | Ga0068856_100004931 | Ga0068856_10000493111 | 141 |
| 60 | 3300005614 | Ga0068856_100041233 | Ga0068856_1000412335 | 141 |
| 61 | 3300005614 | Ga0068856_100283614 | Ga0068856_1002836142 | 141 |
| 62 | 3300005614 | Ga0068856_100474978 | Ga0068856_1004749782 | 141 |
| 63 | 3300005616 | Ga0068852_100036789 | Ga0068852_1000367895 | 141 |
| 64 | 3300005617 | Ga0068859_100004436 | Ga0068859_1000044366 | 141 |
| 65 | 3300005617 | Ga0068859_100389662 | Ga0068859_1003896622 | 141 |
| 66 | 3300005617 | Ga0068859_100736249 | Ga0068859_1007362492 | 141 |
| 67 | 3300005718 | Ga0068866_10341741 | Ga0068866_103417412 | 141 |
| 68 | 3300005719 | Ga0068861_100413314 | Ga0068861_1004133142 | 141 |
| 69 | 3300005841 | Ga0068863_101030875 | Ga0068863_1010308752 | 141 |
| 70 | 3300005842 | Ga0068858_100126868 | Ga0068858_1001268683 | 141 |
| 71 | 3300005842 | Ga0068858_100331342 | Ga0068858_1003313422 | 141 |
| 72 | 3300005842 | Ga0068858_101459531 | Ga0068858_1014595312 | 141 |
| 73 | 3300005843 | Ga0068860_100016588 | Ga0068860_1000165881 | 141 |
| 74 | 3300005843 | Ga0068860_100360332 | Ga0068860_1003603322 | 141 |
| 75 | 3300005843 | Ga0068860_101218713 | Ga0068860_1012187132 | 141 |
| 76 | 3300005843 | Ga0068860_101230597 | Ga0068860_1012305972 | 141 |
| 77 | 3300006237 | Ga0097621_100015072 | Ga0097621_1000150723 | 141 |
| 78 | 3300006237 | Ga0097621_100053718 | Ga0097621_1000537184 | 141 |
| 79 | 3300006358 | Ga0068871_100043737 | Ga0068871_1000437373 | 141 |
| 80 | 3300006358 | Ga0068871_100232540 | Ga0068871_1002325402 | 141 |
| 81 | 3300006846 | Ga0075430_100149681 | Ga0075430_1001496812 | 141 |
| 82 | 3300006847 | Ga0075431_100551023 | Ga0075431_1005510232 | 141 |
| 83 | 3300006881 | Ga0068865_100080099 | Ga0068865_1000800992 | 141 |
| 84 | 3300006881 | Ga0068865_100244775 | Ga0068865_1002447752 | 141 |
| 85 | 3300006931 | Ga0097620_100004436 | Ga0097620_1000044366 | 141 |
| 86 | 3300006931 | Ga0097620_100389638 | Ga0097620_1003896382 | 141 |
| 87 | 3300006931 | Ga0097620_100736330 | Ga0097620_1007363302 | 141 |
| 88 | 3300009093 | Ga0105240_10059431 | Ga0105240_100594313 | 141 |
| 89 | 3300009093 | Ga0105240_10216496 | Ga0105240_102164961 | 141 |
| 90 | 3300009093 | Ga0105240_10265781 | Ga0105240_102657812 | 141 |
| 91 | 3300009093 | Ga0105240_10626738 | Ga0105240_106267382 | 141 |
| 92 | 3300009093 | Ga0105240_11020135 | Ga0105240_110201351 | 141 |
| 93 | 3300009098 | Ga0105245_10000995 | Ga0105245_1000099512 | 141 |
| 94 | 3300009098 | Ga0105245_10010053 | Ga0105245_100100533 | 141 |
| 95 | 3300009098 | Ga0105245_10016474 | Ga0105245_100164744 | 141 |
| 96 | 3300009098 | Ga0105245_10386342 | Ga0105245_103863422 | 141 |
| 97 | 3300009098 | Ga0105245_10518402 | Ga0105245_105184022 | 141 |
| 98 | 3300009098 | Ga0105245_10576985 | Ga0105245_105769852 | 141 |
| 99 | 3300009098 | Ga0105245_11288328 | Ga0105245_112883282 | 141 |
| 100 | 3300009147 | Ga0114129_10250487 | Ga0114129_102504872 | 141 |
| 101 | 3300009147 | Ga0114129_12166573 | Ga0114129_121665731 | 141 |
| 102 | 3300009148 | Ga0105243_10250631 | Ga0105243_102506312 | 141 |
| 103 | 3300009148 | Ga0105243_10333544 | Ga0105243_103335442 | 141 |
| 104 | 3300009174 | Ga0105241_10003993 | Ga0105241_100039935 | 141 |
| 105 | 3300009174 | Ga0105241_10004427 | Ga0105241_100044276 | 141 |
| 106 | 3300009174 | Ga0105241_10090756 | Ga0105241_100907562 | 141 |
| 107 | 3300009174 | Ga0105241_10185185 | Ga0105241_101851852 | 141 |
| 108 | 3300009176 | Ga0105242_10021225 | Ga0105242_100212256 | 141 |
| 109 | 3300009176 | Ga0105242_10213542 | Ga0105242_102135421 | 141 |
| 110 | 3300009176 | Ga0105242_10361157 | Ga0105242_103611572 | 141 |
| 111 | 3300009176 | Ga0105242_10421655 | Ga0105242_104216552 | 141 |
| 112 | 3300009177 | Ga0105248_10002352 | Ga0105248_1000235215 | 141 |
| 113 | 3300009177 | Ga0105248_10044053 | Ga0105248_100440537 | 141 |
| 114 | 3300009177 | Ga0105248_10595851 | Ga0105248_105958512 | 141 |
| 115 | 3300009177 | Ga0105248_10698211 | Ga0105248_106982112 | 141 |
| 116 | 3300009545 | Ga0105237_10003834 | Ga0105237_1000383412 | 141 |
| 117 | 3300009545 | Ga0105237_10050866 | Ga0105237_100508661 | 141 |
| 118 | 3300009545 | Ga0105237_10080424 | Ga0105237_100804242 | 141 |
| 119 | 3300009545 | Ga0105237_10330756 | Ga0105237_103307562 | 141 |
| 120 | 3300009545 | Ga0105237_10802424 | Ga0105237_108024242 | 141 |
| 121 | 3300009551 | Ga0105238_10003582 | Ga0105238_100035826 | 141 |
| 122 | 3300009551 | Ga0105238_10008583 | Ga0105238_100085834 | 141 |
| 123 | 3300009551 | Ga0105238_10008740 | Ga0105238_100087403 | 141 |
| 124 | 3300009551 | Ga0105238_10040342 | Ga0105238_100403424 | 141 |
| 125 | 3300009553 | Ga0105249_10010002 | Ga0105249_100100024 | 141 |
| 126 | 3300009553 | Ga0105249_10252921 | Ga0105249_102529212 | 141 |
| 127 | 3300010375 | Ga0105239_10001560 | Ga0105239_1000156014 | 141 |
| 128 | 3300010375 | Ga0105239_10003467 | Ga0105239_1000346712 | 141 |
| 129 | 3300010375 | Ga0105239_10005119 | Ga0105239_100051194 | 141 |
| 130 | 3300010375 | Ga0105239_10177067 | Ga0105239_101770673 | 141 |
| 131 | 3300011119 | Ga0105246_10007724 | Ga0105246_100077242 | 141 |
| 132 | 3300011119 | Ga0105246_10016536 | Ga0105246_100165363 | 141 |
| 133 | 3300011119 | Ga0105246_10022428 | Ga0105246_100224282 | 141 |
| 134 | 3300011119 | Ga0105246_10440855 | Ga0105246_104408551 | 141 |
| 135 | 3300013100 | Ga0157373_10397864 | Ga0157373_103978642 | 141 |
| 136 | 3300013104 | Ga0157370_10012271 | Ga0157370_100122712 | 141 |
| 137 | 3300013105 | Ga0157369_10139285 | Ga0157369_101392853 | 141 |
| 138 | 3300013105 | Ga0157369_11102366 | Ga0157369_111023662 | 141 |
| 139 | 3300013296 | Ga0157374_10058634 | Ga0157374_100586343 | 141 |
| 140 | 3300013296 | Ga0157374_10084437 | Ga0157374_100844372 | 141 |
| 141 | 3300013297 | Ga0157378_10003102 | Ga0157378_100031029 | 141 |
| 142 | 3300013297 | Ga0157378_10797341 | Ga0157378_107973412 | 141 |
| 143 | 3300013306 | Ga0163162_11809243 | Ga0163162_118092431 | 141 |
| 144 | 3300013307 | Ga0157372_10010127 | Ga0157372_100101274 | 141 |
| 145 | 3300013307 | Ga0157372_10028028 | Ga0157372_100280286 | 141 |
| 146 | 3300013307 | Ga0157372_10044505 | Ga0157372_100445051 | 141 |
| 147 | 3300013307 | Ga0157372_10356130 | Ga0157372_103561302 | 141 |
| 148 | 3300013308 | Ga0157375_10022810 | Ga0157375_100228103 | 141 |
| 149 | 3300013308 | Ga0157375_10646228 | Ga0157375_106462282 | 141 |
| 150 | 3300014325 | Ga0163163_10011957 | Ga0163163_100119572 | 141 |
| 151 | 3300014325 | Ga0163163_10050827 | Ga0163163_100508274 | 141 |
| 152 | 3300014325 | Ga0163163_10532008 | Ga0163163_105320082 | 141 |
| 153 | 3300014325 | Ga0163163_10563800 | Ga0163163_105638002 | 141 |
| 154 | 3300014325 | Ga0163163_11297927 | Ga0163163_112979272 | 141 |
| 155 | 3300014968 | Ga0157379_10036385 | Ga0157379_100363854 | 141 |
| 156 | 3300014968 | Ga0157379_10150448 | Ga0157379_101504482 | 141 |
| 157 | 3300014968 | Ga0157379_10307717 | Ga0157379_103077172 | 141 |
| 158 | 3300014969 | Ga0157376_10203321 | Ga0157376_102033212 | 141 |
| 159 | 3300014969 | Ga0157376_10218689 | Ga0157376_102186891 | 141 |
| 160 | 3300014969 | Ga0157376_10281898 | Ga0157376_102818982 | 141 |
| 161 | 3300025898 | Ga0207692_10830205 | Ga0207692_108302051 | 141 |
| 162 | 3300025899 | Ga0207642_10050838 | Ga0207642_100508383 | 141 |
| 163 | 3300025899 | Ga0207642_10449358 | Ga0207642_104493581 | 141 |
| 164 | 3300025905 | Ga0207685_10693485 | Ga0207685_106934851 | 141 |
| 165 | 3300025907 | Ga0207645_10541892 | Ga0207645_105418921 | 141 |
| 166 | 3300025911 | Ga0207654_10004365 | Ga0207654_100043651 | 141 |
| 167 | 3300025911 | Ga0207654_10008452 | Ga0207654_100084524 | 141 |
| 168 | 3300025911 | Ga0207654_10073794 | Ga0207654_100737942 | 141 |
| 169 | 3300025911 | Ga0207654_10428409 | Ga0207654_104284091 | 141 |
| 170 | 3300025911 | Ga0207654_10661438 | Ga0207654_106614382 | 141 |
| 171 | 3300025912 | Ga0207707_10001082 | Ga0207707_100010824 | 141 |
| 172 | 3300025913 | Ga0207695_10001264 | Ga0207695_1000126422 | 141 |
| 173 | 3300025913 | Ga0207695_10177848 | Ga0207695_101778482 | 141 |
| 174 | 3300025913 | Ga0207695_10948776 | Ga0207695_109487761 | 141 |
| 175 | 3300025914 | Ga0207671_10003366 | Ga0207671_1000336611 | 141 |
| 176 | 3300025914 | Ga0207671_10004291 | Ga0207671_100042918 | 141 |
| 177 | 3300025914 | Ga0207671_10636530 | Ga0207671_106365302 | 141 |
| 178 | 3300025916 | Ga0207663_10036173 | Ga0207663_100361733 | 141 |
| 179 | 3300025916 | Ga0207663_10553727 | Ga0207663_105537272 | 141 |
| 180 | 3300025917 | Ga0207660_10039300 | Ga0207660_100393002 | 141 |
| 181 | 3300025918 | Ga0207662_11160315 | Ga0207662_111603151 | 141 |
| 182 | 3300025919 | Ga0207657_11195673 | Ga0207657_111956731 | 141 |
| 183 | 3300025920 | Ga0207649_10525386 | Ga0207649_105253862 | 141 |
| 184 | 3300025921 | Ga0207652_10006515 | Ga0207652_1000651510 | 141 |
| 185 | 3300025922 | Ga0207646_11936896 | Ga0207646_119368961 | 141 |
| 186 | 3300025924 | Ga0207694_10000985 | Ga0207694_1000098521 | 141 |
| 187 | 3300025924 | Ga0207694_10088360 | Ga0207694_100883602 | 141 |
| 188 | 3300025924 | Ga0207694_11438090 | Ga0207694_114380902 | 141 |
| 189 | 3300025927 | Ga0207687_10001118 | Ga0207687_100011188 | 141 |
| 190 | 3300025927 | Ga0207687_10013555 | Ga0207687_100135552 | 141 |
| 191 | 3300025927 | Ga0207687_10185179 | Ga0207687_101851792 | 141 |
| 192 | 3300025927 | Ga0207687_11281435 | Ga0207687_112814351 | 141 |
| 193 | 3300025928 | Ga0207700_10055679 | Ga0207700_100556792 | 141 |
| 194 | 3300025931 | Ga0207644_10049191 | Ga0207644_100491913 | 141 |
| 195 | 3300025934 | Ga0207686_10002961 | Ga0207686_100029616 | 141 |
| 196 | 3300025934 | Ga0207686_10052381 | Ga0207686_100523812 | 141 |
| 197 | 3300025934 | Ga0207686_10229808 | Ga0207686_102298081 | 141 |
| 198 | 3300025935 | Ga0207709_10081823 | Ga0207709_100818232 | 141 |
| 199 | 3300025935 | Ga0207709_10252965 | Ga0207709_102529652 | 141 |
| 200 | 3300025935 | Ga0207709_11292282 | Ga0207709_112922822 | 141 |
| 201 | 3300025936 | Ga0207670_10037852 | Ga0207670_100378524 | 141 |
| 202 | 3300025936 | Ga0207670_10947687 | Ga0207670_109476872 | 141 |
| 203 | 3300025936 | Ga0207670_11669161 | Ga0207670_116691611 | 141 |
| 204 | 3300025938 | Ga0207704_10038582 | Ga0207704_100385822 | 141 |
| 205 | 3300025938 | Ga0207704_10965880 | Ga0207704_109658802 | 141 |
| 206 | 3300025941 | Ga0207711_10116322 | Ga0207711_101163223 | 141 |
| 207 | 3300025941 | Ga0207711_11123535 | Ga0207711_111235352 | 141 |
| 208 | 3300025942 | Ga0207689_10021246 | Ga0207689_100212463 | 141 |
| 209 | 3300025942 | Ga0207689_10113291 | Ga0207689_101132912 | 141 |
| 210 | 3300025944 | Ga0207661_10000365 | Ga0207661_1000036520 | 141 |
| 211 | 3300025944 | Ga0207661_10003386 | Ga0207661_100033863 | 141 |
| 212 | 3300025944 | Ga0207661_10285687 | Ga0207661_102856871 | 141 |
| 213 | 3300025944 | Ga0207661_10395542 | Ga0207661_103955422 | 141 |
| 214 | 3300025949 | Ga0207667_10002201 | Ga0207667_1000220122 | 141 |
| 215 | 3300025961 | Ga0207712_11006337 | Ga0207712_110063372 | 141 |
| 216 | 3300025961 | Ga0207712_11309766 | Ga0207712_113097661 | 141 |
| 217 | 3300025981 | Ga0207640_10964881 | Ga0207640_109648812 | 141 |
| 218 | 3300026023 | Ga0207677_10449299 | Ga0207677_104492992 | 141 |
| 219 | 3300026023 | Ga0207677_10964686 | Ga0207677_109646861 | 141 |
| 220 | 3300026035 | Ga0207703_10120667 | Ga0207703_101206673 | 141 |
| 221 | 3300026035 | Ga0207703_10436162 | Ga0207703_104361622 | 141 |
| 222 | 3300026035 | Ga0207703_11273595 | Ga0207703_112735951 | 141 |
| 223 | 3300026041 | Ga0207639_10032444 | Ga0207639_100324444 | 141 |
| 224 | 3300026041 | Ga0207639_10465975 | Ga0207639_104659752 | 141 |
| 225 | 3300026041 | Ga0207639_11300627 | Ga0207639_113006272 | 141 |
| 226 | 3300026075 | Ga0207708_10125138 | Ga0207708_101251383 | 141 |
| 227 | 3300026078 | Ga0207702_10705357 | Ga0207702_107053572 | 141 |
| 228 | 3300026088 | Ga0207641_10878293 | Ga0207641_108782932 | 141 |
| 229 | 3300026089 | Ga0207648_10031143 | Ga0207648_100311432 | 141 |
| 230 | 3300026116 | Ga0207674_10000042 | Ga0207674_1000004222 | 141 |
| 231 | 3300026116 | Ga0207674_10004196 | Ga0207674_100041968 | 141 |
| 232 | 3300026118 | Ga0207675_100590974 | Ga0207675_1005909741 | 141 |
| 233 | 3300028381 | Ga0268264_10247806 | Ga0268264_102478062 | 141 |
| 234 | 3300028381 | Ga0268264_10394032 | Ga0268264_103940322 | 141 |
| 235 | 3300028381 | Ga0268264_11301584 | Ga0268264_113015842 | 141 |
| 236 | 3300028577 | Ga0265318_10313029 | Ga0265318_103130292 | 141 |
| 237 | 3300031595 | Ga0265313_10006767 | Ga0265313_100067675 | 141 |
| 238 | 3300035086 | Ga0373934_0002765 | Ga0373934_0002765_1357_1782 | 141 |
| 239 | 3300035086 | Ga0373934_0240822 | Ga0373934_0240822_154_579 | 141 |
| 240 | 3300035111 | Ga0373923_0076298 | Ga0373923_0076298_637_1062 | 141 |
| 241 | 3300035113 | Ga0373936_0094527 | Ga0373936_0094527_812_1237 | 141 |
| 242 | 3300035117 | Ga0373953_0014028 | Ga0373953_0014028_1347_1772 | 141 |
| 243 | 3300035118 | Ga0373954_0005904 | Ga0373954_0005904_2764_3189 | 141 |
| 244 | 3300035119 | Ga0373956_0616574 | Ga0373956_0616574_72_497 | 141 |
| 245 | 3300035172 | Ga0373955_0003733 | Ga0373955_0003733_3383_3808 | 141 |
| 246 | 3300035172 | Ga0373955_0024298 | Ga0373955_0024298_1051_1476 | 141 |
| 247 | 3300035172 | Ga0373955_0100013 | Ga0373955_0100013_1096_1521 | 141 |
| 248 | 3300035410 | Ga0373924_0236576 | Ga0373924_0236576_325_750 | 141 |
| 249 | 3300035692 | Ga0373935_0123876 | Ga0373935_0123876_1176_1601 | 141 |
| 250 | 3300035695 | Ga0373927_0341039 | Ga0373927_0341039_178_603 | 141 |
| 251 | 3300035724 | Ga0373933_0008593 | Ga0373933_0008593_4755_5180 | 141 |
| 252 | 3300035724 | Ga0373933_0064300 | Ga0373933_0064300_287_712 | 141 |
| 253 | 3300036401 | Ga0373937_0005019 | Ga0373937_0005019_5181_5606 | 141 |
| 254 | 3300036401 | Ga0373937_0010310 | Ga0373937_0010310_5534_5959 | 141 |
| 255 | 3300036401 | Ga0373937_0026597 | Ga0373937_0026597_4735_5160 | 141 |
| 256 | 3300036401 | Ga0373937_0725743 | Ga0373937_0725743_430_855 | 141 |
| 257 | 3300037068 | Ga0373925_1160086 | Ga0373925_1160086_193_618 | 141 |
| 258 | 3300046454 | Ga0495592_0290259 | Ga0495592_0290259_190_615 | 141 |
| 259 | 3300046462 | Ga0495651_0449080 | Ga0495651_0449080_349_774 | 141 |
| 260 | 3300046462 | Ga0495651_0475942 | Ga0495651_0475942_32_457 | 141 |
| 261 | 3300046472 | Ga0495580_0137993 | Ga0495580_0137993_968_1393 | 141 |
| 262 | 3300046475 | Ga0495639_0424335 | Ga0495639_0424335_169_594 | 141 |
| 263 | 3300046511 | Ga0495608_0133456 | Ga0495608_0133456_644_1069 | 141 |
| 264 | 3300046526 | Ga0495666_0080436 | Ga0495666_0080436_481_906 | 141 |
| 265 | 3300046529 | Ga0495652_0026824 | Ga0495652_0026824_1506_1931 | 141 |
| 266 | 3300046529 | Ga0495652_0200045 | Ga0495652_0200045_977_1402 | 141 |
| 267 | 3300046531 | Ga0495665_0048124 | Ga0495665_0048124_1510_1935 | 141 |
| 268 | 3300046535 | Ga0495586_0022817 | Ga0495586_0022817_1368_1793 | 141 |
| 269 | 3300046535 | Ga0495586_0035520 | Ga0495586_0035520_2193_2618 | 141 |
| 270 | 3300046535 | Ga0495586_0323360 | Ga0495586_0323360_127_552 | 141 |
| 271 | 3300046536 | Ga0495587_0102177 | Ga0495587_0102177_122_547 | 141 |
| 272 | 3300046543 | Ga0495645_0187300 | Ga0495645_0187300_312_737 | 141 |
| 273 | 3300046642 | Ga0495634_0043856 | Ga0495634_0043856_212_637 | 141 |
| 274 | 3300046678 | Ga0495599_0015319 | Ga0495599_0015319_2042_2467 | 141 |
| 275 | 3300046683 | Ga0495658_0765601 | Ga0495658_0765601_30_455 | 141 |
| 276 | 3300046689 | Ga0495613_0235160 | Ga0495613_0235160_24_449 | 141 |
| 277 | 3300046690 | Ga0495624_0461651 | Ga0495624_0461651_40_465 | 141 |
| 278 | 3300047317 | Ga0495604_0420209 | Ga0495604_0420209_343_768 | 141 |
| 279 | 3300047322 | Ga0495680_0239275 | Ga0495680_0239275_120_545 | 141 |
| 280 | 3300047322 | Ga0495680_0965715 | Ga0495680_0965715_58_483 | 141 |
| 281 | 3300047444 | Ga0495675_0034828 | Ga0495675_0034828_34_459 | 141 |
| 282 | 3300047471 | Ga0495684_0018073 | Ga0495684_0018073_3235_3660 | 141 |
| 283 | 3300047673 | Ga0495593_0470703 | Ga0495593_0470703_60_485 | 141 |
| 284 | 3300048088 | Ga0495602_0104389 | Ga0495602_0104389_191_616 | 141 |
| 285 | 3300048907 | Ga0496104_0070864 | Ga0496104_0070864_485_910 | 141 |
| 286 | 3300050507 | nmdc:mga05p37_1363594_c1 | nmdc:mga05p37_1363594_c1_127_552 | 141 |
| 287 | 3300050509 | nmdc:mga0qj67_153642_c1 | nmdc:mga0qj67_153642_c1_1091_1516 | 141 |
| 288 | 3300050510 | nmdc:mga06r32_17814_c1 | nmdc:mga06r32_17814_c1_596_1021 | 141 |
| 289 | 3300050515 | nmdc:mga0a205_388808_c1 | nmdc:mga0a205_388808_c1_472_897 | 141 |
| 290 | 3300053077 | Ga0495601_0690615 | Ga0495601_0690615_116_541 | 141 |
| 291 | 3300005466 | Ga0070685_10107744 | Ga0070685_101077442 | 142 |
| 292 | 3300025936 | Ga0207670_10247515 | Ga0207670_102475152 | 142 |
| 293 | 3300005842 | Ga0068858_100358703 | Ga0068858_1003587033 | 143 |
| 294 | 3300009147 | Ga0114129_10639343 | Ga0114129_106393431 | 143 |
| 295 | 3300009177 | Ga0105248_11235203 | Ga0105248_112352031 | 143 |
| 296 | 3300014968 | Ga0157379_10036482 | Ga0157379_100364825 | 143 |
| 297 | 3300026088 | Ga0207641_11254359 | Ga0207641_112543592 | 143 |
| 298 | 3300035172 | Ga0373955_0425656 | Ga0373955_0425656_135_566 | 143 |
| 299 | 3300036401 | Ga0373937_1585673 | Ga0373937_1585673_44_475 | 143 |
| 300 | 3300046517 | Ga0495630_0383536 | Ga0495630_0383536_416_847 | 143 |
| 301 | 3300053084 | Ga0495595_0678147 | Ga0495595_0678147_75_506 | 143 |
| 302 | 3300005295 | Ga0065707_10569422 | Ga0065707_105694222 | 144 |
| 303 | 3300005330 | Ga0070690_100001755 | Ga0070690_1000017555 | 144 |
| 304 | 3300005335 | Ga0070666_10055332 | Ga0070666_100553323 | 144 |
| 305 | 3300005341 | Ga0070691_10044838 | Ga0070691_100448381 | 144 |
| 306 | 3300005343 | Ga0070687_100062705 | Ga0070687_1000627052 | 144 |
| 307 | 3300005353 | Ga0070669_100058228 | Ga0070669_1000582282 | 144 |
| 308 | 3300005355 | Ga0070671_100292907 | Ga0070671_1002929071 | 144 |
| 309 | 3300005364 | Ga0070673_100245054 | Ga0070673_1002450541 | 144 |
| 310 | 3300005364 | Ga0070673_100842734 | Ga0070673_1008427341 | 144 |
| 311 | 3300005367 | Ga0070667_101260587 | Ga0070667_1012605872 | 144 |
| 312 | 3300005434 | Ga0070709_10077086 | Ga0070709_100770862 | 144 |
| 313 | 3300005438 | Ga0070701_10324189 | Ga0070701_103241891 | 144 |
| 314 | 3300005440 | Ga0070705_100618811 | Ga0070705_1006188111 | 144 |
| 315 | 3300005445 | Ga0070708_100590953 | Ga0070708_1005909532 | 144 |
| 316 | 3300005459 | Ga0068867_100216295 | Ga0068867_1002162951 | 144 |
| 317 | 3300005468 | Ga0070707_100436139 | Ga0070707_1004361392 | 144 |
| 318 | 3300005536 | Ga0070697_100265016 | Ga0070697_1002650162 | 144 |
| 319 | 3300005539 | Ga0068853_100249309 | Ga0068853_1002493092 | 144 |
| 320 | 3300005544 | Ga0070686_100011840 | Ga0070686_1000118405 | 144 |
| 321 | 3300005544 | Ga0070686_100352569 | Ga0070686_1003525692 | 144 |
| 322 | 3300005545 | Ga0070695_100023533 | Ga0070695_1000235332 | 144 |
| 323 | 3300005549 | Ga0070704_100001980 | Ga0070704_10000198014 | 144 |
| 324 | 3300005549 | Ga0070704_101428023 | Ga0070704_1014280231 | 144 |
| 325 | 3300005578 | Ga0068854_100041576 | Ga0068854_1000415763 | 144 |
| 326 | 3300005615 | Ga0070702_100013446 | Ga0070702_1000134462 | 144 |
| 327 | 3300005719 | Ga0068861_100052494 | Ga0068861_1000524942 | 144 |
| 328 | 3300005719 | Ga0068861_100740753 | Ga0068861_1007407531 | 144 |
| 329 | 3300005842 | Ga0068858_100162156 | Ga0068858_1001621561 | 144 |
| 330 | 3300005842 | Ga0068858_102269423 | Ga0068858_1022694231 | 144 |
| 331 | 3300006058 | Ga0075432_10148080 | Ga0075432_101480801 | 144 |
| 332 | 3300006852 | Ga0075433_10176595 | Ga0075433_101765952 | 144 |
| 333 | 3300006852 | Ga0075433_10347596 | Ga0075433_103475962 | 144 |
| 334 | 3300006871 | Ga0075434_100000008 | Ga0075434_10000000867 | 144 |
| 335 | 3300006871 | Ga0075434_100055477 | Ga0075434_1000554772 | 144 |
| 336 | 3300006871 | Ga0075434_100477790 | Ga0075434_1004777901 | 144 |
| 337 | 3300006914 | Ga0075436_100000027 | Ga0075436_10000002746 | 144 |
| 338 | 3300006914 | Ga0075436_100057458 | Ga0075436_1000574582 | 144 |
| 339 | 3300006914 | Ga0075436_100122217 | Ga0075436_1001222172 | 144 |
| 340 | 3300006914 | Ga0075436_100206366 | Ga0075436_1002063662 | 144 |
| 341 | 3300007076 | Ga0075435_100000003 | Ga0075435_10000000346 | 144 |
| 342 | 3300007076 | Ga0075435_100013881 | Ga0075435_1000138813 | 144 |
| 343 | 3300007076 | Ga0075435_100193404 | Ga0075435_1001934042 | 144 |
| 344 | 3300009093 | Ga0105240_10150780 | Ga0105240_101507802 | 144 |
| 345 | 3300009093 | Ga0105240_10494925 | Ga0105240_104949252 | 144 |
| 346 | 3300009094 | Ga0111539_10009890 | Ga0111539_1000989012 | 144 |
| 347 | 3300009098 | Ga0105245_10280874 | Ga0105245_102808742 | 144 |
| 348 | 3300009147 | Ga0114129_10080667 | Ga0114129_100806672 | 144 |
| 349 | 3300009148 | Ga0105243_10026001 | Ga0105243_100260013 | 144 |
| 350 | 3300009174 | Ga0105241_10052491 | Ga0105241_100524913 | 144 |
| 351 | 3300009176 | Ga0105242_10387470 | Ga0105242_103874702 | 144 |
| 352 | 3300009177 | Ga0105248_10061746 | Ga0105248_100617463 | 144 |
| 353 | 3300009177 | Ga0105248_10263057 | Ga0105248_102630574 | 144 |
| 354 | 3300009551 | Ga0105238_11036808 | Ga0105238_110368082 | 144 |
| 355 | 3300013297 | Ga0157378_10574705 | Ga0157378_105747052 | 144 |
| 356 | 3300025903 | Ga0207680_10159721 | Ga0207680_101597211 | 144 |
| 357 | 3300025906 | Ga0207699_10386857 | Ga0207699_103868572 | 144 |
| 358 | 3300025907 | Ga0207645_10037955 | Ga0207645_100379553 | 144 |
| 359 | 3300025907 | Ga0207645_10144208 | Ga0207645_101442082 | 144 |
| 360 | 3300025913 | Ga0207695_10304252 | Ga0207695_103042522 | 144 |
| 361 | 3300025913 | Ga0207695_10355257 | Ga0207695_103552572 | 144 |
| 362 | 3300025918 | Ga0207662_10165925 | Ga0207662_101659252 | 144 |
| 363 | 3300025923 | Ga0207681_10043546 | Ga0207681_100435463 | 144 |
| 364 | 3300025931 | Ga0207644_10286280 | Ga0207644_102862801 | 144 |
| 365 | 3300025934 | Ga0207686_10044422 | Ga0207686_100444222 | 144 |
| 366 | 3300025934 | Ga0207686_10874442 | Ga0207686_108744421 | 144 |
| 367 | 3300025939 | Ga0207665_10088056 | Ga0207665_100880562 | 144 |
| 368 | 3300025960 | Ga0207651_10217939 | Ga0207651_102179392 | 144 |
| 369 | 3300026035 | Ga0207703_10385184 | Ga0207703_103851842 | 144 |
| 370 | 3300026041 | Ga0207639_10248516 | Ga0207639_102485162 | 144 |
| 371 | 3300026075 | Ga0207708_10026291 | Ga0207708_100262914 | 144 |
| 372 | 3300026089 | Ga0207648_10047304 | Ga0207648_100473044 | 144 |
| 373 | 3300026118 | Ga0207675_100122073 | Ga0207675_1001220732 | 144 |
| 374 | 3300026118 | Ga0207675_100211171 | Ga0207675_1002111712 | 144 |
| 375 | 3300034819 | Ga0373958_0000467 | Ga0373958_0000467_2540_2974 | 144 |
| 376 | 3300034820 | Ga0373959_0000365 | Ga0373959_0000365_1299_1733 | 144 |
| 377 | 3300035084 | Ga0373928_0004057 | Ga0373928_0004057_976_1410 | 144 |
| 378 | 3300035085 | Ga0373929_0002432 | Ga0373929_0002432_1858_2292 | 144 |
| 379 | 3300035088 | Ga0373940_0000042 | Ga0373940_0000042_11770_12204 | 144 |
| 380 | 3300035091 | Ga0373951_0004493 | Ga0373951_0004493_1449_1883 | 144 |
| 381 | 3300035092 | Ga0373952_0001618 | Ga0373952_0001618_1657_2091 | 144 |
| 382 | 3300035112 | Ga0373932_0000932 | Ga0373932_0000932_5214_5648 | 144 |
| 383 | 3300035113 | Ga0373936_0108637 | Ga0373936_0108637_297_734 | 144 |
| 384 | 3300035115 | Ga0373941_0009794 | Ga0373941_0009794_431_865 | 144 |
| 385 | 3300035117 | Ga0373953_0044960 | Ga0373953_0044960_483_920 | 144 |
| 386 | 3300035121 | Ga0373960_0014458 | Ga0373960_0014458_199_633 | 144 |
| 387 | 3300035170 | Ga0373943_0288074 | Ga0373943_0288074_318_755 | 144 |
| 388 | 3300035241 | Ga0373961_0003447 | Ga0373961_0003447_3034_3468 | 144 |
| 389 | 3300035410 | Ga0373924_0033660 | Ga0373924_0033660_1410_1847 | 144 |
| 390 | 3300035691 | Ga0373931_0001065 | Ga0373931_0001065_5367_5801 | 144 |
| 391 | 3300035692 | Ga0373935_0143489 | Ga0373935_0143489_369_806 | 144 |
| 392 | 3300042012 | Ga0439455_0254181 | Ga0439455_0254181_14_448 | 144 |
| 393 | 3300045051 | Ga0451576_0005340 | Ga0451576_0005340_488_922 | 144 |
| 394 | 3300045051 | Ga0451576_0151111 | Ga0451576_0151111_1800_2237 | 144 |
| 395 | 3300046463 | Ga0495653_0307631 | Ga0495653_0307631_378_815 | 144 |
| 396 | 3300046499 | Ga0495594_0467512 | Ga0495594_0467512_21_458 | 144 |
| 397 | 3300046535 | Ga0495586_0104367 | Ga0495586_0104367_864_1301 | 144 |
| 398 | 3300046543 | Ga0495645_0701014 | Ga0495645_0701014_35_472 | 144 |
| 399 | 3300046683 | Ga0495658_0009241 | Ga0495658_0009241_2734_3171 | 144 |
| 400 | 3300047471 | Ga0495684_0698594 | Ga0495684_0698594_90_527 | 144 |
| 401 | 3300048904 | Ga0496101_0180416 | Ga0496101_0180416_144_578 | 144 |
| 402 | 3300048905 | Ga0496102_0092827 | Ga0496102_0092827_73_510 | 144 |
| 403 | 3300048909 | Ga0496106_0242260 | Ga0496106_0242260_359_793 | 144 |
| 404 | 3300048910 | Ga0496107_0432121 | Ga0496107_0432121_280_717 | 144 |
| 405 | 3300050507 | nmdc:mga05p37_271227_c1 | nmdc:mga05p37_271227_c1_639_1097 | 144 |
| 406 | 3300050511 | nmdc:mga08y16_485559_c1 | nmdc:mga08y16_485559_c1_735_1172 | 144 |
| 407 | 3300050512 | nmdc:mga0n895_123345_c1 | nmdc:mga0n895_123345_c1_2146_2583 | 144 |
| 408 | 3300050512 | nmdc:mga0n895_125649_c1 | nmdc:mga0n895_125649_c1_1251_1688 | 144 |
| 409 | 3300050512 | nmdc:mga0n895_40_c1 | nmdc:mga0n895_40_c1_11296_11733 | 144 |
| 410 | 3300050513 | nmdc:mga0rr50_101519_c1 | nmdc:mga0rr50_101519_c1_1789_2226 | 144 |
| 411 | 3300050513 | nmdc:mga0rr50_154265_c1 | nmdc:mga0rr50_154265_c1_439_876 | 144 |
| 412 | 3300050513 | nmdc:mga0rr50_45958_c1 | nmdc:mga0rr50_45958_c1_2745_3182 | 144 |
| 413 | 3300050513 | nmdc:mga0rr50_7_c1 | nmdc:mga0rr50_7_c1_68312_68749 | 144 |
| 414 | 3300050514 | nmdc:mga08x19_1023369_c1 | nmdc:mga08x19_1023369_c1_128_565 | 144 |
| 415 | 3300050514 | nmdc:mga08x19_14795_c1 | nmdc:mga08x19_14795_c1_3412_3849 | 144 |
| 416 | 3300050514 | nmdc:mga08x19_386379_c1 | nmdc:mga08x19_386379_c1_340_777 | 144 |
| 417 | 3300050514 | nmdc:mga08x19_521435_c1 | nmdc:mga08x19_521435_c1_378_815 | 144 |
| 418 | 3300050514 | nmdc:mga08x19_60_c1 | nmdc:mga08x19_60_c1_52736_53173 | 144 |
| 419 | 3300050515 | nmdc:mga0a205_155034_c1 | nmdc:mga0a205_155034_c1_553_990 | 144 |
| 420 | 3300053077 | Ga0495601_0048766 | Ga0495601_0048766_721_1158 | 144 |
| 421 | 3300053084 | Ga0495595_0208898 | Ga0495595_0208898_110_547 | 144 |
| 422 | 3300053085 | Ga0495619_0026818 | Ga0495619_0026818_1350_1787 | 144 |
| 423 | 3300005290 | Ga0065712_10366233 | Ga0065712_103662332 | 145 |
| 424 | 3300005293 | Ga0065715_10373781 | Ga0065715_103737812 | 145 |
| 425 | 3300005293 | Ga0065715_10403299 | Ga0065715_104032991 | 145 |
| 426 | 3300005293 | Ga0065715_10623254 | Ga0065715_106232541 | 145 |
| 427 | 3300005293 | Ga0065715_10918578 | Ga0065715_109185781 | 145 |
| 428 | 3300005295 | Ga0065707_10211202 | Ga0065707_102112021 | 145 |
| 429 | 3300005295 | Ga0065707_10278551 | Ga0065707_102785512 | 145 |
| 430 | 3300005295 | Ga0065707_10289751 | Ga0065707_102897512 | 145 |
| 431 | 3300005328 | Ga0070676_10475747 | Ga0070676_104757472 | 145 |
| 432 | 3300005328 | Ga0070676_10684261 | Ga0070676_106842612 | 145 |
| 433 | 3300005331 | Ga0070670_100587073 | Ga0070670_1005870732 | 145 |
| 434 | 3300005335 | Ga0070666_10247735 | Ga0070666_102477352 | 145 |
| 435 | 3300005338 | Ga0068868_100912128 | Ga0068868_1009121281 | 145 |
| 436 | 3300005340 | Ga0070689_100135028 | Ga0070689_1001350282 | 145 |
| 437 | 3300005343 | Ga0070687_100450186 | Ga0070687_1004501862 | 145 |
| 438 | 3300005347 | Ga0070668_100012081 | Ga0070668_1000120814 | 145 |
| 439 | 3300005353 | Ga0070669_100062239 | Ga0070669_1000622392 | 145 |
| 440 | 3300005353 | Ga0070669_100168850 | Ga0070669_1001688502 | 145 |
| 441 | 3300005353 | Ga0070669_100258026 | Ga0070669_1002580263 | 145 |
| 442 | 3300005354 | Ga0070675_100476974 | Ga0070675_1004769742 | 145 |
| 443 | 3300005356 | Ga0070674_100206181 | Ga0070674_1002061812 | 145 |
| 444 | 3300005356 | Ga0070674_100404639 | Ga0070674_1004046391 | 145 |
| 445 | 3300005356 | Ga0070674_100748271 | Ga0070674_1007482712 | 145 |
| 446 | 3300005364 | Ga0070673_101622710 | Ga0070673_1016227101 | 145 |
| 447 | 3300005365 | Ga0070688_100306881 | Ga0070688_1003068812 | 145 |
| 448 | 3300005365 | Ga0070688_100515902 | Ga0070688_1005159021 | 145 |
| 449 | 3300005365 | Ga0070688_100594654 | Ga0070688_1005946542 | 145 |
| 450 | 3300005366 | Ga0070659_100948145 | Ga0070659_1009481451 | 145 |
| 451 | 3300005367 | Ga0070667_100092099 | Ga0070667_1000920993 | 145 |
| 452 | 3300005367 | Ga0070667_101108837 | Ga0070667_1011088372 | 145 |
| 453 | 3300005438 | Ga0070701_10163892 | Ga0070701_101638922 | 145 |
| 454 | 3300005440 | Ga0070705_100043384 | Ga0070705_1000433843 | 145 |
| 455 | 3300005440 | Ga0070705_100117159 | Ga0070705_1001171593 | 145 |
| 456 | 3300005444 | Ga0070694_100156012 | Ga0070694_1001560122 | 145 |
| 457 | 3300005445 | Ga0070708_100078357 | Ga0070708_1000783573 | 145 |
| 458 | 3300005445 | Ga0070708_101405681 | Ga0070708_1014056811 | 145 |
| 459 | 3300005456 | Ga0070678_101329351 | Ga0070678_1013293512 | 145 |
| 460 | 3300005457 | Ga0070662_100660953 | Ga0070662_1006609531 | 145 |
| 461 | 3300005459 | Ga0068867_100116402 | Ga0068867_1001164022 | 145 |
| 462 | 3300005459 | Ga0068867_100676905 | Ga0068867_1006769051 | 145 |
| 463 | 3300005467 | Ga0070706_100848094 | Ga0070706_1008480942 | 145 |
| 464 | 3300005467 | Ga0070706_101752069 | Ga0070706_1017520691 | 145 |
| 465 | 3300005468 | Ga0070707_100136306 | Ga0070707_1001363063 | 145 |
| 466 | 3300005471 | Ga0070698_100610759 | Ga0070698_1006107592 | 145 |
| 467 | 3300005518 | Ga0070699_100008658 | Ga0070699_1000086588 | 145 |
| 468 | 3300005518 | Ga0070699_101315383 | Ga0070699_1013153831 | 145 |
| 469 | 3300005536 | Ga0070697_100323285 | Ga0070697_1003232852 | 145 |
| 470 | 3300005536 | Ga0070697_100650934 | Ga0070697_1006509342 | 145 |
| 471 | 3300005536 | Ga0070697_101432588 | Ga0070697_1014325881 | 145 |
| 472 | 3300005536 | Ga0070697_101848318 | Ga0070697_1018483181 | 145 |
| 473 | 3300005543 | Ga0070672_100081477 | Ga0070672_1000814772 | 145 |
| 474 | 3300005543 | Ga0070672_100579204 | Ga0070672_1005792042 | 145 |
| 475 | 3300005545 | Ga0070695_100453422 | Ga0070695_1004534222 | 145 |
| 476 | 3300005546 | Ga0070696_100036659 | Ga0070696_1000366593 | 145 |
| 477 | 3300005546 | Ga0070696_100116865 | Ga0070696_1001168652 | 145 |
| 478 | 3300005546 | Ga0070696_100409188 | Ga0070696_1004091882 | 145 |
| 479 | 3300005546 | Ga0070696_100549520 | Ga0070696_1005495201 | 145 |
| 480 | 3300005548 | Ga0070665_101150885 | Ga0070665_1011508851 | 145 |
| 481 | 3300005549 | Ga0070704_100019169 | Ga0070704_1000191693 | 145 |
| 482 | 3300005577 | Ga0068857_101620971 | Ga0068857_1016209712 | 145 |
| 483 | 3300005578 | Ga0068854_101349318 | Ga0068854_1013493181 | 145 |
| 484 | 3300005615 | Ga0070702_100402232 | Ga0070702_1004022322 | 145 |
| 485 | 3300005617 | Ga0068859_100586946 | Ga0068859_1005869461 | 145 |
| 486 | 3300005617 | Ga0068859_101806942 | Ga0068859_1018069422 | 145 |
| 487 | 3300005718 | Ga0068866_10012669 | Ga0068866_100126693 | 145 |
| 488 | 3300005719 | Ga0068861_100365336 | Ga0068861_1003653362 | 145 |
| 489 | 3300005841 | Ga0068863_100002248 | Ga0068863_1000022484 | 145 |
| 490 | 3300005843 | Ga0068860_100824612 | Ga0068860_1008246122 | 145 |
| 491 | 3300005843 | Ga0068860_101174248 | Ga0068860_1011742482 | 145 |
| 492 | 3300005844 | Ga0068862_100025381 | Ga0068862_1000253813 | 145 |
| 493 | 3300005844 | Ga0068862_100039769 | Ga0068862_1000397693 | 145 |
| 494 | 3300005844 | Ga0068862_100168875 | Ga0068862_1001688753 | 145 |
| 495 | 3300005844 | Ga0068862_100238312 | Ga0068862_1002383122 | 145 |
| 496 | 3300005844 | Ga0068862_100382905 | Ga0068862_1003829052 | 145 |
| 497 | 3300005937 | Ga0081455_10039863 | Ga0081455_100398633 | 145 |
| 498 | 3300006237 | Ga0097621_100315775 | Ga0097621_1003157752 | 145 |
| 499 | 3300006844 | Ga0075428_100194367 | Ga0075428_1001943673 | 145 |
| 500 | 3300006844 | Ga0075428_100210920 | Ga0075428_1002109202 | 145 |
| 501 | 3300006844 | Ga0075428_101146298 | Ga0075428_1011462981 | 145 |
| 502 | 3300006852 | Ga0075433_10038933 | Ga0075433_100389332 | 145 |
| 503 | 3300006852 | Ga0075433_10055981 | Ga0075433_100559814 | 145 |
| 504 | 3300006852 | Ga0075433_10292478 | Ga0075433_102924782 | 145 |
| 505 | 3300006852 | Ga0075433_10827124 | Ga0075433_108271242 | 145 |
| 506 | 3300006871 | Ga0075434_100027537 | Ga0075434_1000275372 | 145 |
| 507 | 3300006871 | Ga0075434_102260752 | Ga0075434_1022607521 | 145 |
| 508 | 3300006880 | Ga0075429_100120831 | Ga0075429_1001208311 | 145 |
| 509 | 3300006880 | Ga0075429_100647350 | Ga0075429_1006473501 | 145 |
| 510 | 3300006880 | Ga0075429_100946899 | Ga0075429_1009468991 | 145 |
| 511 | 3300006914 | Ga0075436_100011040 | Ga0075436_1000110402 | 145 |
| 512 | 3300006914 | Ga0075436_100045390 | Ga0075436_1000453902 | 145 |
| 513 | 3300006914 | Ga0075436_101138981 | Ga0075436_1011389811 | 145 |
| 514 | 3300006931 | Ga0097620_100586928 | Ga0097620_1005869282 | 145 |
| 515 | 3300006931 | Ga0097620_101806034 | Ga0097620_1018060342 | 145 |
| 516 | 3300007076 | Ga0075435_100141099 | Ga0075435_1001410992 | 145 |
| 517 | 3300007076 | Ga0075435_100175645 | Ga0075435_1001756451 | 145 |
| 518 | 3300007265 | Ga0099794_10031037 | Ga0099794_100310374 | 145 |
| 519 | 3300009094 | Ga0111539_10123852 | Ga0111539_101238522 | 145 |
| 520 | 3300009094 | Ga0111539_10183180 | Ga0111539_101831804 | 145 |
| 521 | 3300009094 | Ga0111539_10419571 | Ga0111539_104195712 | 145 |
| 522 | 3300009094 | Ga0111539_10566272 | Ga0111539_105662722 | 145 |
| 523 | 3300009094 | Ga0111539_10882244 | Ga0111539_108822442 | 145 |
| 524 | 3300009094 | Ga0111539_11306255 | Ga0111539_113062552 | 145 |
| 525 | 3300009098 | Ga0105245_10342415 | Ga0105245_103424152 | 145 |
| 526 | 3300009147 | Ga0114129_10002259 | Ga0114129_1000225917 | 145 |
| 527 | 3300009147 | Ga0114129_10013616 | Ga0114129_100136169 | 145 |
| 528 | 3300009147 | Ga0114129_10020088 | Ga0114129_100200885 | 145 |
| 529 | 3300009147 | Ga0114129_10158846 | Ga0114129_101588462 | 145 |
| 530 | 3300009147 | Ga0114129_10660927 | Ga0114129_106609272 | 145 |
| 531 | 3300009147 | Ga0114129_10711046 | Ga0114129_107110462 | 145 |
| 532 | 3300009147 | Ga0114129_11190981 | Ga0114129_111909811 | 145 |
| 533 | 3300009148 | Ga0105243_10028709 | Ga0105243_100287094 | 145 |
| 534 | 3300009176 | Ga0105242_11199483 | Ga0105242_111994832 | 145 |
| 535 | 3300009177 | Ga0105248_10122096 | Ga0105248_101220961 | 145 |
| 536 | 3300009177 | Ga0105248_10731291 | Ga0105248_107312912 | 145 |
| 537 | 3300009177 | Ga0105248_11386353 | Ga0105248_113863531 | 145 |
| 538 | 3300009177 | Ga0105248_11691672 | Ga0105248_116916722 | 145 |
| 539 | 3300009553 | Ga0105249_10082274 | Ga0105249_100822742 | 145 |
| 540 | 3300009553 | Ga0105249_10140243 | Ga0105249_101402433 | 145 |
| 541 | 3300009553 | Ga0105249_10512227 | Ga0105249_105122273 | 145 |
| 542 | 3300013297 | Ga0157378_11142677 | Ga0157378_111426771 | 145 |
| 543 | 3300013306 | Ga0163162_10168635 | Ga0163162_101686352 | 145 |
| 544 | 3300013306 | Ga0163162_10890422 | Ga0163162_108904222 | 145 |
| 545 | 3300013308 | Ga0157375_10173308 | Ga0157375_101733082 | 145 |
| 546 | 3300014325 | Ga0163163_10061557 | Ga0163163_100615572 | 145 |
| 547 | 3300014326 | Ga0157380_10022436 | Ga0157380_100224365 | 145 |
| 548 | 3300014326 | Ga0157380_10396070 | Ga0157380_103960702 | 145 |
| 549 | 3300014326 | Ga0157380_10431496 | Ga0157380_104314962 | 145 |
| 550 | 3300014968 | Ga0157379_10037219 | Ga0157379_100372193 | 145 |
| 551 | 3300017792 | Ga0163161_10411377 | Ga0163161_104113772 | 145 |
| 552 | 3300017792 | Ga0163161_10638212 | Ga0163161_106382121 | 145 |
| 553 | 3300025315 | Ga0207697_10049771 | Ga0207697_100497711 | 145 |
| 554 | 3300025885 | Ga0207653_10238454 | Ga0207653_102384542 | 145 |
| 555 | 3300025899 | Ga0207642_10075643 | Ga0207642_100756433 | 145 |
| 556 | 3300025901 | Ga0207688_10207309 | Ga0207688_102073091 | 145 |
| 557 | 3300025903 | Ga0207680_10163236 | Ga0207680_101632362 | 145 |
| 558 | 3300025907 | Ga0207645_10025740 | Ga0207645_100257403 | 145 |
| 559 | 3300025910 | Ga0207684_10773072 | Ga0207684_107730721 | 145 |
| 560 | 3300025922 | Ga0207646_10386952 | Ga0207646_103869522 | 145 |
| 561 | 3300025922 | Ga0207646_10464150 | Ga0207646_104641501 | 145 |
| 562 | 3300025922 | Ga0207646_10681486 | Ga0207646_106814861 | 145 |
| 563 | 3300025923 | Ga0207681_10172124 | Ga0207681_101721242 | 145 |
| 564 | 3300025923 | Ga0207681_10256114 | Ga0207681_102561142 | 145 |
| 565 | 3300025923 | Ga0207681_10699549 | Ga0207681_106995492 | 145 |
| 566 | 3300025926 | Ga0207659_10138714 | Ga0207659_101387142 | 145 |
| 567 | 3300025931 | Ga0207644_10194493 | Ga0207644_101944931 | 145 |
| 568 | 3300025933 | Ga0207706_10103492 | Ga0207706_101034922 | 145 |
| 569 | 3300025935 | Ga0207709_11055297 | Ga0207709_110552971 | 145 |
| 570 | 3300025936 | Ga0207670_10259592 | Ga0207670_102595922 | 145 |
| 571 | 3300025936 | Ga0207670_11728033 | Ga0207670_117280331 | 145 |
| 572 | 3300025937 | Ga0207669_10084910 | Ga0207669_100849102 | 145 |
| 573 | 3300025937 | Ga0207669_11458449 | Ga0207669_114584491 | 145 |
| 574 | 3300025940 | Ga0207691_10032228 | Ga0207691_100322284 | 145 |
| 575 | 3300025941 | Ga0207711_10038447 | Ga0207711_100384473 | 145 |
| 576 | 3300025941 | Ga0207711_10299374 | Ga0207711_102993742 | 145 |
| 577 | 3300025941 | Ga0207711_10614462 | Ga0207711_106144622 | 145 |
| 578 | 3300025960 | Ga0207651_10309662 | Ga0207651_103096621 | 145 |
| 579 | 3300025961 | Ga0207712_10122621 | Ga0207712_101226212 | 145 |
| 580 | 3300025961 | Ga0207712_10378796 | Ga0207712_103787962 | 145 |
| 581 | 3300025961 | Ga0207712_11028681 | Ga0207712_110286812 | 145 |
| 582 | 3300025972 | Ga0207668_10769373 | Ga0207668_107693732 | 145 |
| 583 | 3300025981 | Ga0207640_10859119 | Ga0207640_108591192 | 145 |
| 584 | 3300025986 | Ga0207658_10314454 | Ga0207658_103144542 | 145 |
| 585 | 3300026023 | Ga0207677_10178308 | Ga0207677_101783081 | 145 |
| 586 | 3300026035 | Ga0207703_11283445 | Ga0207703_112834451 | 145 |
| 587 | 3300026075 | Ga0207708_10011567 | Ga0207708_100115676 | 145 |
| 588 | 3300026088 | Ga0207641_10002063 | Ga0207641_1000206310 | 145 |
| 589 | 3300026088 | Ga0207641_11861595 | Ga0207641_118615951 | 145 |
| 590 | 3300026089 | Ga0207648_10138703 | Ga0207648_101387032 | 145 |
| 591 | 3300026089 | Ga0207648_10651937 | Ga0207648_106519372 | 145 |
| 592 | 3300026116 | Ga0207674_10725777 | Ga0207674_107257772 | 145 |
| 593 | 3300026118 | Ga0207675_100217770 | Ga0207675_1002177702 | 145 |
| 594 | 3300026118 | Ga0207675_100231408 | Ga0207675_1002314082 | 145 |
| 595 | 3300026118 | Ga0207675_102478749 | Ga0207675_1024787491 | 145 |
| 596 | 3300028380 | Ga0268265_10009546 | Ga0268265_100095462 | 145 |
| 597 | 3300028380 | Ga0268265_10035070 | Ga0268265_100350702 | 145 |
| 598 | 3300028380 | Ga0268265_10181899 | Ga0268265_101818992 | 145 |
| 599 | 3300028380 | Ga0268265_10586421 | Ga0268265_105864212 | 145 |
| 600 | 3300028380 | Ga0268265_10665752 | Ga0268265_106657522 | 145 |
| 601 | 3300028380 | Ga0268265_11743442 | Ga0268265_117434421 | 145 |
| 602 | 3300028381 | Ga0268264_10522970 | Ga0268264_105229702 | 145 |
| 603 | 3300034817 | Ga0373948_0113580 | Ga0373948_0113580_164_601 | 145 |
| 604 | 3300035114 | Ga0373939_0194113 | Ga0373939_0194113_97_534 | 145 |
| 605 | 3300035115 | Ga0373941_0147089 | Ga0373941_0147089_132_569 | 145 |
| 606 | 3300038443 | Ga0395901_0740811 | Ga0395901_0740811_421_858 | 145 |
| 607 | 3300046477 | Ga0495664_0033136 | Ga0495664_0033136_2330_2830 | 145 |
| 608 | 3300046516 | Ga0495628_0249933 | Ga0495628_0249933_349_786 | 145 |
| 609 | 3300046533 | Ga0495640_0023882 | Ga0495640_0023882_1575_2075 | 145 |
| 610 | 3300046536 | Ga0495587_0069604 | Ga0495587_0069604_1393_1893 | 145 |
| 611 | 3300046559 | Ga0495667_0598797 | Ga0495667_0598797_12_512 | 145 |
| 612 | 3300046615 | Ga0495656_0634522 | Ga0495656_0634522_50_487 | 145 |
| 613 | 3300047319 | Ga0495674_0010765 | Ga0495674_0010765_1265_1765 | 145 |
| 614 | 3300047471 | Ga0495684_0628237 | Ga0495684_0628237_32_469 | 145 |
| 615 | 3300048088 | Ga0495602_0837345 | Ga0495602_0837345_90_590 | 145 |
| 616 | 3300048088 | Ga0495602_0893765 | Ga0495602_0893765_10_510 | 145 |
| 617 | 3300048905 | Ga0496102_1030270 | Ga0496102_1030270_233_670 | 145 |
| 618 | 3300048915 | Ga0496112_0455489 | Ga0496112_0455489_311_748 | 145 |
| 619 | 3300050507 | nmdc:mga05p37_191440_c1 | nmdc:mga05p37_191440_c1_170_610 | 145 |
| 620 | 3300050507 | nmdc:mga05p37_2297_c1 | nmdc:mga05p37_2297_c1_5769_6212 | 145 |
| 621 | 3300050507 | nmdc:mga05p37_29151_c1 | nmdc:mga05p37_29151_c1_4943_5380 | 145 |
| 622 | 3300050507 | nmdc:mga05p37_30104_c1 | nmdc:mga05p37_30104_c1_580_1017 | 145 |
| 623 | 3300050507 | nmdc:mga05p37_37360_c1 | nmdc:mga05p37_37360_c1_3808_4245 | 145 |
| 624 | 3300050507 | nmdc:mga05p37_39838_c1 | nmdc:mga05p37_39838_c1_4072_4527 | 145 |
| 625 | 3300050508 | nmdc:mga09592_592880_c1 | nmdc:mga09592_592880_c1_23_460 | 145 |
| 626 | 3300050508 | nmdc:mga09592_763997_c1 | nmdc:mga09592_763997_c1_162_617 | 145 |
| 627 | 3300050511 | nmdc:mga08y16_339184_c1 | nmdc:mga08y16_339184_c1_279_716 | 145 |
| 628 | 3300050511 | nmdc:mga08y16_518139_c1 | nmdc:mga08y16_518139_c1_496_933 | 145 |
| 629 | 3300050511 | nmdc:mga08y16_66734_c1 | nmdc:mga08y16_66734_c1_625_1062 | 145 |
| 630 | 3300050511 | nmdc:mga08y16_697457_c1 | nmdc:mga08y16_697457_c1_259_711 | 145 |
| 631 | 3300050512 | nmdc:mga0n895_1223632_c1 | nmdc:mga0n895_1223632_c1_164_607 | 145 |
| 632 | 3300050512 | nmdc:mga0n895_3651_c1 | nmdc:mga0n895_3651_c1_8619_9056 | 145 |
| 633 | 3300050513 | nmdc:mga0rr50_189094_c1 | nmdc:mga0rr50_189094_c1_1074_1511 | 145 |
| 634 | 3300050513 | nmdc:mga0rr50_205034_c1 | nmdc:mga0rr50_205034_c1_1025_1525 | 145 |
| 635 | 3300050514 | nmdc:mga08x19_163365_c1 | nmdc:mga08x19_163365_c1_13_450 | 145 |
| 636 | 3300050514 | nmdc:mga08x19_25613_c1 | nmdc:mga08x19_25613_c1_85_522 | 145 |
| 637 | 3300050515 | nmdc:mga0a205_125561_c1 | nmdc:mga0a205_125561_c1_1508_1963 | 145 |
| 638 | 3300050515 | nmdc:mga0a205_22891_c1 | nmdc:mga0a205_22891_c1_4431_4868 | 145 |
| 639 | 3300050515 | nmdc:mga0a205_35320_c1 | nmdc:mga0a205_35320_c1_184_621 | 145 |
| 640 | 3300050515 | nmdc:mga0a205_61187_c1 | nmdc:mga0a205_61187_c1_555_992 | 145 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6o2d-assembly1.cif.gz_B | schizosaccharomyces pombe cnp3 cupin domain | 0.8603 | 42 | 144 |
| 5ooa-assembly1.cif.gz_A | streptomyces pac13 (y89f) with uridine | 0.8596 | 45 | 145 |
| 5njn-assembly1.cif.gz_A | roll out the beta-barrel: structure and mechanism of pac13, a unique nucleoside dehydratase | 0.859 | 45 | 145 |
| 5oo8-assembly1.cif.gz_A | streptomyces pac13 (h42q) with uridine | 0.8586 | 45 | 145 |
| 5oo9-assembly1.cif.gz_A | streptomyces pac13 (y55f) with uridine | 0.8584 | 45 | 145 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D8PPZ7_421_512_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8661 | 42 | 144 | 2.60.120.10 |
| 3rnsA01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8618 | 43 | 143 | 2.60.120.10 |
| af_P17410_9_96_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8559 | 50 | 142 | 2.60.120.10 |
| af_Q03188_852_942_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8549 | 43 | 142 | 2.60.120.10 |
| af_Q9USR9_537_626_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8533 | 42 | 142 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A849STV1-F1-model_v4 | Cupin domain-containing protein | 0.9832 | 52 | 144 |
|
| AF-A0A520HRA1-F1-model_v4 | Cupin domain-containing protein | 0.973 | 52 | 144 |
|
| AF-A0A534PYC0-F1-model_v4 | Cupin domain-containing protein | 0.9653 | 26 | 142 |
|
| AF-A0A1H4PAZ8-F1-model_v4 | Cupin domain-containing protein | 0.9618 | 48 | 145 |
|
| AF-A0A2V9NMQ9-F1-model_v4 | Cupin type-1 domain-containing protein | 0.9615 | 19 | 142 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar