F471686

General Info

Members Datasets Scaffolds Average Seq Length
640 443 1280 190

Family's Representative Sequence

Representative Sequence 3300015265|Ga0182005_1031458|Ga0182005_10314582
Length 191
Sequence MPATVLLHPTIDYGIRKGADDFAGGTLICHCLDKPVRVEIQGQIAHNHACGCTQCWKPEGAIVSIVGVVPTDHVKVAANGDKLAVVNPAATILRHACQVCGVHMHGPVEKDHAFKGLTFVHTELSREEGWQAPQFGAFISSVIEGGVKPDRMGAIRSRIRELGLEPYDCLSPPLMDALAIFAAKKSGVLAE

Samples

Sample ID Description Type Environment
1 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
9 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
168 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
173 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
174 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
175 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
182 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
183 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
184 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
185 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
186 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
187 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
188 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
191 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
192 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
193 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
194 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
195 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
196 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
197 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
198 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
199 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
200 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
201 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
202 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
203 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
204 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
205 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
206 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
207 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
208 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
209 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
210 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
211 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
212 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
213 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
214 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
215 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
216 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
217 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
218 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
219 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
220 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
221 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
222 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
223 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
224 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
225 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
226 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
227 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
228 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
229 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
230 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
231 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
232 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
233 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
234 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
235 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
236 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
237 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
238 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
239 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
240 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
241 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
242 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
243 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
244 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
245 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
246 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
247 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
248 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
251 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
252 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
253 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
254 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
255 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
256 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
257 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
258 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
260 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
261 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
262 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
263 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
264 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
265 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
266 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
267 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
268 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
269 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
270 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
271 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
272 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
273 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
275 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
276 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
277 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
278 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
279 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
280 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
281 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
282 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
283 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
284 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
285 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
286 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
287 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
288 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
289 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
290 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
291 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
292 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
293 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
294 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
295 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
296 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
297 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
298 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
299 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
300 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
301 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
302 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
303 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
304 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
305 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
306 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
307 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
308 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
309 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
310 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
311 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
312 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
313 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
314 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
315 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
316 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
317 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
318 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
319 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
320 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
321 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
322 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
323 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
324 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
325 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
326 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
327 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
328 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
329 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
330 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
331 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
332 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
333 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
334 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
335 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
336 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
337 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
338 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
339 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
340 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
341 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
342 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
343 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
344 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
345 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
346 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
347 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
348 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
349 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
350 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
351 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
352 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
353 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
354 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
355 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
356 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
357 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
358 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
359 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
360 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
361 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
362 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
363 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
364 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
365 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
366 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
367 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
368 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
369 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
370 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
371 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
372 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
373 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
374 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
375 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
376 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
377 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
378 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
379 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
380 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
381 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
382 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
383 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
384 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
385 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
386 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
387 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
388 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
389 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
390 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
391 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
392 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
393 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
394 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
395 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
396 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
397 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
398 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
399 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
400 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
401 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
402 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
403 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
404 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
405 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
406 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
407 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
408 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
409 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
410 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
411 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
412 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
413 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
414 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
415 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
416 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
417 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
418 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
419 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
420 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
421 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
422 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
423 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
424 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
425 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
426 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
427 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
428 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
429 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
430 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
431 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
432 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
433 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
434 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
435 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
436 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
437 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
438 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
439 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
440 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
441 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
442 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
443 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 73.28
Metatranscriptomes 0.31
Isolates 26.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.09
Nodule 25.94
Rhizoplane 1.88
Rhizosphere 70
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0182005_1031458 3300015265 Bacteria 1446
2 JGI24752J21851_1005054 3300001976 Bacteria 1726
3 JGI24737J22298_10045781 3300001990 Bacteria 1336
4 JGI24743J22301_10008908 3300001991 Bacteria 1770
5 JGI24748J21848_1003367 3300002074 Bacteria 1825
6 JGI24749J21850_1001329 3300002076 Bacteria 3504
7 JGI24744J21845_10010718 3300002077 Bacteria 1876
8 JGI24742J22300_10044733 3300002244 Bacteria 794
9 Ga0055529_1026157 3300003763 Bacteria 720
10 Ga0065165_1003711 3300005262 Bacteria 10329
11 Ga0065712_10540831 3300005290 Bacteria 621
12 Ga0070658_10104267 3300005327 Bacteria 2346
13 Ga0070676_10016431 3300005328 Bacteria 4092
14 Ga0070676_10062888 3300005328 Bacteria 2210
15 Ga0070676_10245112 3300005328 Bacteria 1193
16 Ga0070683_100019617 3300005329 Bacteria 6007
17 Ga0070683_100189909 3300005329 Bacteria 1950
18 Ga0070690_100152768 3300005330 Bacteria 1576
19 Ga0070690_100156452 3300005330 Bacteria 1558
20 Ga0070670_100006947 3300005331 Bacteria 9594
21 Ga0070670_100058116 3300005331 Bacteria 3320
22 Ga0070670_100255945 3300005331 Bacteria 1525
23 Ga0070670_100637166 3300005331 Bacteria 956
24 Ga0070670_100902906 3300005331 Bacteria 801
25 Ga0070677_10002830 3300005333 Bacteria 5560
26 Ga0068869_100027285 3300005334 Bacteria 3980
27 Ga0068869_100095733 3300005334 Bacteria 2240
28 Ga0068869_100468044 3300005334 Bacteria 1047
29 Ga0070680_100718791 3300005336 Bacteria 860
30 Ga0068868_100368109 3300005338 Bacteria 1234
31 Ga0070660_100499463 3300005339 Bacteria 1012
32 Ga0070689_100015051 3300005340 Bacteria 5633
33 Ga0070687_100093941 3300005343 Bacteria 1665
34 Ga0070661_100013384 3300005344 Bacteria 5758
35 Ga0070661_100074158 3300005344 Bacteria 2505
36 Ga0070661_100266817 3300005344 Bacteria 1325
37 Ga0070668_100604830 3300005347 Bacteria 959
38 Ga0070669_100051391 3300005353 Bacteria 3012
39 Ga0070669_100661514 3300005353 Bacteria 879
40 Ga0070675_100041261 3300005354 Bacteria 3769
41 Ga0070675_100094711 3300005354 Bacteria 2506
42 Ga0070671_100062933 3300005355 Bacteria 3089
43 Ga0070671_100096781 3300005355 Bacteria 2475
44 Ga0070671_100156909 3300005355 Bacteria 1922
45 Ga0070674_100021692 3300005356 Bacteria 4130
46 Ga0070674_100031942 3300005356 Bacteria 3493
47 Ga0070674_100165796 3300005356 Bacteria 1680
48 Ga0070673_100089311 3300005364 Bacteria 2515
49 Ga0070673_100207692 3300005364 Bacteria 1689
50 Ga0070688_100377183 3300005365 Bacteria 1044
51 Ga0070688_100389916 3300005365 Bacteria 1029
52 Ga0070659_100005300 3300005366 Bacteria 9248
53 Ga0070659_100042770 3300005366 Bacteria 3543
54 Ga0070667_100341337 3300005367 Bacteria 1354
55 Ga0070667_101275727 3300005367 Bacteria 688
56 Ga0070703_10128338 3300005406 Bacteria 928
57 Ga0070701_10015017 3300005438 Bacteria 3565
58 Ga0070711_100160087 3300005439 Bacteria 1706
59 Ga0070700_100038683 3300005441 Bacteria 2909
60 Ga0070700_100038975 3300005441 Bacteria 2899
61 Ga0070708_100019076 3300005445 Bacteria 5753
62 Ga0070663_100012638 3300005455 Bacteria 5350
63 Ga0070678_100986672 3300005456 Bacteria 774
64 Ga0070662_100017354 3300005457 Bacteria 4853
65 Ga0070662_100521937 3300005457 Bacteria 992
66 Ga0070662_100699144 3300005457 Bacteria 858
67 Ga0070681_10006485 3300005458 Bacteria 11387
68 Ga0068867_100124676 3300005459 Bacteria 1994
69 Ga0068867_100129083 3300005459 Bacteria 1963
70 Ga0068867_100183164 3300005459 Bacteria 1666
71 Ga0068867_100488263 3300005459 Bacteria 1056
72 Ga0070685_10007635 3300005466 Bacteria 5535
73 Ga0070706_100363177 3300005467 Bacteria 1349
74 Ga0070707_100114703 3300005468 Bacteria 2614
75 Ga0070707_100623547 3300005468 Bacteria 1041
76 Ga0070698_100729237 3300005471 Bacteria 934
77 Ga0070684_100042011 3300005535 Bacteria 3945
78 Ga0070697_100001052 3300005536 Bacteria 20835
79 Ga0068853_100045009 3300005539 Bacteria 3779
80 Ga0070672_100052594 3300005543 Bacteria 3180
81 Ga0070672_100192218 3300005543 Bacteria 1704
82 Ga0070672_100377268 3300005543 Bacteria 1212
83 Ga0070686_100200402 3300005544 Bacteria 1430
84 Ga0070693_100083483 3300005547 Bacteria 1910
85 Ga0070665_100125484 3300005548 Bacteria 2569
86 Ga0070704_100328421 3300005549 Bacteria 1284
87 Ga0068855_100157348 3300005563 Bacteria 2581
88 Ga0070664_100045617 3300005564 Bacteria 3702
89 Ga0068857_100033561 3300005577 Bacteria 4539
90 Ga0068854_100062515 3300005578 Bacteria 2699
91 Ga0068854_100733413 3300005578 Bacteria 856
92 Ga0068856_100275528 3300005614 Bacteria 1699
93 Ga0068852_100066781 3300005616 Bacteria 3142
94 Ga0068852_100183587 3300005616 Bacteria 1968
95 Ga0068859_100282552 3300005617 Bacteria 1752
96 Ga0068859_100714279 3300005617 Bacteria 1092
97 Ga0068864_100010838 3300005618 Bacteria 7534
98 Ga0068864_100054081 3300005618 Bacteria 3464
99 Ga0068864_100282178 3300005618 Bacteria 1550
100 Ga0068866_10000718 3300005718 Bacteria 15043
101 Ga0068866_10470586 3300005718 Bacteria 826
102 Ga0068851_10008199 3300005834 Bacteria 4822
103 Ga0068851_10060950 3300005834 Bacteria 1933
104 Ga0068870_10009253 3300005840 Bacteria 4473
105 Ga0068870_10203884 3300005840 Bacteria 1201
106 Ga0068863_100170636 3300005841 Bacteria 2086
107 Ga0068863_101093223 3300005841 Bacteria 802
108 Ga0068858_100147608 3300005842 Bacteria 2209
109 Ga0068860_100031554 3300005843 Bacteria 5093
110 Ga0068862_100133557 3300005844 Bacteria 2197
111 Ga0081539_10000123 3300005985 Bacteria 181245
112 Ga0070716_100019444 3300006173 Bacteria 3550
113 Ga0097621_100058776 3300006237 Bacteria 3146
114 Ga0097621_100165022 3300006237 Bacteria 1906
115 Ga0097621_100266379 3300006237 Bacteria 1504
116 Ga0068871_100011876 3300006358 Bacteria 6407
117 Ga0075428_100004637 3300006844 Bacteria 15209
118 Ga0075428_100024116 3300006844 Bacteria 6730
119 Ga0075430_100546030 3300006846 Bacteria 956
120 Ga0075430_100557625 3300006846 Bacteria 945
121 Ga0075430_100559792 3300006846 Bacteria 943
122 Ga0075431_100144371 3300006847 Bacteria 2453
123 Ga0075431_100227241 3300006847 Bacteria 1902
124 Ga0075434_100611132 3300006871 Bacteria 1109
125 Ga0075429_100290780 3300006880 Bacteria 1431
126 Ga0075429_101123624 3300006880 Bacteria 686
127 Ga0068865_100455617 3300006881 Bacteria 1058
128 Ga0097620_100282551 3300006931 Bacteria 1752
129 Ga0097620_100714254 3300006931 Bacteria 1092
130 Ga0079104_1003142 3300006946 Bacteria 8020
131 Ga0075435_100294966 3300007076 Bacteria 1386
132 Ga0099794_10153573 3300007265 Bacteria 1169
133 Ga0099794_10170943 3300007265 Bacteria 1108
134 Ga0105240_10180520 3300009093 Bacteria 2491
135 Ga0105240_10266942 3300009093 Bacteria 1972
136 Ga0111539_10001294 3300009094 Bacteria 33400
137 Ga0111539_10071210 3300009094 Bacteria 4103
138 Ga0111539_10124118 3300009094 Bacteria 3026
139 Ga0105245_10122598 3300009098 Bacteria 2430
140 Ga0105245_10147018 3300009098 Bacteria 2224
141 Ga0105247_10208351 3300009101 Bacteria 1317
142 Ga0114129_10442176 3300009147 Bacteria 1707
143 Ga0114129_10468026 3300009147 Bacteria 1651
144 Ga0105243_10495533 3300009148 Bacteria 1156
145 Ga0105241_10283727 3300009174 Bacteria 1415
146 Ga0105242_10042076 3300009176 Bacteria 3687
147 Ga0105242_10070407 3300009176 Bacteria 2900
148 Ga0105242_10146645 3300009176 Bacteria 2053
149 Ga0105248_10379941 3300009177 Bacteria 1590
150 Ga0105249_10081235 3300009553 Bacteria 3013
151 Ga0105239_10438895 3300010375 Bacteria 1480
152 Ga0105246_10147094 3300011119 Bacteria 1779
153 Ga0157371_10048062 3300013102 Bacteria 3033
154 Ga0157370_10025847 3300013104 Bacteria 5808
155 Ga0157370_10034719 3300013104 Bacteria 4907
156 Ga0157374_10044777 3300013296 Bacteria 4091
157 Ga0157374_10613692 3300013296 Bacteria 1098
158 Ga0157378_10026505 3300013297 Bacteria 5110
159 Ga0157378_10044702 3300013297 Bacteria 3934
160 Ga0157378_10087523 3300013297 Bacteria 2826
161 Ga0163162_10210261 3300013306 Bacteria 2075
162 Ga0163162_10557141 3300013306 Bacteria 1274
163 Ga0163162_10563974 3300013306 Bacteria 1266
164 Ga0157372_10297717 3300013307 Bacteria 1876
165 Ga0157375_10051026 3300013308 Bacteria 4060
166 Ga0163163_10027693 3300014325 Bacteria 5433
167 Ga0163163_10091811 3300014325 Bacteria 3051
168 Ga0157380_10108016 3300014326 Bacteria 2332
169 Ga0157380_10175905 3300014326 Bacteria 1875
170 Ga0157377_10024961 3300014745 Bacteria 3183
171 Ga0157379_10047477 3300014968 Bacteria 3830
172 Ga0157379_11051143 3300014968 Bacteria 778
173 Ga0157376_10022565 3300014969 Bacteria 4910
174 Ga0157376_10055653 3300014969 Bacteria 3301
175 Ga0157376_10101057 3300014969 Bacteria 2519
176 Ga0182005_1102881 3300015265 Bacteria 802
177 Ga0163161_10111550 3300017792 Bacteria 2045
178 Ga0163161_10175443 3300017792 Bacteria 1641
179 Ga0154015_1362810 3300020610 Bacteria 782
180 Ga0209148_1001096 3300025254 Bacteria 16299
181 Ga0207666_1000888 3300025271 Bacteria 3585
182 Ga0209455_1000236 3300025272 Bacteria 69542
183 Ga0207673_1004643 3300025290 Bacteria 1649
184 Ga0207697_10002189 3300025315 Bacteria 10219
185 Ga0207697_10216085 3300025315 Bacteria 845
186 Ga0207656_10210016 3300025321 Bacteria 943
187 Ga0207682_10001161 3300025893 Bacteria 12213
188 Ga0207642_10047884 3300025899 Bacteria 1913
189 Ga0207710_10208443 3300025900 Bacteria 967
190 Ga0207688_10002993 3300025901 Bacteria 9201
191 Ga0207688_10067047 3300025901 Bacteria 2031
192 Ga0207688_10101303 3300025901 Bacteria 1663
193 Ga0207680_10080938 3300025903 Bacteria 2040
194 Ga0207680_10153001 3300025903 Bacteria 1539
195 Ga0207680_10176249 3300025903 Bacteria 1443
196 Ga0207647_10099220 3300025904 Bacteria 1730
197 Ga0207645_10010868 3300025907 Bacteria 6238
198 Ga0207645_10044263 3300025907 Bacteria 2849
199 Ga0207645_10221116 3300025907 Bacteria 1248
200 Ga0207643_10026528 3300025908 Bacteria 3207
201 Ga0207643_10042187 3300025908 Bacteria 2571
202 Ga0207705_10377732 3300025909 Bacteria 1094
203 Ga0207707_10009251 3300025912 Bacteria 8549
204 Ga0207707_10201759 3300025912 Bacteria 1734
205 Ga0207695_10178881 3300025913 Bacteria 2043
206 Ga0207660_10214871 3300025917 Bacteria 1507
207 Ga0207660_10555655 3300025917 Bacteria 934
208 Ga0207662_10029193 3300025918 Bacteria 3194
209 Ga0207662_10039817 3300025918 Bacteria 2759
210 Ga0207657_10023950 3300025919 Bacteria 5668
211 Ga0207657_10473578 3300025919 Bacteria 982
212 Ga0207657_10729459 3300025919 Bacteria 768
213 Ga0207649_10019012 3300025920 Bacteria 3921
214 Ga0207681_10041650 3300025923 Bacteria 3063
215 Ga0207650_10002813 3300025925 Bacteria 12015
216 Ga0207650_10006817 3300025925 Bacteria 7791
217 Ga0207650_10322936 3300025925 Bacteria 1264
218 Ga0207650_10777559 3300025925 Bacteria 811
219 Ga0207659_10023318 3300025926 Bacteria 4128
220 Ga0207659_10045268 3300025926 Bacteria 3101
221 Ga0207659_10414954 3300025926 Bacteria 1128
222 Ga0207687_10942116 3300025927 Bacteria 740
223 Ga0207644_10026240 3300025931 Bacteria 4012
224 Ga0207644_10044486 3300025931 Bacteria 3154
225 Ga0207644_10048807 3300025931 Bacteria 3028
226 Ga0207690_10026834 3300025932 Bacteria 3632
227 Ga0207690_10029263 3300025932 Bacteria 3500
228 Ga0207690_10352775 3300025932 Bacteria 1163
229 Ga0207706_10038070 3300025933 Bacteria 4267
230 Ga0207706_10132642 3300025933 Bacteria 2191
231 Ga0207686_10128682 3300025934 Bacteria 1734
232 Ga0207709_10118976 3300025935 Bacteria 1780
233 Ga0207709_10271140 3300025935 Bacteria 1249
234 Ga0207670_10112545 3300025936 Bacteria 1964
235 Ga0207669_10003224 3300025937 Bacteria 7051
236 Ga0207669_10067000 3300025937 Bacteria 2235
237 Ga0207704_10026694 3300025938 Bacteria 3172
238 Ga0207704_10148569 3300025938 Bacteria 1650
239 Ga0207665_10004112 3300025939 Bacteria 9702
240 Ga0207665_10248223 3300025939 Bacteria 1314
241 Ga0207691_10020408 3300025940 Bacteria 6263
242 Ga0207691_10033134 3300025940 Bacteria 4811
243 Ga0207691_10050441 3300025940 Bacteria 3810
244 Ga0207691_10201046 3300025940 Bacteria 1734
245 Ga0207711_10060761 3300025941 Bacteria 3257
246 Ga0207711_10303505 3300025941 Bacteria 1473
247 Ga0207711_10321403 3300025941 Bacteria 1430
248 Ga0207711_10743209 3300025941 Bacteria 914
249 Ga0207689_10002000 3300025942 Bacteria 19245
250 Ga0207689_10024322 3300025942 Bacteria 5083
251 Ga0207689_10096912 3300025942 Bacteria 2422
252 Ga0207661_10131282 3300025944 Bacteria 2146
253 Ga0207679_10054985 3300025945 Bacteria 2933
254 Ga0207679_11041986 3300025945 Bacteria 750
255 Ga0207651_10017051 3300025960 Bacteria 4278
256 Ga0207651_10019462 3300025960 Bacteria 4069
257 Ga0207712_10151874 3300025961 Bacteria 1790
258 Ga0207712_10269198 3300025961 Bacteria 1385
259 Ga0207640_10047369 3300025981 Bacteria 2772
260 Ga0207640_10077477 3300025981 Bacteria 2260
261 Ga0207640_10301198 3300025981 Bacteria 1268
262 Ga0207658_11020986 3300025986 Bacteria 755
263 Ga0207677_10070838 3300026023 Bacteria 2459
264 Ga0207677_10849615 3300026023 Bacteria 820
265 Ga0207703_10206557 3300026035 Bacteria 1748
266 Ga0207703_10559105 3300026035 Bacteria 1079
267 Ga0207639_11543170 3300026041 Bacteria 623
268 Ga0207678_10024982 3300026067 Bacteria 5218
269 Ga0207678_10829172 3300026067 Bacteria 817
270 Ga0207708_10001525 3300026075 Bacteria 17268
271 Ga0207708_10089617 3300026075 Bacteria 2371
272 Ga0207702_10409490 3300026078 Bacteria 1309
273 Ga0207641_10072218 3300026088 Bacteria 2971
274 Ga0207641_10994010 3300026088 Bacteria 835
275 Ga0207648_10002413 3300026089 Bacteria 20119
276 Ga0207648_10010715 3300026089 Bacteria 8664
277 Ga0207648_10047258 3300026089 Bacteria 3773
278 Ga0207648_10108344 3300026089 Bacteria 2439
279 Ga0207648_10177214 3300026089 Bacteria 1886
280 Ga0207676_10003738 3300026095 Bacteria 10765
281 Ga0207676_10033741 3300026095 Bacteria 3869
282 Ga0207676_10060785 3300026095 Bacteria 2990
283 Ga0207676_10459048 3300026095 Bacteria 1202
284 Ga0207674_10012605 3300026116 Bacteria 9448
285 Ga0207674_10256326 3300026116 Bacteria 1696
286 Ga0207675_100002195 3300026118 Bacteria 19391
287 Ga0207675_100060323 3300026118 Bacteria 3541
288 Ga0207683_10009151 3300026121 Bacteria 8438
289 Ga0207683_10029270 3300026121 Bacteria 4768
290 Ga0207683_10240678 3300026121 Bacteria 1651
291 Ga0207698_10051107 3300026142 Bacteria 3158
292 Ga0207698_10130666 3300026142 Bacteria 2145
293 Ga0209281_1000185 3300027111 Bacteria 144489
294 Ga0209588_1097255 3300027671 Bacteria 948
295 Ga0207428_10003119 3300027907 Bacteria 16270
296 Ga0207428_10536873 3300027907 Bacteria 847
297 Ga0268266_10778906 3300028379 Bacteria 923
298 Ga0268265_10224128 3300028380 Bacteria 1647
299 Ga0265339_10078292 3300031249 Bacteria 1750
300 Ga0265331_10001701 3300031250 Bacteria 15865
301 Ga0265313_10001910 3300031595 Bacteria 18906
302 Ga0265342_10028193 3300031712 Bacteria 3501
303 Ga0307405_10141375 3300031731 Bacteria 1679
304 Ga0307413_10655439 3300031824 Bacteria 866
305 Ga0307410_10193575 3300031852 Bacteria 1548
306 Ga0307410_11146963 3300031852 Bacteria 675
307 Ga0307406_10474366 3300031901 Bacteria 1009
308 Ga0307416_100616997 3300032002 Bacteria 1166
309 Ga0307414_10015934 3300032004 Bacteria 4554
310 Ga0373949_0039774 3300035090 Bacteria 1152
311 Ga0373954_0466173 3300035118 Bacteria 626
312 Ga0373946_0214715 3300035171 Bacteria 927
313 Ga0373961_0207116 3300035241 Bacteria 694
314 Ga0373924_0196720 3300035410 Bacteria 889
315 Ga0373931_0076086 3300035691 Bacteria 1843
316 Ga0373925_0232061 3300037068 Bacteria 1476
317 Ga0373925_0248963 3300037068 Bacteria 1425
318 Ga0395900_0771018 3300037418 Bacteria 891
319 Ga0395901_0262887 3300038443 Bacteria 1796
320 Ga0436365_1634399 3300039437 Bacteria 1252
321 Ga0436361_0054625 3300039447 Bacteria 1830
322 Ga0439449_0009101 3300042007 Bacteria 3766
323 Ga0451576_0108295 3300045051 Bacteria 2891
324 Ga0451576_0636327 3300045051 Bacteria 1121
325 Ga0451576_1430168 3300045051 Bacteria 719
326 Ga0466967_1021876 3300045976 Bacteria 823
327 Ga0495627_050704 3300046453 Bacteria 1250
328 Ga0495603_0036094 3300046455 Bacteria 2967
329 Ga0495591_002414 3300046458 Bacteria 10411
330 Ga0495591_022973 3300046458 Bacteria 2007
331 Ga0495629_0179917 3300046459 Bacteria 1466
332 Ga0495629_0453934 3300046459 Bacteria 867
333 Ga0495582_0016423 3300046473 Bacteria 4056
334 Ga0495605_0006197 3300046474 Bacteria 6899
335 Ga0495605_0166953 3300046474 Bacteria 974
336 Ga0495584_0002448 3300046491 Bacteria 10526
337 Ga0495584_0079320 3300046491 Bacteria 1651
338 Ga0495584_0079809 3300046491 Bacteria 1646
339 Ga0495585_0001749 3300046492 Bacteria 16550
340 Ga0495585_0020956 3300046492 Bacteria 3755
341 Ga0495594_0398008 3300046499 Bacteria 783
342 Ga0495596_0004882 3300046500 Bacteria 6433
343 Ga0495596_0050374 3300046500 Bacteria 1631
344 Ga0495607_0019497 3300046501 Bacteria 4306
345 Ga0495607_0060993 3300046501 Bacteria 2144
346 Ga0495607_0229135 3300046501 Bacteria 904
347 Ga0495583_0002935 3300046506 Bacteria 13742
348 Ga0495583_0095684 3300046506 Bacteria 1273
349 Ga0495606_0038835 3300046507 Bacteria 3216
350 Ga0495606_0166465 3300046507 Bacteria 1282
351 Ga0495606_0310960 3300046507 Bacteria 850
352 Ga0495610_0006047 3300046512 Bacteria 8447
353 Ga0495610_0185734 3300046512 Bacteria 861
354 Ga0495616_0056664 3300046513 Bacteria 1934
355 Ga0495616_0067256 3300046513 Bacteria 1742
356 Ga0495616_0072899 3300046513 Bacteria 1657
357 Ga0495616_0230273 3300046513 Bacteria 803
358 Ga0495620_0179077 3300046515 Bacteria 820
359 Ga0495631_0002278 3300046518 Bacteria 10987
360 Ga0495631_0031624 3300046518 Bacteria 2391
361 Ga0495631_0043968 3300046518 Bacteria 1969
362 Ga0495632_0111599 3300046519 Bacteria 1283
363 Ga0495637_0001501 3300046520 Bacteria 13679
364 Ga0495637_0132809 3300046520 Bacteria 949
365 Ga0495643_0003683 3300046522 Bacteria 11112
366 Ga0495643_0004252 3300046522 Bacteria 10109
367 Ga0495643_0133487 3300046522 Bacteria 1244
368 Ga0495644_0105888 3300046523 Bacteria 1065
369 Ga0495648_0018792 3300046524 Bacteria 4878
370 Ga0495648_0136378 3300046524 Bacteria 1297
371 Ga0495648_0219024 3300046524 Bacteria 940
372 Ga0495642_0015559 3300046528 Bacteria 2958
373 Ga0495642_0016073 3300046528 Bacteria 2913
374 Ga0495665_0017875 3300046531 Bacteria 3811
375 Ga0495598_0007048 3300046537 Bacteria 2562
376 Ga0495609_0004890 3300046538 Bacteria 7204
377 Ga0495609_0022748 3300046538 Bacteria 2887
378 Ga0495621_0030647 3300046539 Bacteria 1840
379 Ga0495621_0035705 3300046539 Bacteria 1722
380 Ga0495597_0002350 3300046542 Bacteria 12187
381 Ga0495633_0001768 3300046558 Bacteria 16030
382 Ga0495633_0003584 3300046558 Bacteria 10269
383 Ga0495633_0103155 3300046558 Bacteria 1323
384 Ga0495668_0101765 3300046616 Bacteria 1571
385 Ga0495668_0127076 3300046616 Bacteria 1395
386 Ga0495668_0292584 3300046616 Bacteria 892
387 Ga0495611_0020106 3300046648 Bacteria 2872
388 Ga0495611_0105341 3300046648 Bacteria 1311
389 Ga0495611_0113749 3300046648 Bacteria 1260
390 Ga0495625_0206081 3300046660 Bacteria 1295
391 Ga0495661_0005995 3300046665 Bacteria 8579
392 Ga0495661_0023971 3300046665 Bacteria 3954
393 Ga0495588_0283627 3300046674 Bacteria 873
394 Ga0495623_0168188 3300046679 Bacteria 1283
395 Ga0495669_0009132 3300046684 Bacteria 4178
396 Ga0495669_0011285 3300046684 Bacteria 3792
397 Ga0495669_0248718 3300046684 Bacteria 854
398 Ga0495670_0001829 3300046691 Bacteria 10457
399 Ga0495670_0268273 3300046691 Bacteria 911
400 Ga0495670_0306495 3300046691 Bacteria 851
401 Ga0495649_0003510 3300046694 Bacteria 10558
402 Ga0495649_0086286 3300046694 Bacteria 1675
403 Ga0495589_0021409 3300046794 Bacteria 3304
404 Ga0495589_0108405 3300046794 Bacteria 1341
405 Ga0495589_0115390 3300046794 Bacteria 1294
406 Ga0495660_0046735 3300046810 Bacteria 2373
407 Ga0495660_0086272 3300046810 Bacteria 1638
408 Ga0495660_0094627 3300046810 Bacteria 1546
409 Ga0495581_0087675 3300047315 Bacteria 1804
410 Ga0495672_0003402 3300047320 Bacteria 13658
411 Ga0495672_0005177 3300047320 Bacteria 10406
412 Ga0495683_0001729 3300047323 Bacteria 13823
413 Ga0495683_0012586 3300047323 Bacteria 4442
414 Ga0495683_0226372 3300047323 Bacteria 831
415 Ga0495677_0001217 3300047445 Bacteria 10305
416 Ga0495677_0002706 3300047445 Bacteria 6925
417 Ga0495677_0012869 3300047445 Bacteria 3047
418 Ga0495677_0048298 3300047445 Bacteria 1563
419 Ga0495679_027749 3300047446 Bacteria 1863
420 Ga0495679_041794 3300047446 Bacteria 1417
421 Ga0495685_000764 3300047447 Bacteria 9829
422 Ga0495685_060323 3300047447 Bacteria 1279
423 Ga0495681_0003858 3300047470 Bacteria 10364
424 Ga0495681_0131323 3300047470 Bacteria 1065
425 Ga0495686_0007559 3300047472 Bacteria 8128
426 Ga0495593_0113958 3300047673 Bacteria 1379
427 Ga0495614_0013584 3300048089 Bacteria 3570
428 Ga0495626_0019658 3300048091 Bacteria 3375
429 Ga0495626_0031282 3300048091 Bacteria 2562
430 Ga0496101_0024851 3300048904 Bacteria 4152
431 Ga0496102_0131818 3300048905 Bacteria 2340
432 Ga0496104_0051577 3300048907 Bacteria 3883
433 Ga0496106_0079311 3300048909 Bacteria 2520
434 Ga0496107_0052602 3300048910 Bacteria 2937
435 Ga0496107_0295948 3300048910 Bacteria 1205
436 Ga0496109_0038809 3300048912 Bacteria 4307
437 Ga0496109_0185969 3300048912 Bacteria 1952
438 Ga0496110_0034272 3300048913 Bacteria 4397
439 Ga0496110_0536063 3300048913 Bacteria 1064
440 Ga0496114_0031768 3300048917 Bacteria 4344
441 Ga0496114_0886406 3300048917 Bacteria 773
442 Ga0496124_0129929 3300048927 Bacteria 2002
443 Ga0496124_0190304 3300048927 Bacteria 1571
444 Ga0495678_002197 3300049459 Bacteria 13677
445 Ga0495682_0176518 3300049460 Bacteria 759
446 Ga0501041_0178290 3300049577 Bacteria 1330
447 Ga0501067_0029724 3300049583 Bacteria 3028
448 Ga0501072_0755004 3300049588 Bacteria 763
449 Ga0501073_0003137 3300049589 Bacteria 12392
450 Ga0501235_129396 3300049669 Bacteria 638
451 nmdc:mga0k408_70295_c1 3300050493 Bacteria 2043
452 nmdc:mga05p37_190319_c1 3300050507 Bacteria 2492
453 nmdc:mga05p37_387281_c2 3300050507 Bacteria 650
454 nmdc:mga0qj67_437162_c1 3300050509 Bacteria 1054
455 nmdc:mga0qj67_605905_c1 3300050509 Bacteria 876
456 nmdc:mga0qj67_763430_c1 3300050509 Bacteria 767
457 nmdc:mga0qj67_891086_c1 3300050509 Bacteria 701
458 nmdc:mga06r32_102176_c1 3300050510 Bacteria 2814
459 nmdc:mga06r32_219179_c1 3300050510 Bacteria 1891
460 nmdc:mga08y16_158395_c1 3300050511 Bacteria 2352
461 nmdc:mga08y16_161147_c1 3300050511 Bacteria 2331
462 nmdc:mga08y16_288417_c1 3300050511 Bacteria 1692
463 nmdc:mga08y16_3082_c1 3300050511 Bacteria 17238
464 nmdc:mga0n895_199522_c1 3300050512 Bacteria 2032
465 nmdc:mga0rr50_181811_c1 3300050513 Bacteria 1719
466 Ga0495601_0102346 3300053077 Bacteria 1851
467 Ga0500647_0275238 3300053091 Bacteria 730
468 Ga0500604_0000554 3300053151 Bacteria 10291
469 Ga0587086_018684 3300059507 Bacteria 926
470 Ga0501082_0344217 3300060353 Bacteria 1299
471 Ga0530510_0004951 3300061734 Bacteria 9199
472 2510308229 2510065057 Bacteria 6649661
473 2511497177 2511231052 Bacteria 6974333
474 2512529644 2512047086 Bacteria 6850303
475 2513582653 2513237086 Bacteria 7265287
476 2513614705 2513237091 Bacteria 6900273
477 2513882222 2513237140 Bacteria 7076289
478 2513901841 2513237143 Bacteria 6664116
479 2515611766 2515154107 Bacteria 6795637
480 2516895592 2516653046 Bacteria 6989037
481 2524449427 2524023207 Bacteria 6813453
482 2551678935 2551306084 Bacteria 8942552
483 2551682173 2551306084 Bacteria 8942552
484 2551683487 2551306085 Bacteria 7347181
485 2551693089 2551306086 Bacteria 6843938
486 2551699525 2551306087 Bacteria 7351905
487 2551736930 2551306092 Bacteria 6992595
488 2551741065 2551306093 Bacteria 7064773
489 2739612108 2739367655 Bacteria 4051151
490 2776265895 2775506901 Bacteria 9631051
491 2855829594 2855825444 Bacteria 6785811
492 2855844690 2855839649 Bacteria 7135830
493 2858805846 2858800743 Bacteria 6603254
494 2908744722 2908739725 Bacteria 8628932
495 2915991496 2915986958 Bacteria 6739310
496 2916000569 2915993759 Bacteria 7016183
497 2916005162 2916000859 Bacteria 6865702
498 2916007692 2916007675 Bacteria 6898660
499 2916021201 2916014648 Bacteria 6946486
500 2916021904 2916021584 Bacteria 6854472
501 2916030899 2916028427 Bacteria 6748433
502 2916041042 2916035215 Bacteria 6755766
503 2916042253 2916041962 Bacteria 6820487
504 2916053427 2916048683 Bacteria 6543552
505 2916057173 2916055098 Bacteria 6758838
506 2916075663 2916068649 Bacteria 6943657
507 2916080258 2916076590 Bacteria 6596108
508 2921201691 2921201388 Bacteria 6926299
509 2921212381 2921208531 Bacteria 6745326
510 2921242075 2921237296 Bacteria 6876710
511 2921244805 2921244191 Bacteria 6568419
512 2921259219 2921257292 Bacteria 6808382
513 2921269851 2921263974 Bacteria 6864552
514 2921286761 2921282425 Bacteria 6826397
515 2921292310 2921289301 Bacteria 7316391
516 2921300857 2921296804 Bacteria 7176999
517 2924147907 2924144063 Bacteria 6883928
518 2924152792 2924150972 Bacteria 7169444
519 2924161942 2924158325 Bacteria 7188855
520 2924165779 2924165586 Bacteria 7260590
521 2924175627 2924172951 Bacteria 6749356
522 2924180451 2924179722 Bacteria 6843264
523 2924186737 2924186466 Bacteria 6876637
524 2924199392 2924193448 Bacteria 6955718
525 2924200772 2924200457 Bacteria 6757188
526 2924207395 2924207177 Bacteria 6917007
527 2924215589 2924214083 Bacteria 7080103
528 2924222544 2924221636 Bacteria 7113495
529 2924229112 2924228884 Bacteria 6633132
530 2936997080 2936996657 Bacteria 6298727
531 2937003236 2937002841 Bacteria 6934057
532 2937010085 2937009748 Bacteria 6746052
533 2937020521 2937016420 Bacteria 6782579
534 2937025403 2937023124 Bacteria 6815156
535 2937045219 2937042894 Bacteria 6741576
536 2937054254 2937049772 Bacteria 6757901
537 2937060300 2937056579 Bacteria 7107896
538 2937064162 2937063883 Bacteria 7199456
539 2937076894 2937071275 Bacteria 6984483
540 2937092557 2937091812 Bacteria 6979387
541 2937105013 2937098957 Bacteria 7249374
542 2937112971 2937106411 Bacteria 6947143
543 2937115665 2937113482 Bacteria 6505872
544 2937119856 2937119839 Bacteria 6597547
545 2937132546 2937126314 Bacteria 6771275
546 2939670525 2939669807 Bacteria 5028511
547 2957382510 2957382221 Bacteria 6737050
548 2957391723 2957388812 Bacteria 6778072
549 2957400182 2957395598 Bacteria 6822399
550 2957404044 2957402308 Bacteria 6741770
551 2957411430 2957408893 Bacteria 6558585
552 2957416454 2957415311 Bacteria 6991633
553 2957424847 2957422303 Bacteria 7172205
554 2957445772 2957443900 Bacteria 6869977
555 2957450871 2957450854 Bacteria 6765715
556 2957460306 2957457609 Bacteria 6967680
557 2957465448 2957464669 Bacteria 6568877
558 2957474463 2957471148 Bacteria 6797643
559 2957478884 2957478035 Bacteria 6756658
560 2957493425 2957491536 Bacteria 6695180
561 2957498484 2957498199 Bacteria 7126688
562 2957508946 2957505466 Bacteria 7253085
563 2960588088 2960584000 Bacteria 6864594
564 2960600046 2960597568 Bacteria 6550735
565 2960607373 2960603979 Bacteria 6898737
566 2960611183 2960610863 Bacteria 6691244
567 2960622541 2960617483 Bacteria 6727748
568 2960627568 2960624210 Bacteria 6875384
569 2960644225 2960637947 Bacteria 7296468
570 2960647374 2960645483 Bacteria 7211087
571 2960657112 2960652885 Bacteria 7083688
572 2960663929 2960660292 Bacteria 7041660
573 2960674021 2960667422 Bacteria 6763020
574 2960674460 2960674078 Bacteria 6609048
575 2960691807 2960687367 Bacteria 6535474
576 2964611853 2964607997 Bacteria 7101408
577 2964618602 2964615318 Bacteria 6809089
578 2964626652 2964621998 Bacteria 6834995
579 2964634807 2964628898 Bacteria 7083044
580 2964636307 2964636051 Bacteria 7091832
581 2964643194 2964643177 Bacteria 6820887
582 2964652454 2964649959 Bacteria 6675118
583 2964662160 2964656573 Bacteria 7100150
584 2964663819 2964663802 Bacteria 7019362
585 2964677927 2964670856 Bacteria 6851364
586 2964683542 2964678106 Bacteria 6792020
587 2964685144 2964685014 Bacteria 6839111
588 2964694253 2964691889 Bacteria 6802758
589 2964699095 2964698721 Bacteria 6765331
590 2964710905 2964705432 Bacteria 7114648
591 2964716573 2964712639 Bacteria 6695970
592 2964722726 2964719344 Bacteria 7286602
593 2967669912 2967664464 Bacteria 6948836
594 2967671588 2967671571 Bacteria 7021409
595 2967682936 2967678726 Bacteria 7264382
596 2967695573 2967693043 Bacteria 6804451
597 2967706092 2967699805 Bacteria 6854538
598 2967714245 2967706974 Bacteria 7186053
599 2967717540 2967714385 Bacteria 7000047
600 2967721593 2967721400 Bacteria 7073753
601 2967737224 2967735183 Bacteria 6827012
602 2967748367 2967742019 Bacteria 6794534
603 2967748988 2967748971 Bacteria 6733771
604 2967755739 2967755722 Bacteria 6814706
605 2967764588 2967762386 Bacteria 6923502
606 2967769635 2967769361 Bacteria 6587838
607 2967781793 2967775926 Bacteria 6738189
608 2970024000 2970019648 Bacteria 7072033
609 2970033667 2970033650 Bacteria 7118744
610 2970041488 2970040964 Bacteria 6731123
611 2970054495 2970047711 Bacteria 7088379
612 2970057645 2970054988 Bacteria 6611507
613 2970065711 2970061556 Bacteria 7099761
614 2970068844 2970068827 Bacteria 7123112
615 2970078200 2970076120 Bacteria 6697332
616 2970084275 2970082768 Bacteria 6183754
617 2970089388 2970088815 Bacteria 6933825
618 2970095782 2970095765 Bacteria 6936963
619 2970102694 2970102677 Bacteria 6812532
620 2970111155 2970109326 Bacteria 6863976
621 2970117708 2970116247 Bacteria 6501857
622 2970132072 2970129317 Bacteria 6806560
623 2970136242 2970136068 Bacteria 7207982
624 2970151945 2970149975 Bacteria 6779706
625 2970160838 2970156795 Bacteria 7168044
626 2970169038 2970164137 Bacteria 6861252
627 2970170979 2970170962 Bacteria 6876229
628 2970183349 2970177841 Bacteria 6768001
629 2970189475 2970184632 Bacteria 7054431
630 2970192043 2970191845 Bacteria 7032787
631 2977518336 2977516862 Bacteria 6940108
632 2977526348 2977523885 Bacteria 6960446
633 2977543074 2977537788 Bacteria 6929320
634 2977555968 2977551784 Bacteria 7125765
635 2977565848 2977558990 Bacteria 6863948
636 2977566269 2977565890 Bacteria 6901543
637 2977575448 2977572785 Bacteria 6763888
638 2977582347 2977579622 Bacteria 6772100
639 648735701 648276728 Bacteria 6968865
640 8003997219 8003992118 Bacteria 7266902
641 Ga0182005_1031458
642 JGI24752J21851_1005054
643 JGI24737J22298_10045781
644 JGI24743J22301_10008908
645 JGI24748J21848_1003367
646 JGI24749J21850_1001329
647 JGI24744J21845_10010718
648 JGI24742J22300_10044733
649 Ga0055529_1026157
650 Ga0065165_1003711
651 Ga0065712_10540831
652 Ga0070658_10104267
653 Ga0070676_10016431
654 Ga0070676_10062888
655 Ga0070676_10245112
656 Ga0070683_100019617
657 Ga0070683_100189909
658 Ga0070690_100152768
659 Ga0070690_100156452
660 Ga0070670_100006947
661 Ga0070670_100058116
662 Ga0070670_100255945
663 Ga0070670_100637166
664 Ga0070670_100902906
665 Ga0070677_10002830
666 Ga0068869_100027285
667 Ga0068869_100095733
668 Ga0068869_100468044
669 Ga0070680_100718791
670 Ga0068868_100368109
671 Ga0070660_100499463
672 Ga0070689_100015051
673 Ga0070687_100093941
674 Ga0070661_100013384
675 Ga0070661_100074158
676 Ga0070661_100266817
677 Ga0070668_100604830
678 Ga0070669_100051391
679 Ga0070669_100661514
680 Ga0070675_100041261
681 Ga0070675_100094711
682 Ga0070671_100062933
683 Ga0070671_100096781
684 Ga0070671_100156909
685 Ga0070674_100021692
686 Ga0070674_100031942
687 Ga0070674_100165796
688 Ga0070673_100089311
689 Ga0070673_100207692
690 Ga0070688_100377183
691 Ga0070688_100389916
692 Ga0070659_100005300
693 Ga0070659_100042770
694 Ga0070667_100341337
695 Ga0070667_101275727
696 Ga0070703_10128338
697 Ga0070701_10015017
698 Ga0070711_100160087
699 Ga0070700_100038683
700 Ga0070700_100038975
701 Ga0070708_100019076
702 Ga0070663_100012638
703 Ga0070678_100986672
704 Ga0070662_100017354
705 Ga0070662_100521937
706 Ga0070662_100699144
707 Ga0070681_10006485
708 Ga0068867_100124676
709 Ga0068867_100129083
710 Ga0068867_100183164
711 Ga0068867_100488263
712 Ga0070685_10007635
713 Ga0070706_100363177
714 Ga0070707_100114703
715 Ga0070707_100623547
716 Ga0070698_100729237
717 Ga0070684_100042011
718 Ga0070697_100001052
719 Ga0068853_100045009
720 Ga0070672_100052594
721 Ga0070672_100192218
722 Ga0070672_100377268
723 Ga0070686_100200402
724 Ga0070693_100083483
725 Ga0070665_100125484
726 Ga0070704_100328421
727 Ga0068855_100157348
728 Ga0070664_100045617
729 Ga0068857_100033561
730 Ga0068854_100062515
731 Ga0068854_100733413
732 Ga0068856_100275528
733 Ga0068852_100066781
734 Ga0068852_100183587
735 Ga0068859_100282552
736 Ga0068859_100714279
737 Ga0068864_100010838
738 Ga0068864_100054081
739 Ga0068864_100282178
740 Ga0068866_10000718
741 Ga0068866_10470586
742 Ga0068851_10008199
743 Ga0068851_10060950
744 Ga0068870_10009253
745 Ga0068870_10203884
746 Ga0068863_100170636
747 Ga0068863_101093223
748 Ga0068858_100147608
749 Ga0068860_100031554
750 Ga0068862_100133557
751 Ga0081539_10000123
752 Ga0070716_100019444
753 Ga0097621_100058776
754 Ga0097621_100165022
755 Ga0097621_100266379
756 Ga0068871_100011876
757 Ga0075428_100004637
758 Ga0075428_100024116
759 Ga0075430_100546030
760 Ga0075430_100557625
761 Ga0075430_100559792
762 Ga0075431_100144371
763 Ga0075431_100227241
764 Ga0075434_100611132
765 Ga0075429_100290780
766 Ga0075429_101123624
767 Ga0068865_100455617
768 Ga0097620_100282551
769 Ga0097620_100714254
770 Ga0079104_1003142
771 Ga0075435_100294966
772 Ga0099794_10153573
773 Ga0099794_10170943
774 Ga0105240_10180520
775 Ga0105240_10266942
776 Ga0111539_10001294
777 Ga0111539_10071210
778 Ga0111539_10124118
779 Ga0105245_10122598
780 Ga0105245_10147018
781 Ga0105247_10208351
782 Ga0114129_10442176
783 Ga0114129_10468026
784 Ga0105243_10495533
785 Ga0105241_10283727
786 Ga0105242_10042076
787 Ga0105242_10070407
788 Ga0105242_10146645
789 Ga0105248_10379941
790 Ga0105249_10081235
791 Ga0105239_10438895
792 Ga0105246_10147094
793 Ga0157371_10048062
794 Ga0157370_10025847
795 Ga0157370_10034719
796 Ga0157374_10044777
797 Ga0157374_10613692
798 Ga0157378_10026505
799 Ga0157378_10044702
800 Ga0157378_10087523
801 Ga0163162_10210261
802 Ga0163162_10557141
803 Ga0163162_10563974
804 Ga0157372_10297717
805 Ga0157375_10051026
806 Ga0163163_10027693
807 Ga0163163_10091811
808 Ga0157380_10108016
809 Ga0157380_10175905
810 Ga0157377_10024961
811 Ga0157379_10047477
812 Ga0157379_11051143
813 Ga0157376_10022565
814 Ga0157376_10055653
815 Ga0157376_10101057
816 Ga0182005_1102881
817 Ga0163161_10111550
818 Ga0163161_10175443
819 Ga0154015_1362810
820 Ga0209148_1001096
821 Ga0207666_1000888
822 Ga0209455_1000236
823 Ga0207673_1004643
824 Ga0207697_10002189
825 Ga0207697_10216085
826 Ga0207656_10210016
827 Ga0207682_10001161
828 Ga0207642_10047884
829 Ga0207710_10208443
830 Ga0207688_10002993
831 Ga0207688_10067047
832 Ga0207688_10101303
833 Ga0207680_10080938
834 Ga0207680_10153001
835 Ga0207680_10176249
836 Ga0207647_10099220
837 Ga0207645_10010868
838 Ga0207645_10044263
839 Ga0207645_10221116
840 Ga0207643_10026528
841 Ga0207643_10042187
842 Ga0207705_10377732
843 Ga0207707_10009251
844 Ga0207707_10201759
845 Ga0207695_10178881
846 Ga0207660_10214871
847 Ga0207660_10555655
848 Ga0207662_10029193
849 Ga0207662_10039817
850 Ga0207657_10023950
851 Ga0207657_10473578
852 Ga0207657_10729459
853 Ga0207649_10019012
854 Ga0207681_10041650
855 Ga0207650_10002813
856 Ga0207650_10006817
857 Ga0207650_10322936
858 Ga0207650_10777559
859 Ga0207659_10023318
860 Ga0207659_10045268
861 Ga0207659_10414954
862 Ga0207687_10942116
863 Ga0207644_10026240
864 Ga0207644_10044486
865 Ga0207644_10048807
866 Ga0207690_10026834
867 Ga0207690_10029263
868 Ga0207690_10352775
869 Ga0207706_10038070
870 Ga0207706_10132642
871 Ga0207686_10128682
872 Ga0207709_10118976
873 Ga0207709_10271140
874 Ga0207670_10112545
875 Ga0207669_10003224
876 Ga0207669_10067000
877 Ga0207704_10026694
878 Ga0207704_10148569
879 Ga0207665_10004112
880 Ga0207665_10248223
881 Ga0207691_10020408
882 Ga0207691_10033134
883 Ga0207691_10050441
884 Ga0207691_10201046
885 Ga0207711_10060761
886 Ga0207711_10303505
887 Ga0207711_10321403
888 Ga0207711_10743209
889 Ga0207689_10002000
890 Ga0207689_10024322
891 Ga0207689_10096912
892 Ga0207661_10131282
893 Ga0207679_10054985
894 Ga0207679_11041986
895 Ga0207651_10017051
896 Ga0207651_10019462
897 Ga0207712_10151874
898 Ga0207712_10269198
899 Ga0207640_10047369
900 Ga0207640_10077477
901 Ga0207640_10301198
902 Ga0207658_11020986
903 Ga0207677_10070838
904 Ga0207677_10849615
905 Ga0207703_10206557
906 Ga0207703_10559105
907 Ga0207639_11543170
908 Ga0207678_10024982
909 Ga0207678_10829172
910 Ga0207708_10001525
911 Ga0207708_10089617
912 Ga0207702_10409490
913 Ga0207641_10072218
914 Ga0207641_10994010
915 Ga0207648_10002413
916 Ga0207648_10010715
917 Ga0207648_10047258
918 Ga0207648_10108344
919 Ga0207648_10177214
920 Ga0207676_10003738
921 Ga0207676_10033741
922 Ga0207676_10060785
923 Ga0207676_10459048
924 Ga0207674_10012605
925 Ga0207674_10256326
926 Ga0207675_100002195
927 Ga0207675_100060323
928 Ga0207683_10009151
929 Ga0207683_10029270
930 Ga0207683_10240678
931 Ga0207698_10051107
932 Ga0207698_10130666
933 Ga0209281_1000185
934 Ga0209588_1097255
935 Ga0207428_10003119
936 Ga0207428_10536873
937 Ga0268266_10778906
938 Ga0268265_10224128
939 Ga0265339_10078292
940 Ga0265331_10001701
941 Ga0265313_10001910
942 Ga0265342_10028193
943 Ga0307405_10141375
944 Ga0307413_10655439
945 Ga0307410_10193575
946 Ga0307410_11146963
947 Ga0307406_10474366
948 Ga0307416_100616997
949 Ga0307414_10015934
950 Ga0373949_0039774
951 Ga0373954_0466173
952 Ga0373946_0214715
953 Ga0373961_0207116
954 Ga0373924_0196720
955 Ga0373931_0076086
956 Ga0373925_0232061
957 Ga0373925_0248963
958 Ga0395900_0771018
959 Ga0395901_0262887
960 Ga0436365_1634399
961 Ga0436361_0054625
962 Ga0439449_0009101
963 Ga0451576_0108295
964 Ga0451576_0636327
965 Ga0451576_1430168
966 Ga0466967_1021876
967 Ga0495627_050704
968 Ga0495603_0036094
969 Ga0495591_002414
970 Ga0495591_022973
971 Ga0495629_0179917
972 Ga0495629_0453934
973 Ga0495582_0016423
974 Ga0495605_0006197
975 Ga0495605_0166953
976 Ga0495584_0002448
977 Ga0495584_0079320
978 Ga0495584_0079809
979 Ga0495585_0001749
980 Ga0495585_0020956
981 Ga0495594_0398008
982 Ga0495596_0004882
983 Ga0495596_0050374
984 Ga0495607_0019497
985 Ga0495607_0060993
986 Ga0495607_0229135
987 Ga0495583_0002935
988 Ga0495583_0095684
989 Ga0495606_0038835
990 Ga0495606_0166465
991 Ga0495606_0310960
992 Ga0495610_0006047
993 Ga0495610_0185734
994 Ga0495616_0056664
995 Ga0495616_0067256
996 Ga0495616_0072899
997 Ga0495616_0230273
998 Ga0495620_0179077
999 Ga0495631_0002278
1000 Ga0495631_0031624
1001 Ga0495631_0043968
1002 Ga0495632_0111599
1003 Ga0495637_0001501
1004 Ga0495637_0132809
1005 Ga0495643_0003683
1006 Ga0495643_0004252
1007 Ga0495643_0133487
1008 Ga0495644_0105888
1009 Ga0495648_0018792
1010 Ga0495648_0136378
1011 Ga0495648_0219024
1012 Ga0495642_0015559
1013 Ga0495642_0016073
1014 Ga0495665_0017875
1015 Ga0495598_0007048
1016 Ga0495609_0004890
1017 Ga0495609_0022748
1018 Ga0495621_0030647
1019 Ga0495621_0035705
1020 Ga0495597_0002350
1021 Ga0495633_0001768
1022 Ga0495633_0003584
1023 Ga0495633_0103155
1024 Ga0495668_0101765
1025 Ga0495668_0127076
1026 Ga0495668_0292584
1027 Ga0495611_0020106
1028 Ga0495611_0105341
1029 Ga0495611_0113749
1030 Ga0495625_0206081
1031 Ga0495661_0005995
1032 Ga0495661_0023971
1033 Ga0495588_0283627
1034 Ga0495623_0168188
1035 Ga0495669_0009132
1036 Ga0495669_0011285
1037 Ga0495669_0248718
1038 Ga0495670_0001829
1039 Ga0495670_0268273
1040 Ga0495670_0306495
1041 Ga0495649_0003510
1042 Ga0495649_0086286
1043 Ga0495589_0021409
1044 Ga0495589_0108405
1045 Ga0495589_0115390
1046 Ga0495660_0046735
1047 Ga0495660_0086272
1048 Ga0495660_0094627
1049 Ga0495581_0087675
1050 Ga0495672_0003402
1051 Ga0495672_0005177
1052 Ga0495683_0001729
1053 Ga0495683_0012586
1054 Ga0495683_0226372
1055 Ga0495677_0001217
1056 Ga0495677_0002706
1057 Ga0495677_0012869
1058 Ga0495677_0048298
1059 Ga0495679_027749
1060 Ga0495679_041794
1061 Ga0495685_000764
1062 Ga0495685_060323
1063 Ga0495681_0003858
1064 Ga0495681_0131323
1065 Ga0495686_0007559
1066 Ga0495593_0113958
1067 Ga0495614_0013584
1068 Ga0495626_0019658
1069 Ga0495626_0031282
1070 Ga0496101_0024851
1071 Ga0496102_0131818
1072 Ga0496104_0051577
1073 Ga0496106_0079311
1074 Ga0496107_0052602
1075 Ga0496107_0295948
1076 Ga0496109_0038809
1077 Ga0496109_0185969
1078 Ga0496110_0034272
1079 Ga0496110_0536063
1080 Ga0496114_0031768
1081 Ga0496114_0886406
1082 Ga0496124_0129929
1083 Ga0496124_0190304
1084 Ga0495678_002197
1085 Ga0495682_0176518
1086 Ga0501041_0178290
1087 Ga0501067_0029724
1088 Ga0501072_0755004
1089 Ga0501073_0003137
1090 Ga0501235_129396
1091 nmdc:mga0k408_70295_c1
1092 nmdc:mga05p37_190319_c1
1093 nmdc:mga05p37_387281_c2
1094 nmdc:mga0qj67_437162_c1
1095 nmdc:mga0qj67_605905_c1
1096 nmdc:mga0qj67_763430_c1
1097 nmdc:mga0qj67_891086_c1
1098 nmdc:mga06r32_102176_c1
1099 nmdc:mga06r32_219179_c1
1100 nmdc:mga08y16_158395_c1
1101 nmdc:mga08y16_161147_c1
1102 nmdc:mga08y16_288417_c1
1103 nmdc:mga08y16_3082_c1
1104 nmdc:mga0n895_199522_c1
1105 nmdc:mga0rr50_181811_c1
1106 Ga0495601_0102346
1107 Ga0500647_0275238
1108 Ga0500604_0000554
1109 Ga0587086_018684
1110 Ga0501082_0344217
1111 Ga0530510_0004951
1112 2510308229
1113 2511497177
1114 2512529644
1115 2513582653
1116 2513614705
1117 2513882222
1118 2513901841
1119 2515611766
1120 2516895592
1121 2524449427
1122 2551678935
1123 2551682173
1124 2551683487
1125 2551693089
1126 2551699525
1127 2551736930
1128 2551741065
1129 2739612108
1130 2776265895
1131 2855829594
1132 2855844690
1133 2858805846
1134 2908744722
1135 2915991496
1136 2916000569
1137 2916005162
1138 2916007692
1139 2916021201
1140 2916021904
1141 2916030899
1142 2916041042
1143 2916042253
1144 2916053427
1145 2916057173
1146 2916075663
1147 2916080258
1148 2921201691
1149 2921212381
1150 2921242075
1151 2921244805
1152 2921259219
1153 2921269851
1154 2921286761
1155 2921292310
1156 2921300857
1157 2924147907
1158 2924152792
1159 2924161942
1160 2924165779
1161 2924175627
1162 2924180451
1163 2924186737
1164 2924199392
1165 2924200772
1166 2924207395
1167 2924215589
1168 2924222544
1169 2924229112
1170 2936997080
1171 2937003236
1172 2937010085
1173 2937020521
1174 2937025403
1175 2937045219
1176 2937054254
1177 2937060300
1178 2937064162
1179 2937076894
1180 2937092557
1181 2937105013
1182 2937112971
1183 2937115665
1184 2937119856
1185 2937132546
1186 2939670525
1187 2957382510
1188 2957391723
1189 2957400182
1190 2957404044
1191 2957411430
1192 2957416454
1193 2957424847
1194 2957445772
1195 2957450871
1196 2957460306
1197 2957465448
1198 2957474463
1199 2957478884
1200 2957493425
1201 2957498484
1202 2957508946
1203 2960588088
1204 2960600046
1205 2960607373
1206 2960611183
1207 2960622541
1208 2960627568
1209 2960644225
1210 2960647374
1211 2960657112
1212 2960663929
1213 2960674021
1214 2960674460
1215 2960691807
1216 2964611853
1217 2964618602
1218 2964626652
1219 2964634807
1220 2964636307
1221 2964643194
1222 2964652454
1223 2964662160
1224 2964663819
1225 2964677927
1226 2964683542
1227 2964685144
1228 2964694253
1229 2964699095
1230 2964710905
1231 2964716573
1232 2964722726
1233 2967669912
1234 2967671588
1235 2967682936
1236 2967695573
1237 2967706092
1238 2967714245
1239 2967717540
1240 2967721593
1241 2967737224
1242 2967748367
1243 2967748988
1244 2967755739
1245 2967764588
1246 2967769635
1247 2967781793
1248 2970024000
1249 2970033667
1250 2970041488
1251 2970054495
1252 2970057645
1253 2970065711
1254 2970068844
1255 2970078200
1256 2970084275
1257 2970089388
1258 2970095782
1259 2970102694
1260 2970111155
1261 2970117708
1262 2970132072
1263 2970136242
1264 2970151945
1265 2970160838
1266 2970169038
1267 2970170979
1268 2970183349
1269 2970189475
1270 2970192043
1271 2977518336
1272 2977526348
1273 2977543074
1274 2977555968
1275 2977565848
1276 2977566269
1277 2977575448
1278 2977582347
1279 648735701
1280 8003997219

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

48

141

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xa8-assembly1.cif.gz_A crystal structure analysis of glutathione-dependent formaldehyde-activating enzyme (gfa) 0.9842 2 191
1xa8-assembly1.cif.gz_A crystal structure analysis of glutathione-dependent formaldehyde-activating enzyme (gfa) 0.969 2 191
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.7317 25 166
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.7143 25 166
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.7135 21 169
ID Description Score Start End Superfamily
1xa8D00 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.9849 2 191 3.90.1590.10
1xa8D00 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.9697 2 191 3.90.1590.10
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.8022 23 141 3.90.1590.10
3facD00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.6944 25 167 2.170.150.70
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.6788 23 141 3.90.1590.10
ID Description Score Start End GO Terms
AF-A0A2A3JZ04-F1-model_v4 Glutathione-dependent formaldehyde-activating enzyme (EC 4.4.1.22) (S-(hydroxymethyl)glutathione synthase) 1 5 187 GO:0008270
GO:0046294
GO:0051907
AF-A0A3M2SSX5-F1-model_v4 CENP-V/GFA domain-containing protein 1 21 170 GO:0008270
GO:0046294
GO:0051907
AF-D4ZD20-F1-model_v4 Glutathione-dependent formaldehyde-activating enzyme (EC 4.4.1.22) (S-(hydroxymethyl)glutathione synthase) 1 26 185 GO:0008270
GO:0046294
GO:0051907
AF-A0A1H3FHQ2-F1-model_v4 S-(Hydroxymethyl)glutathione synthase 1 5 129 GO:0016846
GO:0046872
AF-A6FDY1-F1-model_v4 Glutathione-dependent formaldehyde-activating enzyme (EC 4.4.1.22) (S-(hydroxymethyl)glutathione synthase) 0.9999 5 185 GO:0008270
GO:0046294
GO:0051907

Map