F471686
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 640 | 443 | 1280 | 190 |
Family's Representative Sequence
| Representative Sequence | 3300015265|Ga0182005_1031458|Ga0182005_10314582 |
| Length | 191 |
| Sequence | MPATVLLHPTIDYGIRKGADDFAGGTLICHCLDKPVRVEIQGQIAHNHACGCTQCWKPEGAIVSIVGVVPTDHVKVAANGDKLAVVNPAATILRHACQVCGVHMHGPVEKDHAFKGLTFVHTELSREEGWQAPQFGAFISSVIEGGVKPDRMGAIRSRIRELGLEPYDCLSPPLMDALAIFAAKKSGVLAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 2 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 6 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 7 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 8 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 9 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 72 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 76 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 77 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 83 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 84 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 111 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 168 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 170 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 173 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 174 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 175 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 176 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 177 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 178 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 179 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 180 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 181 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 182 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 183 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 184 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 185 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 186 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 187 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 188 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 190 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 191 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 192 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 193 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 194 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 195 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 196 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 249 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 250 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 251 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 252 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 254 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 255 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 256 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 263 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 264 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 272 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 273 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 274 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 276 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 277 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 278 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 279 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 280 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 281 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 282 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 283 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 284 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 285 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 286 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 287 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 288 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 289 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 290 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 291 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 292 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 293 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 294 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 295 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 296 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 297 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 298 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 299 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 300 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 301 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 302 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 303 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 304 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 305 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 306 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 307 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 308 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 309 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 310 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 311 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 312 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 313 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 314 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 315 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 316 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 317 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 318 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 319 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 320 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 321 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 322 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 323 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 324 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 325 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 326 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 327 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 328 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 329 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 330 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 331 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 332 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 333 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 334 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 335 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 336 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 337 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 338 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 339 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 340 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 341 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 342 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 343 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 344 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 345 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 346 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 347 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 348 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 349 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 350 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 351 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 352 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 353 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 354 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 355 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 356 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 357 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 358 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 359 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 360 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 361 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 362 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 363 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 364 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 365 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 366 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 367 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 368 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 369 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 370 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 371 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 372 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 373 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 374 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 375 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 376 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 377 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 378 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 379 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 380 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 381 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 382 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 383 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 384 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 385 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 386 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 387 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 388 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 389 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 390 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 391 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 392 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 393 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 394 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 395 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 396 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 397 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 398 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 399 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 400 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 401 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 402 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 403 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 404 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 405 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 406 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 407 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 408 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 409 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 410 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 411 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 412 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 413 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 414 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 415 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 416 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 417 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 418 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 419 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 420 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 421 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 422 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 423 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 424 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 425 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 426 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 427 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 428 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 429 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 430 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 431 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 432 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 433 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 434 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 435 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 436 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 437 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 438 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 439 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 440 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 441 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 442 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 443 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 73.28 |
| Metatranscriptomes | 0.31 |
| Isolates | 26.41 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.09 |
| Nodule | 25.94 |
| Rhizoplane | 1.88 |
| Rhizosphere | 70 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0182005_1031458 | 3300015265 | Bacteria | 1446 |
| 2 | JGI24752J21851_1005054 | 3300001976 | Bacteria | 1726 |
| 3 | JGI24737J22298_10045781 | 3300001990 | Bacteria | 1336 |
| 4 | JGI24743J22301_10008908 | 3300001991 | Bacteria | 1770 |
| 5 | JGI24748J21848_1003367 | 3300002074 | Bacteria | 1825 |
| 6 | JGI24749J21850_1001329 | 3300002076 | Bacteria | 3504 |
| 7 | JGI24744J21845_10010718 | 3300002077 | Bacteria | 1876 |
| 8 | JGI24742J22300_10044733 | 3300002244 | Bacteria | 794 |
| 9 | Ga0055529_1026157 | 3300003763 | Bacteria | 720 |
| 10 | Ga0065165_1003711 | 3300005262 | Bacteria | 10329 |
| 11 | Ga0065712_10540831 | 3300005290 | Bacteria | 621 |
| 12 | Ga0070658_10104267 | 3300005327 | Bacteria | 2346 |
| 13 | Ga0070676_10016431 | 3300005328 | Bacteria | 4092 |
| 14 | Ga0070676_10062888 | 3300005328 | Bacteria | 2210 |
| 15 | Ga0070676_10245112 | 3300005328 | Bacteria | 1193 |
| 16 | Ga0070683_100019617 | 3300005329 | Bacteria | 6007 |
| 17 | Ga0070683_100189909 | 3300005329 | Bacteria | 1950 |
| 18 | Ga0070690_100152768 | 3300005330 | Bacteria | 1576 |
| 19 | Ga0070690_100156452 | 3300005330 | Bacteria | 1558 |
| 20 | Ga0070670_100006947 | 3300005331 | Bacteria | 9594 |
| 21 | Ga0070670_100058116 | 3300005331 | Bacteria | 3320 |
| 22 | Ga0070670_100255945 | 3300005331 | Bacteria | 1525 |
| 23 | Ga0070670_100637166 | 3300005331 | Bacteria | 956 |
| 24 | Ga0070670_100902906 | 3300005331 | Bacteria | 801 |
| 25 | Ga0070677_10002830 | 3300005333 | Bacteria | 5560 |
| 26 | Ga0068869_100027285 | 3300005334 | Bacteria | 3980 |
| 27 | Ga0068869_100095733 | 3300005334 | Bacteria | 2240 |
| 28 | Ga0068869_100468044 | 3300005334 | Bacteria | 1047 |
| 29 | Ga0070680_100718791 | 3300005336 | Bacteria | 860 |
| 30 | Ga0068868_100368109 | 3300005338 | Bacteria | 1234 |
| 31 | Ga0070660_100499463 | 3300005339 | Bacteria | 1012 |
| 32 | Ga0070689_100015051 | 3300005340 | Bacteria | 5633 |
| 33 | Ga0070687_100093941 | 3300005343 | Bacteria | 1665 |
| 34 | Ga0070661_100013384 | 3300005344 | Bacteria | 5758 |
| 35 | Ga0070661_100074158 | 3300005344 | Bacteria | 2505 |
| 36 | Ga0070661_100266817 | 3300005344 | Bacteria | 1325 |
| 37 | Ga0070668_100604830 | 3300005347 | Bacteria | 959 |
| 38 | Ga0070669_100051391 | 3300005353 | Bacteria | 3012 |
| 39 | Ga0070669_100661514 | 3300005353 | Bacteria | 879 |
| 40 | Ga0070675_100041261 | 3300005354 | Bacteria | 3769 |
| 41 | Ga0070675_100094711 | 3300005354 | Bacteria | 2506 |
| 42 | Ga0070671_100062933 | 3300005355 | Bacteria | 3089 |
| 43 | Ga0070671_100096781 | 3300005355 | Bacteria | 2475 |
| 44 | Ga0070671_100156909 | 3300005355 | Bacteria | 1922 |
| 45 | Ga0070674_100021692 | 3300005356 | Bacteria | 4130 |
| 46 | Ga0070674_100031942 | 3300005356 | Bacteria | 3493 |
| 47 | Ga0070674_100165796 | 3300005356 | Bacteria | 1680 |
| 48 | Ga0070673_100089311 | 3300005364 | Bacteria | 2515 |
| 49 | Ga0070673_100207692 | 3300005364 | Bacteria | 1689 |
| 50 | Ga0070688_100377183 | 3300005365 | Bacteria | 1044 |
| 51 | Ga0070688_100389916 | 3300005365 | Bacteria | 1029 |
| 52 | Ga0070659_100005300 | 3300005366 | Bacteria | 9248 |
| 53 | Ga0070659_100042770 | 3300005366 | Bacteria | 3543 |
| 54 | Ga0070667_100341337 | 3300005367 | Bacteria | 1354 |
| 55 | Ga0070667_101275727 | 3300005367 | Bacteria | 688 |
| 56 | Ga0070703_10128338 | 3300005406 | Bacteria | 928 |
| 57 | Ga0070701_10015017 | 3300005438 | Bacteria | 3565 |
| 58 | Ga0070711_100160087 | 3300005439 | Bacteria | 1706 |
| 59 | Ga0070700_100038683 | 3300005441 | Bacteria | 2909 |
| 60 | Ga0070700_100038975 | 3300005441 | Bacteria | 2899 |
| 61 | Ga0070708_100019076 | 3300005445 | Bacteria | 5753 |
| 62 | Ga0070663_100012638 | 3300005455 | Bacteria | 5350 |
| 63 | Ga0070678_100986672 | 3300005456 | Bacteria | 774 |
| 64 | Ga0070662_100017354 | 3300005457 | Bacteria | 4853 |
| 65 | Ga0070662_100521937 | 3300005457 | Bacteria | 992 |
| 66 | Ga0070662_100699144 | 3300005457 | Bacteria | 858 |
| 67 | Ga0070681_10006485 | 3300005458 | Bacteria | 11387 |
| 68 | Ga0068867_100124676 | 3300005459 | Bacteria | 1994 |
| 69 | Ga0068867_100129083 | 3300005459 | Bacteria | 1963 |
| 70 | Ga0068867_100183164 | 3300005459 | Bacteria | 1666 |
| 71 | Ga0068867_100488263 | 3300005459 | Bacteria | 1056 |
| 72 | Ga0070685_10007635 | 3300005466 | Bacteria | 5535 |
| 73 | Ga0070706_100363177 | 3300005467 | Bacteria | 1349 |
| 74 | Ga0070707_100114703 | 3300005468 | Bacteria | 2614 |
| 75 | Ga0070707_100623547 | 3300005468 | Bacteria | 1041 |
| 76 | Ga0070698_100729237 | 3300005471 | Bacteria | 934 |
| 77 | Ga0070684_100042011 | 3300005535 | Bacteria | 3945 |
| 78 | Ga0070697_100001052 | 3300005536 | Bacteria | 20835 |
| 79 | Ga0068853_100045009 | 3300005539 | Bacteria | 3779 |
| 80 | Ga0070672_100052594 | 3300005543 | Bacteria | 3180 |
| 81 | Ga0070672_100192218 | 3300005543 | Bacteria | 1704 |
| 82 | Ga0070672_100377268 | 3300005543 | Bacteria | 1212 |
| 83 | Ga0070686_100200402 | 3300005544 | Bacteria | 1430 |
| 84 | Ga0070693_100083483 | 3300005547 | Bacteria | 1910 |
| 85 | Ga0070665_100125484 | 3300005548 | Bacteria | 2569 |
| 86 | Ga0070704_100328421 | 3300005549 | Bacteria | 1284 |
| 87 | Ga0068855_100157348 | 3300005563 | Bacteria | 2581 |
| 88 | Ga0070664_100045617 | 3300005564 | Bacteria | 3702 |
| 89 | Ga0068857_100033561 | 3300005577 | Bacteria | 4539 |
| 90 | Ga0068854_100062515 | 3300005578 | Bacteria | 2699 |
| 91 | Ga0068854_100733413 | 3300005578 | Bacteria | 856 |
| 92 | Ga0068856_100275528 | 3300005614 | Bacteria | 1699 |
| 93 | Ga0068852_100066781 | 3300005616 | Bacteria | 3142 |
| 94 | Ga0068852_100183587 | 3300005616 | Bacteria | 1968 |
| 95 | Ga0068859_100282552 | 3300005617 | Bacteria | 1752 |
| 96 | Ga0068859_100714279 | 3300005617 | Bacteria | 1092 |
| 97 | Ga0068864_100010838 | 3300005618 | Bacteria | 7534 |
| 98 | Ga0068864_100054081 | 3300005618 | Bacteria | 3464 |
| 99 | Ga0068864_100282178 | 3300005618 | Bacteria | 1550 |
| 100 | Ga0068866_10000718 | 3300005718 | Bacteria | 15043 |
| 101 | Ga0068866_10470586 | 3300005718 | Bacteria | 826 |
| 102 | Ga0068851_10008199 | 3300005834 | Bacteria | 4822 |
| 103 | Ga0068851_10060950 | 3300005834 | Bacteria | 1933 |
| 104 | Ga0068870_10009253 | 3300005840 | Bacteria | 4473 |
| 105 | Ga0068870_10203884 | 3300005840 | Bacteria | 1201 |
| 106 | Ga0068863_100170636 | 3300005841 | Bacteria | 2086 |
| 107 | Ga0068863_101093223 | 3300005841 | Bacteria | 802 |
| 108 | Ga0068858_100147608 | 3300005842 | Bacteria | 2209 |
| 109 | Ga0068860_100031554 | 3300005843 | Bacteria | 5093 |
| 110 | Ga0068862_100133557 | 3300005844 | Bacteria | 2197 |
| 111 | Ga0081539_10000123 | 3300005985 | Bacteria | 181245 |
| 112 | Ga0070716_100019444 | 3300006173 | Bacteria | 3550 |
| 113 | Ga0097621_100058776 | 3300006237 | Bacteria | 3146 |
| 114 | Ga0097621_100165022 | 3300006237 | Bacteria | 1906 |
| 115 | Ga0097621_100266379 | 3300006237 | Bacteria | 1504 |
| 116 | Ga0068871_100011876 | 3300006358 | Bacteria | 6407 |
| 117 | Ga0075428_100004637 | 3300006844 | Bacteria | 15209 |
| 118 | Ga0075428_100024116 | 3300006844 | Bacteria | 6730 |
| 119 | Ga0075430_100546030 | 3300006846 | Bacteria | 956 |
| 120 | Ga0075430_100557625 | 3300006846 | Bacteria | 945 |
| 121 | Ga0075430_100559792 | 3300006846 | Bacteria | 943 |
| 122 | Ga0075431_100144371 | 3300006847 | Bacteria | 2453 |
| 123 | Ga0075431_100227241 | 3300006847 | Bacteria | 1902 |
| 124 | Ga0075434_100611132 | 3300006871 | Bacteria | 1109 |
| 125 | Ga0075429_100290780 | 3300006880 | Bacteria | 1431 |
| 126 | Ga0075429_101123624 | 3300006880 | Bacteria | 686 |
| 127 | Ga0068865_100455617 | 3300006881 | Bacteria | 1058 |
| 128 | Ga0097620_100282551 | 3300006931 | Bacteria | 1752 |
| 129 | Ga0097620_100714254 | 3300006931 | Bacteria | 1092 |
| 130 | Ga0079104_1003142 | 3300006946 | Bacteria | 8020 |
| 131 | Ga0075435_100294966 | 3300007076 | Bacteria | 1386 |
| 132 | Ga0099794_10153573 | 3300007265 | Bacteria | 1169 |
| 133 | Ga0099794_10170943 | 3300007265 | Bacteria | 1108 |
| 134 | Ga0105240_10180520 | 3300009093 | Bacteria | 2491 |
| 135 | Ga0105240_10266942 | 3300009093 | Bacteria | 1972 |
| 136 | Ga0111539_10001294 | 3300009094 | Bacteria | 33400 |
| 137 | Ga0111539_10071210 | 3300009094 | Bacteria | 4103 |
| 138 | Ga0111539_10124118 | 3300009094 | Bacteria | 3026 |
| 139 | Ga0105245_10122598 | 3300009098 | Bacteria | 2430 |
| 140 | Ga0105245_10147018 | 3300009098 | Bacteria | 2224 |
| 141 | Ga0105247_10208351 | 3300009101 | Bacteria | 1317 |
| 142 | Ga0114129_10442176 | 3300009147 | Bacteria | 1707 |
| 143 | Ga0114129_10468026 | 3300009147 | Bacteria | 1651 |
| 144 | Ga0105243_10495533 | 3300009148 | Bacteria | 1156 |
| 145 | Ga0105241_10283727 | 3300009174 | Bacteria | 1415 |
| 146 | Ga0105242_10042076 | 3300009176 | Bacteria | 3687 |
| 147 | Ga0105242_10070407 | 3300009176 | Bacteria | 2900 |
| 148 | Ga0105242_10146645 | 3300009176 | Bacteria | 2053 |
| 149 | Ga0105248_10379941 | 3300009177 | Bacteria | 1590 |
| 150 | Ga0105249_10081235 | 3300009553 | Bacteria | 3013 |
| 151 | Ga0105239_10438895 | 3300010375 | Bacteria | 1480 |
| 152 | Ga0105246_10147094 | 3300011119 | Bacteria | 1779 |
| 153 | Ga0157371_10048062 | 3300013102 | Bacteria | 3033 |
| 154 | Ga0157370_10025847 | 3300013104 | Bacteria | 5808 |
| 155 | Ga0157370_10034719 | 3300013104 | Bacteria | 4907 |
| 156 | Ga0157374_10044777 | 3300013296 | Bacteria | 4091 |
| 157 | Ga0157374_10613692 | 3300013296 | Bacteria | 1098 |
| 158 | Ga0157378_10026505 | 3300013297 | Bacteria | 5110 |
| 159 | Ga0157378_10044702 | 3300013297 | Bacteria | 3934 |
| 160 | Ga0157378_10087523 | 3300013297 | Bacteria | 2826 |
| 161 | Ga0163162_10210261 | 3300013306 | Bacteria | 2075 |
| 162 | Ga0163162_10557141 | 3300013306 | Bacteria | 1274 |
| 163 | Ga0163162_10563974 | 3300013306 | Bacteria | 1266 |
| 164 | Ga0157372_10297717 | 3300013307 | Bacteria | 1876 |
| 165 | Ga0157375_10051026 | 3300013308 | Bacteria | 4060 |
| 166 | Ga0163163_10027693 | 3300014325 | Bacteria | 5433 |
| 167 | Ga0163163_10091811 | 3300014325 | Bacteria | 3051 |
| 168 | Ga0157380_10108016 | 3300014326 | Bacteria | 2332 |
| 169 | Ga0157380_10175905 | 3300014326 | Bacteria | 1875 |
| 170 | Ga0157377_10024961 | 3300014745 | Bacteria | 3183 |
| 171 | Ga0157379_10047477 | 3300014968 | Bacteria | 3830 |
| 172 | Ga0157379_11051143 | 3300014968 | Bacteria | 778 |
| 173 | Ga0157376_10022565 | 3300014969 | Bacteria | 4910 |
| 174 | Ga0157376_10055653 | 3300014969 | Bacteria | 3301 |
| 175 | Ga0157376_10101057 | 3300014969 | Bacteria | 2519 |
| 176 | Ga0182005_1102881 | 3300015265 | Bacteria | 802 |
| 177 | Ga0163161_10111550 | 3300017792 | Bacteria | 2045 |
| 178 | Ga0163161_10175443 | 3300017792 | Bacteria | 1641 |
| 179 | Ga0154015_1362810 | 3300020610 | Bacteria | 782 |
| 180 | Ga0209148_1001096 | 3300025254 | Bacteria | 16299 |
| 181 | Ga0207666_1000888 | 3300025271 | Bacteria | 3585 |
| 182 | Ga0209455_1000236 | 3300025272 | Bacteria | 69542 |
| 183 | Ga0207673_1004643 | 3300025290 | Bacteria | 1649 |
| 184 | Ga0207697_10002189 | 3300025315 | Bacteria | 10219 |
| 185 | Ga0207697_10216085 | 3300025315 | Bacteria | 845 |
| 186 | Ga0207656_10210016 | 3300025321 | Bacteria | 943 |
| 187 | Ga0207682_10001161 | 3300025893 | Bacteria | 12213 |
| 188 | Ga0207642_10047884 | 3300025899 | Bacteria | 1913 |
| 189 | Ga0207710_10208443 | 3300025900 | Bacteria | 967 |
| 190 | Ga0207688_10002993 | 3300025901 | Bacteria | 9201 |
| 191 | Ga0207688_10067047 | 3300025901 | Bacteria | 2031 |
| 192 | Ga0207688_10101303 | 3300025901 | Bacteria | 1663 |
| 193 | Ga0207680_10080938 | 3300025903 | Bacteria | 2040 |
| 194 | Ga0207680_10153001 | 3300025903 | Bacteria | 1539 |
| 195 | Ga0207680_10176249 | 3300025903 | Bacteria | 1443 |
| 196 | Ga0207647_10099220 | 3300025904 | Bacteria | 1730 |
| 197 | Ga0207645_10010868 | 3300025907 | Bacteria | 6238 |
| 198 | Ga0207645_10044263 | 3300025907 | Bacteria | 2849 |
| 199 | Ga0207645_10221116 | 3300025907 | Bacteria | 1248 |
| 200 | Ga0207643_10026528 | 3300025908 | Bacteria | 3207 |
| 201 | Ga0207643_10042187 | 3300025908 | Bacteria | 2571 |
| 202 | Ga0207705_10377732 | 3300025909 | Bacteria | 1094 |
| 203 | Ga0207707_10009251 | 3300025912 | Bacteria | 8549 |
| 204 | Ga0207707_10201759 | 3300025912 | Bacteria | 1734 |
| 205 | Ga0207695_10178881 | 3300025913 | Bacteria | 2043 |
| 206 | Ga0207660_10214871 | 3300025917 | Bacteria | 1507 |
| 207 | Ga0207660_10555655 | 3300025917 | Bacteria | 934 |
| 208 | Ga0207662_10029193 | 3300025918 | Bacteria | 3194 |
| 209 | Ga0207662_10039817 | 3300025918 | Bacteria | 2759 |
| 210 | Ga0207657_10023950 | 3300025919 | Bacteria | 5668 |
| 211 | Ga0207657_10473578 | 3300025919 | Bacteria | 982 |
| 212 | Ga0207657_10729459 | 3300025919 | Bacteria | 768 |
| 213 | Ga0207649_10019012 | 3300025920 | Bacteria | 3921 |
| 214 | Ga0207681_10041650 | 3300025923 | Bacteria | 3063 |
| 215 | Ga0207650_10002813 | 3300025925 | Bacteria | 12015 |
| 216 | Ga0207650_10006817 | 3300025925 | Bacteria | 7791 |
| 217 | Ga0207650_10322936 | 3300025925 | Bacteria | 1264 |
| 218 | Ga0207650_10777559 | 3300025925 | Bacteria | 811 |
| 219 | Ga0207659_10023318 | 3300025926 | Bacteria | 4128 |
| 220 | Ga0207659_10045268 | 3300025926 | Bacteria | 3101 |
| 221 | Ga0207659_10414954 | 3300025926 | Bacteria | 1128 |
| 222 | Ga0207687_10942116 | 3300025927 | Bacteria | 740 |
| 223 | Ga0207644_10026240 | 3300025931 | Bacteria | 4012 |
| 224 | Ga0207644_10044486 | 3300025931 | Bacteria | 3154 |
| 225 | Ga0207644_10048807 | 3300025931 | Bacteria | 3028 |
| 226 | Ga0207690_10026834 | 3300025932 | Bacteria | 3632 |
| 227 | Ga0207690_10029263 | 3300025932 | Bacteria | 3500 |
| 228 | Ga0207690_10352775 | 3300025932 | Bacteria | 1163 |
| 229 | Ga0207706_10038070 | 3300025933 | Bacteria | 4267 |
| 230 | Ga0207706_10132642 | 3300025933 | Bacteria | 2191 |
| 231 | Ga0207686_10128682 | 3300025934 | Bacteria | 1734 |
| 232 | Ga0207709_10118976 | 3300025935 | Bacteria | 1780 |
| 233 | Ga0207709_10271140 | 3300025935 | Bacteria | 1249 |
| 234 | Ga0207670_10112545 | 3300025936 | Bacteria | 1964 |
| 235 | Ga0207669_10003224 | 3300025937 | Bacteria | 7051 |
| 236 | Ga0207669_10067000 | 3300025937 | Bacteria | 2235 |
| 237 | Ga0207704_10026694 | 3300025938 | Bacteria | 3172 |
| 238 | Ga0207704_10148569 | 3300025938 | Bacteria | 1650 |
| 239 | Ga0207665_10004112 | 3300025939 | Bacteria | 9702 |
| 240 | Ga0207665_10248223 | 3300025939 | Bacteria | 1314 |
| 241 | Ga0207691_10020408 | 3300025940 | Bacteria | 6263 |
| 242 | Ga0207691_10033134 | 3300025940 | Bacteria | 4811 |
| 243 | Ga0207691_10050441 | 3300025940 | Bacteria | 3810 |
| 244 | Ga0207691_10201046 | 3300025940 | Bacteria | 1734 |
| 245 | Ga0207711_10060761 | 3300025941 | Bacteria | 3257 |
| 246 | Ga0207711_10303505 | 3300025941 | Bacteria | 1473 |
| 247 | Ga0207711_10321403 | 3300025941 | Bacteria | 1430 |
| 248 | Ga0207711_10743209 | 3300025941 | Bacteria | 914 |
| 249 | Ga0207689_10002000 | 3300025942 | Bacteria | 19245 |
| 250 | Ga0207689_10024322 | 3300025942 | Bacteria | 5083 |
| 251 | Ga0207689_10096912 | 3300025942 | Bacteria | 2422 |
| 252 | Ga0207661_10131282 | 3300025944 | Bacteria | 2146 |
| 253 | Ga0207679_10054985 | 3300025945 | Bacteria | 2933 |
| 254 | Ga0207679_11041986 | 3300025945 | Bacteria | 750 |
| 255 | Ga0207651_10017051 | 3300025960 | Bacteria | 4278 |
| 256 | Ga0207651_10019462 | 3300025960 | Bacteria | 4069 |
| 257 | Ga0207712_10151874 | 3300025961 | Bacteria | 1790 |
| 258 | Ga0207712_10269198 | 3300025961 | Bacteria | 1385 |
| 259 | Ga0207640_10047369 | 3300025981 | Bacteria | 2772 |
| 260 | Ga0207640_10077477 | 3300025981 | Bacteria | 2260 |
| 261 | Ga0207640_10301198 | 3300025981 | Bacteria | 1268 |
| 262 | Ga0207658_11020986 | 3300025986 | Bacteria | 755 |
| 263 | Ga0207677_10070838 | 3300026023 | Bacteria | 2459 |
| 264 | Ga0207677_10849615 | 3300026023 | Bacteria | 820 |
| 265 | Ga0207703_10206557 | 3300026035 | Bacteria | 1748 |
| 266 | Ga0207703_10559105 | 3300026035 | Bacteria | 1079 |
| 267 | Ga0207639_11543170 | 3300026041 | Bacteria | 623 |
| 268 | Ga0207678_10024982 | 3300026067 | Bacteria | 5218 |
| 269 | Ga0207678_10829172 | 3300026067 | Bacteria | 817 |
| 270 | Ga0207708_10001525 | 3300026075 | Bacteria | 17268 |
| 271 | Ga0207708_10089617 | 3300026075 | Bacteria | 2371 |
| 272 | Ga0207702_10409490 | 3300026078 | Bacteria | 1309 |
| 273 | Ga0207641_10072218 | 3300026088 | Bacteria | 2971 |
| 274 | Ga0207641_10994010 | 3300026088 | Bacteria | 835 |
| 275 | Ga0207648_10002413 | 3300026089 | Bacteria | 20119 |
| 276 | Ga0207648_10010715 | 3300026089 | Bacteria | 8664 |
| 277 | Ga0207648_10047258 | 3300026089 | Bacteria | 3773 |
| 278 | Ga0207648_10108344 | 3300026089 | Bacteria | 2439 |
| 279 | Ga0207648_10177214 | 3300026089 | Bacteria | 1886 |
| 280 | Ga0207676_10003738 | 3300026095 | Bacteria | 10765 |
| 281 | Ga0207676_10033741 | 3300026095 | Bacteria | 3869 |
| 282 | Ga0207676_10060785 | 3300026095 | Bacteria | 2990 |
| 283 | Ga0207676_10459048 | 3300026095 | Bacteria | 1202 |
| 284 | Ga0207674_10012605 | 3300026116 | Bacteria | 9448 |
| 285 | Ga0207674_10256326 | 3300026116 | Bacteria | 1696 |
| 286 | Ga0207675_100002195 | 3300026118 | Bacteria | 19391 |
| 287 | Ga0207675_100060323 | 3300026118 | Bacteria | 3541 |
| 288 | Ga0207683_10009151 | 3300026121 | Bacteria | 8438 |
| 289 | Ga0207683_10029270 | 3300026121 | Bacteria | 4768 |
| 290 | Ga0207683_10240678 | 3300026121 | Bacteria | 1651 |
| 291 | Ga0207698_10051107 | 3300026142 | Bacteria | 3158 |
| 292 | Ga0207698_10130666 | 3300026142 | Bacteria | 2145 |
| 293 | Ga0209281_1000185 | 3300027111 | Bacteria | 144489 |
| 294 | Ga0209588_1097255 | 3300027671 | Bacteria | 948 |
| 295 | Ga0207428_10003119 | 3300027907 | Bacteria | 16270 |
| 296 | Ga0207428_10536873 | 3300027907 | Bacteria | 847 |
| 297 | Ga0268266_10778906 | 3300028379 | Bacteria | 923 |
| 298 | Ga0268265_10224128 | 3300028380 | Bacteria | 1647 |
| 299 | Ga0265339_10078292 | 3300031249 | Bacteria | 1750 |
| 300 | Ga0265331_10001701 | 3300031250 | Bacteria | 15865 |
| 301 | Ga0265313_10001910 | 3300031595 | Bacteria | 18906 |
| 302 | Ga0265342_10028193 | 3300031712 | Bacteria | 3501 |
| 303 | Ga0307405_10141375 | 3300031731 | Bacteria | 1679 |
| 304 | Ga0307413_10655439 | 3300031824 | Bacteria | 866 |
| 305 | Ga0307410_10193575 | 3300031852 | Bacteria | 1548 |
| 306 | Ga0307410_11146963 | 3300031852 | Bacteria | 675 |
| 307 | Ga0307406_10474366 | 3300031901 | Bacteria | 1009 |
| 308 | Ga0307416_100616997 | 3300032002 | Bacteria | 1166 |
| 309 | Ga0307414_10015934 | 3300032004 | Bacteria | 4554 |
| 310 | Ga0373949_0039774 | 3300035090 | Bacteria | 1152 |
| 311 | Ga0373954_0466173 | 3300035118 | Bacteria | 626 |
| 312 | Ga0373946_0214715 | 3300035171 | Bacteria | 927 |
| 313 | Ga0373961_0207116 | 3300035241 | Bacteria | 694 |
| 314 | Ga0373924_0196720 | 3300035410 | Bacteria | 889 |
| 315 | Ga0373931_0076086 | 3300035691 | Bacteria | 1843 |
| 316 | Ga0373925_0232061 | 3300037068 | Bacteria | 1476 |
| 317 | Ga0373925_0248963 | 3300037068 | Bacteria | 1425 |
| 318 | Ga0395900_0771018 | 3300037418 | Bacteria | 891 |
| 319 | Ga0395901_0262887 | 3300038443 | Bacteria | 1796 |
| 320 | Ga0436365_1634399 | 3300039437 | Bacteria | 1252 |
| 321 | Ga0436361_0054625 | 3300039447 | Bacteria | 1830 |
| 322 | Ga0439449_0009101 | 3300042007 | Bacteria | 3766 |
| 323 | Ga0451576_0108295 | 3300045051 | Bacteria | 2891 |
| 324 | Ga0451576_0636327 | 3300045051 | Bacteria | 1121 |
| 325 | Ga0451576_1430168 | 3300045051 | Bacteria | 719 |
| 326 | Ga0466967_1021876 | 3300045976 | Bacteria | 823 |
| 327 | Ga0495627_050704 | 3300046453 | Bacteria | 1250 |
| 328 | Ga0495603_0036094 | 3300046455 | Bacteria | 2967 |
| 329 | Ga0495591_002414 | 3300046458 | Bacteria | 10411 |
| 330 | Ga0495591_022973 | 3300046458 | Bacteria | 2007 |
| 331 | Ga0495629_0179917 | 3300046459 | Bacteria | 1466 |
| 332 | Ga0495629_0453934 | 3300046459 | Bacteria | 867 |
| 333 | Ga0495582_0016423 | 3300046473 | Bacteria | 4056 |
| 334 | Ga0495605_0006197 | 3300046474 | Bacteria | 6899 |
| 335 | Ga0495605_0166953 | 3300046474 | Bacteria | 974 |
| 336 | Ga0495584_0002448 | 3300046491 | Bacteria | 10526 |
| 337 | Ga0495584_0079320 | 3300046491 | Bacteria | 1651 |
| 338 | Ga0495584_0079809 | 3300046491 | Bacteria | 1646 |
| 339 | Ga0495585_0001749 | 3300046492 | Bacteria | 16550 |
| 340 | Ga0495585_0020956 | 3300046492 | Bacteria | 3755 |
| 341 | Ga0495594_0398008 | 3300046499 | Bacteria | 783 |
| 342 | Ga0495596_0004882 | 3300046500 | Bacteria | 6433 |
| 343 | Ga0495596_0050374 | 3300046500 | Bacteria | 1631 |
| 344 | Ga0495607_0019497 | 3300046501 | Bacteria | 4306 |
| 345 | Ga0495607_0060993 | 3300046501 | Bacteria | 2144 |
| 346 | Ga0495607_0229135 | 3300046501 | Bacteria | 904 |
| 347 | Ga0495583_0002935 | 3300046506 | Bacteria | 13742 |
| 348 | Ga0495583_0095684 | 3300046506 | Bacteria | 1273 |
| 349 | Ga0495606_0038835 | 3300046507 | Bacteria | 3216 |
| 350 | Ga0495606_0166465 | 3300046507 | Bacteria | 1282 |
| 351 | Ga0495606_0310960 | 3300046507 | Bacteria | 850 |
| 352 | Ga0495610_0006047 | 3300046512 | Bacteria | 8447 |
| 353 | Ga0495610_0185734 | 3300046512 | Bacteria | 861 |
| 354 | Ga0495616_0056664 | 3300046513 | Bacteria | 1934 |
| 355 | Ga0495616_0067256 | 3300046513 | Bacteria | 1742 |
| 356 | Ga0495616_0072899 | 3300046513 | Bacteria | 1657 |
| 357 | Ga0495616_0230273 | 3300046513 | Bacteria | 803 |
| 358 | Ga0495620_0179077 | 3300046515 | Bacteria | 820 |
| 359 | Ga0495631_0002278 | 3300046518 | Bacteria | 10987 |
| 360 | Ga0495631_0031624 | 3300046518 | Bacteria | 2391 |
| 361 | Ga0495631_0043968 | 3300046518 | Bacteria | 1969 |
| 362 | Ga0495632_0111599 | 3300046519 | Bacteria | 1283 |
| 363 | Ga0495637_0001501 | 3300046520 | Bacteria | 13679 |
| 364 | Ga0495637_0132809 | 3300046520 | Bacteria | 949 |
| 365 | Ga0495643_0003683 | 3300046522 | Bacteria | 11112 |
| 366 | Ga0495643_0004252 | 3300046522 | Bacteria | 10109 |
| 367 | Ga0495643_0133487 | 3300046522 | Bacteria | 1244 |
| 368 | Ga0495644_0105888 | 3300046523 | Bacteria | 1065 |
| 369 | Ga0495648_0018792 | 3300046524 | Bacteria | 4878 |
| 370 | Ga0495648_0136378 | 3300046524 | Bacteria | 1297 |
| 371 | Ga0495648_0219024 | 3300046524 | Bacteria | 940 |
| 372 | Ga0495642_0015559 | 3300046528 | Bacteria | 2958 |
| 373 | Ga0495642_0016073 | 3300046528 | Bacteria | 2913 |
| 374 | Ga0495665_0017875 | 3300046531 | Bacteria | 3811 |
| 375 | Ga0495598_0007048 | 3300046537 | Bacteria | 2562 |
| 376 | Ga0495609_0004890 | 3300046538 | Bacteria | 7204 |
| 377 | Ga0495609_0022748 | 3300046538 | Bacteria | 2887 |
| 378 | Ga0495621_0030647 | 3300046539 | Bacteria | 1840 |
| 379 | Ga0495621_0035705 | 3300046539 | Bacteria | 1722 |
| 380 | Ga0495597_0002350 | 3300046542 | Bacteria | 12187 |
| 381 | Ga0495633_0001768 | 3300046558 | Bacteria | 16030 |
| 382 | Ga0495633_0003584 | 3300046558 | Bacteria | 10269 |
| 383 | Ga0495633_0103155 | 3300046558 | Bacteria | 1323 |
| 384 | Ga0495668_0101765 | 3300046616 | Bacteria | 1571 |
| 385 | Ga0495668_0127076 | 3300046616 | Bacteria | 1395 |
| 386 | Ga0495668_0292584 | 3300046616 | Bacteria | 892 |
| 387 | Ga0495611_0020106 | 3300046648 | Bacteria | 2872 |
| 388 | Ga0495611_0105341 | 3300046648 | Bacteria | 1311 |
| 389 | Ga0495611_0113749 | 3300046648 | Bacteria | 1260 |
| 390 | Ga0495625_0206081 | 3300046660 | Bacteria | 1295 |
| 391 | Ga0495661_0005995 | 3300046665 | Bacteria | 8579 |
| 392 | Ga0495661_0023971 | 3300046665 | Bacteria | 3954 |
| 393 | Ga0495588_0283627 | 3300046674 | Bacteria | 873 |
| 394 | Ga0495623_0168188 | 3300046679 | Bacteria | 1283 |
| 395 | Ga0495669_0009132 | 3300046684 | Bacteria | 4178 |
| 396 | Ga0495669_0011285 | 3300046684 | Bacteria | 3792 |
| 397 | Ga0495669_0248718 | 3300046684 | Bacteria | 854 |
| 398 | Ga0495670_0001829 | 3300046691 | Bacteria | 10457 |
| 399 | Ga0495670_0268273 | 3300046691 | Bacteria | 911 |
| 400 | Ga0495670_0306495 | 3300046691 | Bacteria | 851 |
| 401 | Ga0495649_0003510 | 3300046694 | Bacteria | 10558 |
| 402 | Ga0495649_0086286 | 3300046694 | Bacteria | 1675 |
| 403 | Ga0495589_0021409 | 3300046794 | Bacteria | 3304 |
| 404 | Ga0495589_0108405 | 3300046794 | Bacteria | 1341 |
| 405 | Ga0495589_0115390 | 3300046794 | Bacteria | 1294 |
| 406 | Ga0495660_0046735 | 3300046810 | Bacteria | 2373 |
| 407 | Ga0495660_0086272 | 3300046810 | Bacteria | 1638 |
| 408 | Ga0495660_0094627 | 3300046810 | Bacteria | 1546 |
| 409 | Ga0495581_0087675 | 3300047315 | Bacteria | 1804 |
| 410 | Ga0495672_0003402 | 3300047320 | Bacteria | 13658 |
| 411 | Ga0495672_0005177 | 3300047320 | Bacteria | 10406 |
| 412 | Ga0495683_0001729 | 3300047323 | Bacteria | 13823 |
| 413 | Ga0495683_0012586 | 3300047323 | Bacteria | 4442 |
| 414 | Ga0495683_0226372 | 3300047323 | Bacteria | 831 |
| 415 | Ga0495677_0001217 | 3300047445 | Bacteria | 10305 |
| 416 | Ga0495677_0002706 | 3300047445 | Bacteria | 6925 |
| 417 | Ga0495677_0012869 | 3300047445 | Bacteria | 3047 |
| 418 | Ga0495677_0048298 | 3300047445 | Bacteria | 1563 |
| 419 | Ga0495679_027749 | 3300047446 | Bacteria | 1863 |
| 420 | Ga0495679_041794 | 3300047446 | Bacteria | 1417 |
| 421 | Ga0495685_000764 | 3300047447 | Bacteria | 9829 |
| 422 | Ga0495685_060323 | 3300047447 | Bacteria | 1279 |
| 423 | Ga0495681_0003858 | 3300047470 | Bacteria | 10364 |
| 424 | Ga0495681_0131323 | 3300047470 | Bacteria | 1065 |
| 425 | Ga0495686_0007559 | 3300047472 | Bacteria | 8128 |
| 426 | Ga0495593_0113958 | 3300047673 | Bacteria | 1379 |
| 427 | Ga0495614_0013584 | 3300048089 | Bacteria | 3570 |
| 428 | Ga0495626_0019658 | 3300048091 | Bacteria | 3375 |
| 429 | Ga0495626_0031282 | 3300048091 | Bacteria | 2562 |
| 430 | Ga0496101_0024851 | 3300048904 | Bacteria | 4152 |
| 431 | Ga0496102_0131818 | 3300048905 | Bacteria | 2340 |
| 432 | Ga0496104_0051577 | 3300048907 | Bacteria | 3883 |
| 433 | Ga0496106_0079311 | 3300048909 | Bacteria | 2520 |
| 434 | Ga0496107_0052602 | 3300048910 | Bacteria | 2937 |
| 435 | Ga0496107_0295948 | 3300048910 | Bacteria | 1205 |
| 436 | Ga0496109_0038809 | 3300048912 | Bacteria | 4307 |
| 437 | Ga0496109_0185969 | 3300048912 | Bacteria | 1952 |
| 438 | Ga0496110_0034272 | 3300048913 | Bacteria | 4397 |
| 439 | Ga0496110_0536063 | 3300048913 | Bacteria | 1064 |
| 440 | Ga0496114_0031768 | 3300048917 | Bacteria | 4344 |
| 441 | Ga0496114_0886406 | 3300048917 | Bacteria | 773 |
| 442 | Ga0496124_0129929 | 3300048927 | Bacteria | 2002 |
| 443 | Ga0496124_0190304 | 3300048927 | Bacteria | 1571 |
| 444 | Ga0495678_002197 | 3300049459 | Bacteria | 13677 |
| 445 | Ga0495682_0176518 | 3300049460 | Bacteria | 759 |
| 446 | Ga0501041_0178290 | 3300049577 | Bacteria | 1330 |
| 447 | Ga0501067_0029724 | 3300049583 | Bacteria | 3028 |
| 448 | Ga0501072_0755004 | 3300049588 | Bacteria | 763 |
| 449 | Ga0501073_0003137 | 3300049589 | Bacteria | 12392 |
| 450 | Ga0501235_129396 | 3300049669 | Bacteria | 638 |
| 451 | nmdc:mga0k408_70295_c1 | 3300050493 | Bacteria | 2043 |
| 452 | nmdc:mga05p37_190319_c1 | 3300050507 | Bacteria | 2492 |
| 453 | nmdc:mga05p37_387281_c2 | 3300050507 | Bacteria | 650 |
| 454 | nmdc:mga0qj67_437162_c1 | 3300050509 | Bacteria | 1054 |
| 455 | nmdc:mga0qj67_605905_c1 | 3300050509 | Bacteria | 876 |
| 456 | nmdc:mga0qj67_763430_c1 | 3300050509 | Bacteria | 767 |
| 457 | nmdc:mga0qj67_891086_c1 | 3300050509 | Bacteria | 701 |
| 458 | nmdc:mga06r32_102176_c1 | 3300050510 | Bacteria | 2814 |
| 459 | nmdc:mga06r32_219179_c1 | 3300050510 | Bacteria | 1891 |
| 460 | nmdc:mga08y16_158395_c1 | 3300050511 | Bacteria | 2352 |
| 461 | nmdc:mga08y16_161147_c1 | 3300050511 | Bacteria | 2331 |
| 462 | nmdc:mga08y16_288417_c1 | 3300050511 | Bacteria | 1692 |
| 463 | nmdc:mga08y16_3082_c1 | 3300050511 | Bacteria | 17238 |
| 464 | nmdc:mga0n895_199522_c1 | 3300050512 | Bacteria | 2032 |
| 465 | nmdc:mga0rr50_181811_c1 | 3300050513 | Bacteria | 1719 |
| 466 | Ga0495601_0102346 | 3300053077 | Bacteria | 1851 |
| 467 | Ga0500647_0275238 | 3300053091 | Bacteria | 730 |
| 468 | Ga0500604_0000554 | 3300053151 | Bacteria | 10291 |
| 469 | Ga0587086_018684 | 3300059507 | Bacteria | 926 |
| 470 | Ga0501082_0344217 | 3300060353 | Bacteria | 1299 |
| 471 | Ga0530510_0004951 | 3300061734 | Bacteria | 9199 |
| 472 | 2510308229 | 2510065057 | Bacteria | 6649661 |
| 473 | 2511497177 | 2511231052 | Bacteria | 6974333 |
| 474 | 2512529644 | 2512047086 | Bacteria | 6850303 |
| 475 | 2513582653 | 2513237086 | Bacteria | 7265287 |
| 476 | 2513614705 | 2513237091 | Bacteria | 6900273 |
| 477 | 2513882222 | 2513237140 | Bacteria | 7076289 |
| 478 | 2513901841 | 2513237143 | Bacteria | 6664116 |
| 479 | 2515611766 | 2515154107 | Bacteria | 6795637 |
| 480 | 2516895592 | 2516653046 | Bacteria | 6989037 |
| 481 | 2524449427 | 2524023207 | Bacteria | 6813453 |
| 482 | 2551678935 | 2551306084 | Bacteria | 8942552 |
| 483 | 2551682173 | 2551306084 | Bacteria | 8942552 |
| 484 | 2551683487 | 2551306085 | Bacteria | 7347181 |
| 485 | 2551693089 | 2551306086 | Bacteria | 6843938 |
| 486 | 2551699525 | 2551306087 | Bacteria | 7351905 |
| 487 | 2551736930 | 2551306092 | Bacteria | 6992595 |
| 488 | 2551741065 | 2551306093 | Bacteria | 7064773 |
| 489 | 2739612108 | 2739367655 | Bacteria | 4051151 |
| 490 | 2776265895 | 2775506901 | Bacteria | 9631051 |
| 491 | 2855829594 | 2855825444 | Bacteria | 6785811 |
| 492 | 2855844690 | 2855839649 | Bacteria | 7135830 |
| 493 | 2858805846 | 2858800743 | Bacteria | 6603254 |
| 494 | 2908744722 | 2908739725 | Bacteria | 8628932 |
| 495 | 2915991496 | 2915986958 | Bacteria | 6739310 |
| 496 | 2916000569 | 2915993759 | Bacteria | 7016183 |
| 497 | 2916005162 | 2916000859 | Bacteria | 6865702 |
| 498 | 2916007692 | 2916007675 | Bacteria | 6898660 |
| 499 | 2916021201 | 2916014648 | Bacteria | 6946486 |
| 500 | 2916021904 | 2916021584 | Bacteria | 6854472 |
| 501 | 2916030899 | 2916028427 | Bacteria | 6748433 |
| 502 | 2916041042 | 2916035215 | Bacteria | 6755766 |
| 503 | 2916042253 | 2916041962 | Bacteria | 6820487 |
| 504 | 2916053427 | 2916048683 | Bacteria | 6543552 |
| 505 | 2916057173 | 2916055098 | Bacteria | 6758838 |
| 506 | 2916075663 | 2916068649 | Bacteria | 6943657 |
| 507 | 2916080258 | 2916076590 | Bacteria | 6596108 |
| 508 | 2921201691 | 2921201388 | Bacteria | 6926299 |
| 509 | 2921212381 | 2921208531 | Bacteria | 6745326 |
| 510 | 2921242075 | 2921237296 | Bacteria | 6876710 |
| 511 | 2921244805 | 2921244191 | Bacteria | 6568419 |
| 512 | 2921259219 | 2921257292 | Bacteria | 6808382 |
| 513 | 2921269851 | 2921263974 | Bacteria | 6864552 |
| 514 | 2921286761 | 2921282425 | Bacteria | 6826397 |
| 515 | 2921292310 | 2921289301 | Bacteria | 7316391 |
| 516 | 2921300857 | 2921296804 | Bacteria | 7176999 |
| 517 | 2924147907 | 2924144063 | Bacteria | 6883928 |
| 518 | 2924152792 | 2924150972 | Bacteria | 7169444 |
| 519 | 2924161942 | 2924158325 | Bacteria | 7188855 |
| 520 | 2924165779 | 2924165586 | Bacteria | 7260590 |
| 521 | 2924175627 | 2924172951 | Bacteria | 6749356 |
| 522 | 2924180451 | 2924179722 | Bacteria | 6843264 |
| 523 | 2924186737 | 2924186466 | Bacteria | 6876637 |
| 524 | 2924199392 | 2924193448 | Bacteria | 6955718 |
| 525 | 2924200772 | 2924200457 | Bacteria | 6757188 |
| 526 | 2924207395 | 2924207177 | Bacteria | 6917007 |
| 527 | 2924215589 | 2924214083 | Bacteria | 7080103 |
| 528 | 2924222544 | 2924221636 | Bacteria | 7113495 |
| 529 | 2924229112 | 2924228884 | Bacteria | 6633132 |
| 530 | 2936997080 | 2936996657 | Bacteria | 6298727 |
| 531 | 2937003236 | 2937002841 | Bacteria | 6934057 |
| 532 | 2937010085 | 2937009748 | Bacteria | 6746052 |
| 533 | 2937020521 | 2937016420 | Bacteria | 6782579 |
| 534 | 2937025403 | 2937023124 | Bacteria | 6815156 |
| 535 | 2937045219 | 2937042894 | Bacteria | 6741576 |
| 536 | 2937054254 | 2937049772 | Bacteria | 6757901 |
| 537 | 2937060300 | 2937056579 | Bacteria | 7107896 |
| 538 | 2937064162 | 2937063883 | Bacteria | 7199456 |
| 539 | 2937076894 | 2937071275 | Bacteria | 6984483 |
| 540 | 2937092557 | 2937091812 | Bacteria | 6979387 |
| 541 | 2937105013 | 2937098957 | Bacteria | 7249374 |
| 542 | 2937112971 | 2937106411 | Bacteria | 6947143 |
| 543 | 2937115665 | 2937113482 | Bacteria | 6505872 |
| 544 | 2937119856 | 2937119839 | Bacteria | 6597547 |
| 545 | 2937132546 | 2937126314 | Bacteria | 6771275 |
| 546 | 2939670525 | 2939669807 | Bacteria | 5028511 |
| 547 | 2957382510 | 2957382221 | Bacteria | 6737050 |
| 548 | 2957391723 | 2957388812 | Bacteria | 6778072 |
| 549 | 2957400182 | 2957395598 | Bacteria | 6822399 |
| 550 | 2957404044 | 2957402308 | Bacteria | 6741770 |
| 551 | 2957411430 | 2957408893 | Bacteria | 6558585 |
| 552 | 2957416454 | 2957415311 | Bacteria | 6991633 |
| 553 | 2957424847 | 2957422303 | Bacteria | 7172205 |
| 554 | 2957445772 | 2957443900 | Bacteria | 6869977 |
| 555 | 2957450871 | 2957450854 | Bacteria | 6765715 |
| 556 | 2957460306 | 2957457609 | Bacteria | 6967680 |
| 557 | 2957465448 | 2957464669 | Bacteria | 6568877 |
| 558 | 2957474463 | 2957471148 | Bacteria | 6797643 |
| 559 | 2957478884 | 2957478035 | Bacteria | 6756658 |
| 560 | 2957493425 | 2957491536 | Bacteria | 6695180 |
| 561 | 2957498484 | 2957498199 | Bacteria | 7126688 |
| 562 | 2957508946 | 2957505466 | Bacteria | 7253085 |
| 563 | 2960588088 | 2960584000 | Bacteria | 6864594 |
| 564 | 2960600046 | 2960597568 | Bacteria | 6550735 |
| 565 | 2960607373 | 2960603979 | Bacteria | 6898737 |
| 566 | 2960611183 | 2960610863 | Bacteria | 6691244 |
| 567 | 2960622541 | 2960617483 | Bacteria | 6727748 |
| 568 | 2960627568 | 2960624210 | Bacteria | 6875384 |
| 569 | 2960644225 | 2960637947 | Bacteria | 7296468 |
| 570 | 2960647374 | 2960645483 | Bacteria | 7211087 |
| 571 | 2960657112 | 2960652885 | Bacteria | 7083688 |
| 572 | 2960663929 | 2960660292 | Bacteria | 7041660 |
| 573 | 2960674021 | 2960667422 | Bacteria | 6763020 |
| 574 | 2960674460 | 2960674078 | Bacteria | 6609048 |
| 575 | 2960691807 | 2960687367 | Bacteria | 6535474 |
| 576 | 2964611853 | 2964607997 | Bacteria | 7101408 |
| 577 | 2964618602 | 2964615318 | Bacteria | 6809089 |
| 578 | 2964626652 | 2964621998 | Bacteria | 6834995 |
| 579 | 2964634807 | 2964628898 | Bacteria | 7083044 |
| 580 | 2964636307 | 2964636051 | Bacteria | 7091832 |
| 581 | 2964643194 | 2964643177 | Bacteria | 6820887 |
| 582 | 2964652454 | 2964649959 | Bacteria | 6675118 |
| 583 | 2964662160 | 2964656573 | Bacteria | 7100150 |
| 584 | 2964663819 | 2964663802 | Bacteria | 7019362 |
| 585 | 2964677927 | 2964670856 | Bacteria | 6851364 |
| 586 | 2964683542 | 2964678106 | Bacteria | 6792020 |
| 587 | 2964685144 | 2964685014 | Bacteria | 6839111 |
| 588 | 2964694253 | 2964691889 | Bacteria | 6802758 |
| 589 | 2964699095 | 2964698721 | Bacteria | 6765331 |
| 590 | 2964710905 | 2964705432 | Bacteria | 7114648 |
| 591 | 2964716573 | 2964712639 | Bacteria | 6695970 |
| 592 | 2964722726 | 2964719344 | Bacteria | 7286602 |
| 593 | 2967669912 | 2967664464 | Bacteria | 6948836 |
| 594 | 2967671588 | 2967671571 | Bacteria | 7021409 |
| 595 | 2967682936 | 2967678726 | Bacteria | 7264382 |
| 596 | 2967695573 | 2967693043 | Bacteria | 6804451 |
| 597 | 2967706092 | 2967699805 | Bacteria | 6854538 |
| 598 | 2967714245 | 2967706974 | Bacteria | 7186053 |
| 599 | 2967717540 | 2967714385 | Bacteria | 7000047 |
| 600 | 2967721593 | 2967721400 | Bacteria | 7073753 |
| 601 | 2967737224 | 2967735183 | Bacteria | 6827012 |
| 602 | 2967748367 | 2967742019 | Bacteria | 6794534 |
| 603 | 2967748988 | 2967748971 | Bacteria | 6733771 |
| 604 | 2967755739 | 2967755722 | Bacteria | 6814706 |
| 605 | 2967764588 | 2967762386 | Bacteria | 6923502 |
| 606 | 2967769635 | 2967769361 | Bacteria | 6587838 |
| 607 | 2967781793 | 2967775926 | Bacteria | 6738189 |
| 608 | 2970024000 | 2970019648 | Bacteria | 7072033 |
| 609 | 2970033667 | 2970033650 | Bacteria | 7118744 |
| 610 | 2970041488 | 2970040964 | Bacteria | 6731123 |
| 611 | 2970054495 | 2970047711 | Bacteria | 7088379 |
| 612 | 2970057645 | 2970054988 | Bacteria | 6611507 |
| 613 | 2970065711 | 2970061556 | Bacteria | 7099761 |
| 614 | 2970068844 | 2970068827 | Bacteria | 7123112 |
| 615 | 2970078200 | 2970076120 | Bacteria | 6697332 |
| 616 | 2970084275 | 2970082768 | Bacteria | 6183754 |
| 617 | 2970089388 | 2970088815 | Bacteria | 6933825 |
| 618 | 2970095782 | 2970095765 | Bacteria | 6936963 |
| 619 | 2970102694 | 2970102677 | Bacteria | 6812532 |
| 620 | 2970111155 | 2970109326 | Bacteria | 6863976 |
| 621 | 2970117708 | 2970116247 | Bacteria | 6501857 |
| 622 | 2970132072 | 2970129317 | Bacteria | 6806560 |
| 623 | 2970136242 | 2970136068 | Bacteria | 7207982 |
| 624 | 2970151945 | 2970149975 | Bacteria | 6779706 |
| 625 | 2970160838 | 2970156795 | Bacteria | 7168044 |
| 626 | 2970169038 | 2970164137 | Bacteria | 6861252 |
| 627 | 2970170979 | 2970170962 | Bacteria | 6876229 |
| 628 | 2970183349 | 2970177841 | Bacteria | 6768001 |
| 629 | 2970189475 | 2970184632 | Bacteria | 7054431 |
| 630 | 2970192043 | 2970191845 | Bacteria | 7032787 |
| 631 | 2977518336 | 2977516862 | Bacteria | 6940108 |
| 632 | 2977526348 | 2977523885 | Bacteria | 6960446 |
| 633 | 2977543074 | 2977537788 | Bacteria | 6929320 |
| 634 | 2977555968 | 2977551784 | Bacteria | 7125765 |
| 635 | 2977565848 | 2977558990 | Bacteria | 6863948 |
| 636 | 2977566269 | 2977565890 | Bacteria | 6901543 |
| 637 | 2977575448 | 2977572785 | Bacteria | 6763888 |
| 638 | 2977582347 | 2977579622 | Bacteria | 6772100 |
| 639 | 648735701 | 648276728 | Bacteria | 6968865 |
| 640 | 8003997219 | 8003992118 | Bacteria | 7266902 |
| 641 | Ga0182005_1031458 | |||
| 642 | JGI24752J21851_1005054 | |||
| 643 | JGI24737J22298_10045781 | |||
| 644 | JGI24743J22301_10008908 | |||
| 645 | JGI24748J21848_1003367 | |||
| 646 | JGI24749J21850_1001329 | |||
| 647 | JGI24744J21845_10010718 | |||
| 648 | JGI24742J22300_10044733 | |||
| 649 | Ga0055529_1026157 | |||
| 650 | Ga0065165_1003711 | |||
| 651 | Ga0065712_10540831 | |||
| 652 | Ga0070658_10104267 | |||
| 653 | Ga0070676_10016431 | |||
| 654 | Ga0070676_10062888 | |||
| 655 | Ga0070676_10245112 | |||
| 656 | Ga0070683_100019617 | |||
| 657 | Ga0070683_100189909 | |||
| 658 | Ga0070690_100152768 | |||
| 659 | Ga0070690_100156452 | |||
| 660 | Ga0070670_100006947 | |||
| 661 | Ga0070670_100058116 | |||
| 662 | Ga0070670_100255945 | |||
| 663 | Ga0070670_100637166 | |||
| 664 | Ga0070670_100902906 | |||
| 665 | Ga0070677_10002830 | |||
| 666 | Ga0068869_100027285 | |||
| 667 | Ga0068869_100095733 | |||
| 668 | Ga0068869_100468044 | |||
| 669 | Ga0070680_100718791 | |||
| 670 | Ga0068868_100368109 | |||
| 671 | Ga0070660_100499463 | |||
| 672 | Ga0070689_100015051 | |||
| 673 | Ga0070687_100093941 | |||
| 674 | Ga0070661_100013384 | |||
| 675 | Ga0070661_100074158 | |||
| 676 | Ga0070661_100266817 | |||
| 677 | Ga0070668_100604830 | |||
| 678 | Ga0070669_100051391 | |||
| 679 | Ga0070669_100661514 | |||
| 680 | Ga0070675_100041261 | |||
| 681 | Ga0070675_100094711 | |||
| 682 | Ga0070671_100062933 | |||
| 683 | Ga0070671_100096781 | |||
| 684 | Ga0070671_100156909 | |||
| 685 | Ga0070674_100021692 | |||
| 686 | Ga0070674_100031942 | |||
| 687 | Ga0070674_100165796 | |||
| 688 | Ga0070673_100089311 | |||
| 689 | Ga0070673_100207692 | |||
| 690 | Ga0070688_100377183 | |||
| 691 | Ga0070688_100389916 | |||
| 692 | Ga0070659_100005300 | |||
| 693 | Ga0070659_100042770 | |||
| 694 | Ga0070667_100341337 | |||
| 695 | Ga0070667_101275727 | |||
| 696 | Ga0070703_10128338 | |||
| 697 | Ga0070701_10015017 | |||
| 698 | Ga0070711_100160087 | |||
| 699 | Ga0070700_100038683 | |||
| 700 | Ga0070700_100038975 | |||
| 701 | Ga0070708_100019076 | |||
| 702 | Ga0070663_100012638 | |||
| 703 | Ga0070678_100986672 | |||
| 704 | Ga0070662_100017354 | |||
| 705 | Ga0070662_100521937 | |||
| 706 | Ga0070662_100699144 | |||
| 707 | Ga0070681_10006485 | |||
| 708 | Ga0068867_100124676 | |||
| 709 | Ga0068867_100129083 | |||
| 710 | Ga0068867_100183164 | |||
| 711 | Ga0068867_100488263 | |||
| 712 | Ga0070685_10007635 | |||
| 713 | Ga0070706_100363177 | |||
| 714 | Ga0070707_100114703 | |||
| 715 | Ga0070707_100623547 | |||
| 716 | Ga0070698_100729237 | |||
| 717 | Ga0070684_100042011 | |||
| 718 | Ga0070697_100001052 | |||
| 719 | Ga0068853_100045009 | |||
| 720 | Ga0070672_100052594 | |||
| 721 | Ga0070672_100192218 | |||
| 722 | Ga0070672_100377268 | |||
| 723 | Ga0070686_100200402 | |||
| 724 | Ga0070693_100083483 | |||
| 725 | Ga0070665_100125484 | |||
| 726 | Ga0070704_100328421 | |||
| 727 | Ga0068855_100157348 | |||
| 728 | Ga0070664_100045617 | |||
| 729 | Ga0068857_100033561 | |||
| 730 | Ga0068854_100062515 | |||
| 731 | Ga0068854_100733413 | |||
| 732 | Ga0068856_100275528 | |||
| 733 | Ga0068852_100066781 | |||
| 734 | Ga0068852_100183587 | |||
| 735 | Ga0068859_100282552 | |||
| 736 | Ga0068859_100714279 | |||
| 737 | Ga0068864_100010838 | |||
| 738 | Ga0068864_100054081 | |||
| 739 | Ga0068864_100282178 | |||
| 740 | Ga0068866_10000718 | |||
| 741 | Ga0068866_10470586 | |||
| 742 | Ga0068851_10008199 | |||
| 743 | Ga0068851_10060950 | |||
| 744 | Ga0068870_10009253 | |||
| 745 | Ga0068870_10203884 | |||
| 746 | Ga0068863_100170636 | |||
| 747 | Ga0068863_101093223 | |||
| 748 | Ga0068858_100147608 | |||
| 749 | Ga0068860_100031554 | |||
| 750 | Ga0068862_100133557 | |||
| 751 | Ga0081539_10000123 | |||
| 752 | Ga0070716_100019444 | |||
| 753 | Ga0097621_100058776 | |||
| 754 | Ga0097621_100165022 | |||
| 755 | Ga0097621_100266379 | |||
| 756 | Ga0068871_100011876 | |||
| 757 | Ga0075428_100004637 | |||
| 758 | Ga0075428_100024116 | |||
| 759 | Ga0075430_100546030 | |||
| 760 | Ga0075430_100557625 | |||
| 761 | Ga0075430_100559792 | |||
| 762 | Ga0075431_100144371 | |||
| 763 | Ga0075431_100227241 | |||
| 764 | Ga0075434_100611132 | |||
| 765 | Ga0075429_100290780 | |||
| 766 | Ga0075429_101123624 | |||
| 767 | Ga0068865_100455617 | |||
| 768 | Ga0097620_100282551 | |||
| 769 | Ga0097620_100714254 | |||
| 770 | Ga0079104_1003142 | |||
| 771 | Ga0075435_100294966 | |||
| 772 | Ga0099794_10153573 | |||
| 773 | Ga0099794_10170943 | |||
| 774 | Ga0105240_10180520 | |||
| 775 | Ga0105240_10266942 | |||
| 776 | Ga0111539_10001294 | |||
| 777 | Ga0111539_10071210 | |||
| 778 | Ga0111539_10124118 | |||
| 779 | Ga0105245_10122598 | |||
| 780 | Ga0105245_10147018 | |||
| 781 | Ga0105247_10208351 | |||
| 782 | Ga0114129_10442176 | |||
| 783 | Ga0114129_10468026 | |||
| 784 | Ga0105243_10495533 | |||
| 785 | Ga0105241_10283727 | |||
| 786 | Ga0105242_10042076 | |||
| 787 | Ga0105242_10070407 | |||
| 788 | Ga0105242_10146645 | |||
| 789 | Ga0105248_10379941 | |||
| 790 | Ga0105249_10081235 | |||
| 791 | Ga0105239_10438895 | |||
| 792 | Ga0105246_10147094 | |||
| 793 | Ga0157371_10048062 | |||
| 794 | Ga0157370_10025847 | |||
| 795 | Ga0157370_10034719 | |||
| 796 | Ga0157374_10044777 | |||
| 797 | Ga0157374_10613692 | |||
| 798 | Ga0157378_10026505 | |||
| 799 | Ga0157378_10044702 | |||
| 800 | Ga0157378_10087523 | |||
| 801 | Ga0163162_10210261 | |||
| 802 | Ga0163162_10557141 | |||
| 803 | Ga0163162_10563974 | |||
| 804 | Ga0157372_10297717 | |||
| 805 | Ga0157375_10051026 | |||
| 806 | Ga0163163_10027693 | |||
| 807 | Ga0163163_10091811 | |||
| 808 | Ga0157380_10108016 | |||
| 809 | Ga0157380_10175905 | |||
| 810 | Ga0157377_10024961 | |||
| 811 | Ga0157379_10047477 | |||
| 812 | Ga0157379_11051143 | |||
| 813 | Ga0157376_10022565 | |||
| 814 | Ga0157376_10055653 | |||
| 815 | Ga0157376_10101057 | |||
| 816 | Ga0182005_1102881 | |||
| 817 | Ga0163161_10111550 | |||
| 818 | Ga0163161_10175443 | |||
| 819 | Ga0154015_1362810 | |||
| 820 | Ga0209148_1001096 | |||
| 821 | Ga0207666_1000888 | |||
| 822 | Ga0209455_1000236 | |||
| 823 | Ga0207673_1004643 | |||
| 824 | Ga0207697_10002189 | |||
| 825 | Ga0207697_10216085 | |||
| 826 | Ga0207656_10210016 | |||
| 827 | Ga0207682_10001161 | |||
| 828 | Ga0207642_10047884 | |||
| 829 | Ga0207710_10208443 | |||
| 830 | Ga0207688_10002993 | |||
| 831 | Ga0207688_10067047 | |||
| 832 | Ga0207688_10101303 | |||
| 833 | Ga0207680_10080938 | |||
| 834 | Ga0207680_10153001 | |||
| 835 | Ga0207680_10176249 | |||
| 836 | Ga0207647_10099220 | |||
| 837 | Ga0207645_10010868 | |||
| 838 | Ga0207645_10044263 | |||
| 839 | Ga0207645_10221116 | |||
| 840 | Ga0207643_10026528 | |||
| 841 | Ga0207643_10042187 | |||
| 842 | Ga0207705_10377732 | |||
| 843 | Ga0207707_10009251 | |||
| 844 | Ga0207707_10201759 | |||
| 845 | Ga0207695_10178881 | |||
| 846 | Ga0207660_10214871 | |||
| 847 | Ga0207660_10555655 | |||
| 848 | Ga0207662_10029193 | |||
| 849 | Ga0207662_10039817 | |||
| 850 | Ga0207657_10023950 | |||
| 851 | Ga0207657_10473578 | |||
| 852 | Ga0207657_10729459 | |||
| 853 | Ga0207649_10019012 | |||
| 854 | Ga0207681_10041650 | |||
| 855 | Ga0207650_10002813 | |||
| 856 | Ga0207650_10006817 | |||
| 857 | Ga0207650_10322936 | |||
| 858 | Ga0207650_10777559 | |||
| 859 | Ga0207659_10023318 | |||
| 860 | Ga0207659_10045268 | |||
| 861 | Ga0207659_10414954 | |||
| 862 | Ga0207687_10942116 | |||
| 863 | Ga0207644_10026240 | |||
| 864 | Ga0207644_10044486 | |||
| 865 | Ga0207644_10048807 | |||
| 866 | Ga0207690_10026834 | |||
| 867 | Ga0207690_10029263 | |||
| 868 | Ga0207690_10352775 | |||
| 869 | Ga0207706_10038070 | |||
| 870 | Ga0207706_10132642 | |||
| 871 | Ga0207686_10128682 | |||
| 872 | Ga0207709_10118976 | |||
| 873 | Ga0207709_10271140 | |||
| 874 | Ga0207670_10112545 | |||
| 875 | Ga0207669_10003224 | |||
| 876 | Ga0207669_10067000 | |||
| 877 | Ga0207704_10026694 | |||
| 878 | Ga0207704_10148569 | |||
| 879 | Ga0207665_10004112 | |||
| 880 | Ga0207665_10248223 | |||
| 881 | Ga0207691_10020408 | |||
| 882 | Ga0207691_10033134 | |||
| 883 | Ga0207691_10050441 | |||
| 884 | Ga0207691_10201046 | |||
| 885 | Ga0207711_10060761 | |||
| 886 | Ga0207711_10303505 | |||
| 887 | Ga0207711_10321403 | |||
| 888 | Ga0207711_10743209 | |||
| 889 | Ga0207689_10002000 | |||
| 890 | Ga0207689_10024322 | |||
| 891 | Ga0207689_10096912 | |||
| 892 | Ga0207661_10131282 | |||
| 893 | Ga0207679_10054985 | |||
| 894 | Ga0207679_11041986 | |||
| 895 | Ga0207651_10017051 | |||
| 896 | Ga0207651_10019462 | |||
| 897 | Ga0207712_10151874 | |||
| 898 | Ga0207712_10269198 | |||
| 899 | Ga0207640_10047369 | |||
| 900 | Ga0207640_10077477 | |||
| 901 | Ga0207640_10301198 | |||
| 902 | Ga0207658_11020986 | |||
| 903 | Ga0207677_10070838 | |||
| 904 | Ga0207677_10849615 | |||
| 905 | Ga0207703_10206557 | |||
| 906 | Ga0207703_10559105 | |||
| 907 | Ga0207639_11543170 | |||
| 908 | Ga0207678_10024982 | |||
| 909 | Ga0207678_10829172 | |||
| 910 | Ga0207708_10001525 | |||
| 911 | Ga0207708_10089617 | |||
| 912 | Ga0207702_10409490 | |||
| 913 | Ga0207641_10072218 | |||
| 914 | Ga0207641_10994010 | |||
| 915 | Ga0207648_10002413 | |||
| 916 | Ga0207648_10010715 | |||
| 917 | Ga0207648_10047258 | |||
| 918 | Ga0207648_10108344 | |||
| 919 | Ga0207648_10177214 | |||
| 920 | Ga0207676_10003738 | |||
| 921 | Ga0207676_10033741 | |||
| 922 | Ga0207676_10060785 | |||
| 923 | Ga0207676_10459048 | |||
| 924 | Ga0207674_10012605 | |||
| 925 | Ga0207674_10256326 | |||
| 926 | Ga0207675_100002195 | |||
| 927 | Ga0207675_100060323 | |||
| 928 | Ga0207683_10009151 | |||
| 929 | Ga0207683_10029270 | |||
| 930 | Ga0207683_10240678 | |||
| 931 | Ga0207698_10051107 | |||
| 932 | Ga0207698_10130666 | |||
| 933 | Ga0209281_1000185 | |||
| 934 | Ga0209588_1097255 | |||
| 935 | Ga0207428_10003119 | |||
| 936 | Ga0207428_10536873 | |||
| 937 | Ga0268266_10778906 | |||
| 938 | Ga0268265_10224128 | |||
| 939 | Ga0265339_10078292 | |||
| 940 | Ga0265331_10001701 | |||
| 941 | Ga0265313_10001910 | |||
| 942 | Ga0265342_10028193 | |||
| 943 | Ga0307405_10141375 | |||
| 944 | Ga0307413_10655439 | |||
| 945 | Ga0307410_10193575 | |||
| 946 | Ga0307410_11146963 | |||
| 947 | Ga0307406_10474366 | |||
| 948 | Ga0307416_100616997 | |||
| 949 | Ga0307414_10015934 | |||
| 950 | Ga0373949_0039774 | |||
| 951 | Ga0373954_0466173 | |||
| 952 | Ga0373946_0214715 | |||
| 953 | Ga0373961_0207116 | |||
| 954 | Ga0373924_0196720 | |||
| 955 | Ga0373931_0076086 | |||
| 956 | Ga0373925_0232061 | |||
| 957 | Ga0373925_0248963 | |||
| 958 | Ga0395900_0771018 | |||
| 959 | Ga0395901_0262887 | |||
| 960 | Ga0436365_1634399 | |||
| 961 | Ga0436361_0054625 | |||
| 962 | Ga0439449_0009101 | |||
| 963 | Ga0451576_0108295 | |||
| 964 | Ga0451576_0636327 | |||
| 965 | Ga0451576_1430168 | |||
| 966 | Ga0466967_1021876 | |||
| 967 | Ga0495627_050704 | |||
| 968 | Ga0495603_0036094 | |||
| 969 | Ga0495591_002414 | |||
| 970 | Ga0495591_022973 | |||
| 971 | Ga0495629_0179917 | |||
| 972 | Ga0495629_0453934 | |||
| 973 | Ga0495582_0016423 | |||
| 974 | Ga0495605_0006197 | |||
| 975 | Ga0495605_0166953 | |||
| 976 | Ga0495584_0002448 | |||
| 977 | Ga0495584_0079320 | |||
| 978 | Ga0495584_0079809 | |||
| 979 | Ga0495585_0001749 | |||
| 980 | Ga0495585_0020956 | |||
| 981 | Ga0495594_0398008 | |||
| 982 | Ga0495596_0004882 | |||
| 983 | Ga0495596_0050374 | |||
| 984 | Ga0495607_0019497 | |||
| 985 | Ga0495607_0060993 | |||
| 986 | Ga0495607_0229135 | |||
| 987 | Ga0495583_0002935 | |||
| 988 | Ga0495583_0095684 | |||
| 989 | Ga0495606_0038835 | |||
| 990 | Ga0495606_0166465 | |||
| 991 | Ga0495606_0310960 | |||
| 992 | Ga0495610_0006047 | |||
| 993 | Ga0495610_0185734 | |||
| 994 | Ga0495616_0056664 | |||
| 995 | Ga0495616_0067256 | |||
| 996 | Ga0495616_0072899 | |||
| 997 | Ga0495616_0230273 | |||
| 998 | Ga0495620_0179077 | |||
| 999 | Ga0495631_0002278 | |||
| 1000 | Ga0495631_0031624 | |||
| 1001 | Ga0495631_0043968 | |||
| 1002 | Ga0495632_0111599 | |||
| 1003 | Ga0495637_0001501 | |||
| 1004 | Ga0495637_0132809 | |||
| 1005 | Ga0495643_0003683 | |||
| 1006 | Ga0495643_0004252 | |||
| 1007 | Ga0495643_0133487 | |||
| 1008 | Ga0495644_0105888 | |||
| 1009 | Ga0495648_0018792 | |||
| 1010 | Ga0495648_0136378 | |||
| 1011 | Ga0495648_0219024 | |||
| 1012 | Ga0495642_0015559 | |||
| 1013 | Ga0495642_0016073 | |||
| 1014 | Ga0495665_0017875 | |||
| 1015 | Ga0495598_0007048 | |||
| 1016 | Ga0495609_0004890 | |||
| 1017 | Ga0495609_0022748 | |||
| 1018 | Ga0495621_0030647 | |||
| 1019 | Ga0495621_0035705 | |||
| 1020 | Ga0495597_0002350 | |||
| 1021 | Ga0495633_0001768 | |||
| 1022 | Ga0495633_0003584 | |||
| 1023 | Ga0495633_0103155 | |||
| 1024 | Ga0495668_0101765 | |||
| 1025 | Ga0495668_0127076 | |||
| 1026 | Ga0495668_0292584 | |||
| 1027 | Ga0495611_0020106 | |||
| 1028 | Ga0495611_0105341 | |||
| 1029 | Ga0495611_0113749 | |||
| 1030 | Ga0495625_0206081 | |||
| 1031 | Ga0495661_0005995 | |||
| 1032 | Ga0495661_0023971 | |||
| 1033 | Ga0495588_0283627 | |||
| 1034 | Ga0495623_0168188 | |||
| 1035 | Ga0495669_0009132 | |||
| 1036 | Ga0495669_0011285 | |||
| 1037 | Ga0495669_0248718 | |||
| 1038 | Ga0495670_0001829 | |||
| 1039 | Ga0495670_0268273 | |||
| 1040 | Ga0495670_0306495 | |||
| 1041 | Ga0495649_0003510 | |||
| 1042 | Ga0495649_0086286 | |||
| 1043 | Ga0495589_0021409 | |||
| 1044 | Ga0495589_0108405 | |||
| 1045 | Ga0495589_0115390 | |||
| 1046 | Ga0495660_0046735 | |||
| 1047 | Ga0495660_0086272 | |||
| 1048 | Ga0495660_0094627 | |||
| 1049 | Ga0495581_0087675 | |||
| 1050 | Ga0495672_0003402 | |||
| 1051 | Ga0495672_0005177 | |||
| 1052 | Ga0495683_0001729 | |||
| 1053 | Ga0495683_0012586 | |||
| 1054 | Ga0495683_0226372 | |||
| 1055 | Ga0495677_0001217 | |||
| 1056 | Ga0495677_0002706 | |||
| 1057 | Ga0495677_0012869 | |||
| 1058 | Ga0495677_0048298 | |||
| 1059 | Ga0495679_027749 | |||
| 1060 | Ga0495679_041794 | |||
| 1061 | Ga0495685_000764 | |||
| 1062 | Ga0495685_060323 | |||
| 1063 | Ga0495681_0003858 | |||
| 1064 | Ga0495681_0131323 | |||
| 1065 | Ga0495686_0007559 | |||
| 1066 | Ga0495593_0113958 | |||
| 1067 | Ga0495614_0013584 | |||
| 1068 | Ga0495626_0019658 | |||
| 1069 | Ga0495626_0031282 | |||
| 1070 | Ga0496101_0024851 | |||
| 1071 | Ga0496102_0131818 | |||
| 1072 | Ga0496104_0051577 | |||
| 1073 | Ga0496106_0079311 | |||
| 1074 | Ga0496107_0052602 | |||
| 1075 | Ga0496107_0295948 | |||
| 1076 | Ga0496109_0038809 | |||
| 1077 | Ga0496109_0185969 | |||
| 1078 | Ga0496110_0034272 | |||
| 1079 | Ga0496110_0536063 | |||
| 1080 | Ga0496114_0031768 | |||
| 1081 | Ga0496114_0886406 | |||
| 1082 | Ga0496124_0129929 | |||
| 1083 | Ga0496124_0190304 | |||
| 1084 | Ga0495678_002197 | |||
| 1085 | Ga0495682_0176518 | |||
| 1086 | Ga0501041_0178290 | |||
| 1087 | Ga0501067_0029724 | |||
| 1088 | Ga0501072_0755004 | |||
| 1089 | Ga0501073_0003137 | |||
| 1090 | Ga0501235_129396 | |||
| 1091 | nmdc:mga0k408_70295_c1 | |||
| 1092 | nmdc:mga05p37_190319_c1 | |||
| 1093 | nmdc:mga05p37_387281_c2 | |||
| 1094 | nmdc:mga0qj67_437162_c1 | |||
| 1095 | nmdc:mga0qj67_605905_c1 | |||
| 1096 | nmdc:mga0qj67_763430_c1 | |||
| 1097 | nmdc:mga0qj67_891086_c1 | |||
| 1098 | nmdc:mga06r32_102176_c1 | |||
| 1099 | nmdc:mga06r32_219179_c1 | |||
| 1100 | nmdc:mga08y16_158395_c1 | |||
| 1101 | nmdc:mga08y16_161147_c1 | |||
| 1102 | nmdc:mga08y16_288417_c1 | |||
| 1103 | nmdc:mga08y16_3082_c1 | |||
| 1104 | nmdc:mga0n895_199522_c1 | |||
| 1105 | nmdc:mga0rr50_181811_c1 | |||
| 1106 | Ga0495601_0102346 | |||
| 1107 | Ga0500647_0275238 | |||
| 1108 | Ga0500604_0000554 | |||
| 1109 | Ga0587086_018684 | |||
| 1110 | Ga0501082_0344217 | |||
| 1111 | Ga0530510_0004951 | |||
| 1112 | 2510308229 | |||
| 1113 | 2511497177 | |||
| 1114 | 2512529644 | |||
| 1115 | 2513582653 | |||
| 1116 | 2513614705 | |||
| 1117 | 2513882222 | |||
| 1118 | 2513901841 | |||
| 1119 | 2515611766 | |||
| 1120 | 2516895592 | |||
| 1121 | 2524449427 | |||
| 1122 | 2551678935 | |||
| 1123 | 2551682173 | |||
| 1124 | 2551683487 | |||
| 1125 | 2551693089 | |||
| 1126 | 2551699525 | |||
| 1127 | 2551736930 | |||
| 1128 | 2551741065 | |||
| 1129 | 2739612108 | |||
| 1130 | 2776265895 | |||
| 1131 | 2855829594 | |||
| 1132 | 2855844690 | |||
| 1133 | 2858805846 | |||
| 1134 | 2908744722 | |||
| 1135 | 2915991496 | |||
| 1136 | 2916000569 | |||
| 1137 | 2916005162 | |||
| 1138 | 2916007692 | |||
| 1139 | 2916021201 | |||
| 1140 | 2916021904 | |||
| 1141 | 2916030899 | |||
| 1142 | 2916041042 | |||
| 1143 | 2916042253 | |||
| 1144 | 2916053427 | |||
| 1145 | 2916057173 | |||
| 1146 | 2916075663 | |||
| 1147 | 2916080258 | |||
| 1148 | 2921201691 | |||
| 1149 | 2921212381 | |||
| 1150 | 2921242075 | |||
| 1151 | 2921244805 | |||
| 1152 | 2921259219 | |||
| 1153 | 2921269851 | |||
| 1154 | 2921286761 | |||
| 1155 | 2921292310 | |||
| 1156 | 2921300857 | |||
| 1157 | 2924147907 | |||
| 1158 | 2924152792 | |||
| 1159 | 2924161942 | |||
| 1160 | 2924165779 | |||
| 1161 | 2924175627 | |||
| 1162 | 2924180451 | |||
| 1163 | 2924186737 | |||
| 1164 | 2924199392 | |||
| 1165 | 2924200772 | |||
| 1166 | 2924207395 | |||
| 1167 | 2924215589 | |||
| 1168 | 2924222544 | |||
| 1169 | 2924229112 | |||
| 1170 | 2936997080 | |||
| 1171 | 2937003236 | |||
| 1172 | 2937010085 | |||
| 1173 | 2937020521 | |||
| 1174 | 2937025403 | |||
| 1175 | 2937045219 | |||
| 1176 | 2937054254 | |||
| 1177 | 2937060300 | |||
| 1178 | 2937064162 | |||
| 1179 | 2937076894 | |||
| 1180 | 2937092557 | |||
| 1181 | 2937105013 | |||
| 1182 | 2937112971 | |||
| 1183 | 2937115665 | |||
| 1184 | 2937119856 | |||
| 1185 | 2937132546 | |||
| 1186 | 2939670525 | |||
| 1187 | 2957382510 | |||
| 1188 | 2957391723 | |||
| 1189 | 2957400182 | |||
| 1190 | 2957404044 | |||
| 1191 | 2957411430 | |||
| 1192 | 2957416454 | |||
| 1193 | 2957424847 | |||
| 1194 | 2957445772 | |||
| 1195 | 2957450871 | |||
| 1196 | 2957460306 | |||
| 1197 | 2957465448 | |||
| 1198 | 2957474463 | |||
| 1199 | 2957478884 | |||
| 1200 | 2957493425 | |||
| 1201 | 2957498484 | |||
| 1202 | 2957508946 | |||
| 1203 | 2960588088 | |||
| 1204 | 2960600046 | |||
| 1205 | 2960607373 | |||
| 1206 | 2960611183 | |||
| 1207 | 2960622541 | |||
| 1208 | 2960627568 | |||
| 1209 | 2960644225 | |||
| 1210 | 2960647374 | |||
| 1211 | 2960657112 | |||
| 1212 | 2960663929 | |||
| 1213 | 2960674021 | |||
| 1214 | 2960674460 | |||
| 1215 | 2960691807 | |||
| 1216 | 2964611853 | |||
| 1217 | 2964618602 | |||
| 1218 | 2964626652 | |||
| 1219 | 2964634807 | |||
| 1220 | 2964636307 | |||
| 1221 | 2964643194 | |||
| 1222 | 2964652454 | |||
| 1223 | 2964662160 | |||
| 1224 | 2964663819 | |||
| 1225 | 2964677927 | |||
| 1226 | 2964683542 | |||
| 1227 | 2964685144 | |||
| 1228 | 2964694253 | |||
| 1229 | 2964699095 | |||
| 1230 | 2964710905 | |||
| 1231 | 2964716573 | |||
| 1232 | 2964722726 | |||
| 1233 | 2967669912 | |||
| 1234 | 2967671588 | |||
| 1235 | 2967682936 | |||
| 1236 | 2967695573 | |||
| 1237 | 2967706092 | |||
| 1238 | 2967714245 | |||
| 1239 | 2967717540 | |||
| 1240 | 2967721593 | |||
| 1241 | 2967737224 | |||
| 1242 | 2967748367 | |||
| 1243 | 2967748988 | |||
| 1244 | 2967755739 | |||
| 1245 | 2967764588 | |||
| 1246 | 2967769635 | |||
| 1247 | 2967781793 | |||
| 1248 | 2970024000 | |||
| 1249 | 2970033667 | |||
| 1250 | 2970041488 | |||
| 1251 | 2970054495 | |||
| 1252 | 2970057645 | |||
| 1253 | 2970065711 | |||
| 1254 | 2970068844 | |||
| 1255 | 2970078200 | |||
| 1256 | 2970084275 | |||
| 1257 | 2970089388 | |||
| 1258 | 2970095782 | |||
| 1259 | 2970102694 | |||
| 1260 | 2970111155 | |||
| 1261 | 2970117708 | |||
| 1262 | 2970132072 | |||
| 1263 | 2970136242 | |||
| 1264 | 2970151945 | |||
| 1265 | 2970160838 | |||
| 1266 | 2970169038 | |||
| 1267 | 2970170979 | |||
| 1268 | 2970183349 | |||
| 1269 | 2970189475 | |||
| 1270 | 2970192043 | |||
| 1271 | 2977518336 | |||
| 1272 | 2977526348 | |||
| 1273 | 2977543074 | |||
| 1274 | 2977555968 | |||
| 1275 | 2977565848 | |||
| 1276 | 2977566269 | |||
| 1277 | 2977575448 | |||
| 1278 | 2977582347 | |||
| 1279 | 648735701 | |||
| 1280 | 8003997219 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xa8-assembly1.cif.gz_A | crystal structure analysis of glutathione-dependent formaldehyde-activating enzyme (gfa) | 0.9842 | 2 | 191 |
| 1xa8-assembly1.cif.gz_A | crystal structure analysis of glutathione-dependent formaldehyde-activating enzyme (gfa) | 0.969 | 2 | 191 |
| 3fac-assembly8.cif.gz_H | crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. | 0.7317 | 25 | 166 |
| 3fac-assembly8.cif.gz_H | crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. | 0.7143 | 25 | 166 |
| 8ajq-assembly3.cif.gz_E | crystal structure of pa2722 from pseudomonas aeruginosa pao1 | 0.7135 | 21 | 169 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1xa8D00 | Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) | 0.9849 | 2 | 191 | 3.90.1590.10 |
| 1xa8D00 | Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) | 0.9697 | 2 | 191 | 3.90.1590.10 |
| af_O14034_2_133_3.90.1590.10 | Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) | 0.8022 | 23 | 141 | 3.90.1590.10 |
| 3facD00 | Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; | 0.6944 | 25 | 167 | 2.170.150.70 |
| af_O14034_2_133_3.90.1590.10 | Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) | 0.6788 | 23 | 141 | 3.90.1590.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2A3JZ04-F1-model_v4 | Glutathione-dependent formaldehyde-activating enzyme (EC 4.4.1.22) (S-(hydroxymethyl)glutathione synthase) | 1 | 5 | 187 |
GO:0008270
GO:0046294 GO:0051907 |
| AF-A0A3M2SSX5-F1-model_v4 | CENP-V/GFA domain-containing protein | 1 | 21 | 170 |
GO:0008270
GO:0046294 GO:0051907 |
| AF-D4ZD20-F1-model_v4 | Glutathione-dependent formaldehyde-activating enzyme (EC 4.4.1.22) (S-(hydroxymethyl)glutathione synthase) | 1 | 26 | 185 |
GO:0008270
GO:0046294 GO:0051907 |
| AF-A0A1H3FHQ2-F1-model_v4 | S-(Hydroxymethyl)glutathione synthase | 1 | 5 | 129 |
GO:0016846
GO:0046872 |
| AF-A6FDY1-F1-model_v4 | Glutathione-dependent formaldehyde-activating enzyme (EC 4.4.1.22) (S-(hydroxymethyl)glutathione synthase) | 0.9999 | 5 | 185 |
GO:0008270
GO:0046294 GO:0051907 |