F471677

General Info

Members Datasets Scaffolds Average Seq Length
640 293 1280 274

Family's Representative Sequence

Representative Sequence 3300006175|Ga0070712_100007635|Ga0070712_1000076356
Length 290
Sequence VRAAAIRARRQRRLRQTGWNLVGIAVLVVMVFPVFWMVSTAFKQDQDINSFNPTWFPFDGTFSHFRDAIAGSDHPFFWNAVENSLIVVGVTVGLSMVLAFLAAVALAKYRFSGRKMFIAFVIAIQMLPQTGLVIPLFVVLRNYGLTGNYVLFGLILTYLTFVLPFAVWTLRGFLLGIPKELEEAAMVDGSSRLGAFVRILLPLVAPGLVATSVFVFITAWNEFIFANVLLQDQSKQTVTVWLSYFSGSSRHTDWGALMAASTVIAVPVMIFFLLVQRKMRFGLTAGAVKG

Samples

Sample ID Description Type Environment
1 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
151 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
154 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
157 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
158 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
160 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
161 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
162 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
163 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
174 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
175 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
176 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
177 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
178 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
179 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
180 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
181 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
182 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
183 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
184 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
185 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
186 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
187 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
188 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
189 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
194 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
195 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
196 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
197 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
198 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
199 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
200 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
201 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
202 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
203 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
204 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
205 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
206 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
207 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
208 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
209 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
210 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
211 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
212 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
213 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
214 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
215 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
216 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
217 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
218 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
219 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
220 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
221 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
222 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
223 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
224 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
225 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
226 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
227 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
228 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
229 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
230 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
231 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
232 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
233 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
234 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
237 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
238 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
239 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
240 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
241 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
242 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
243 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
244 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
245 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
246 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
247 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
248 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
249 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
262 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
263 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
264 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
265 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
266 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
267 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
268 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
269 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
270 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
271 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
272 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
273 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
274 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
275 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
276 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
279 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
280 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
281 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
282 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
283 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
284 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
285 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
286 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
287 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
288 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
289 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
290 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
291 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
292 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
293 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.16
Nodule 0
Rhizoplane 10.16
Rhizosphere 89.22
Stem 0
Stem Tuber 0
Unclassified 0.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070712_100007635 3300006175 Bacteria 6766
2 JGI24739J22299_10028814 3300001989 Bacteria 1934
3 JGI24738J21930_10018717 3300002075 Bacteria 1447
4 Ga0070658_10015905 3300005327 Bacteria 6016
5 Ga0070658_10016947 3300005327 Bacteria 5831
6 Ga0070683_100014126 3300005329 Bacteria 6974
7 Ga0070683_100032326 3300005329 Bacteria 4765
8 Ga0070683_100034966 3300005329 Bacteria 4593
9 Ga0070683_100121831 3300005329 Bacteria 2464
10 Ga0070683_100129971 3300005329 Bacteria 2383
11 Ga0070683_100514828 3300005329 Bacteria 1143
12 Ga0070670_100035459 3300005331 Bacteria 4294
13 Ga0070670_100310792 3300005331 Bacteria 1380
14 Ga0070677_10076962 3300005333 Bacteria 1418
15 Ga0068869_100041652 3300005334 Bacteria 3289
16 Ga0070680_100001821 3300005336 Bacteria 15662
17 Ga0070680_100028815 3300005336 Bacteria 4455
18 Ga0070680_100339362 3300005336 Bacteria 1277
19 Ga0070682_100001999 3300005337 Bacteria 11374
20 Ga0070682_100079002 3300005337 Bacteria 2124
21 Ga0068868_100051750 3300005338 Bacteria 3232
22 Ga0068868_100060026 3300005338 Bacteria 3009
23 Ga0070660_100005411 3300005339 Bacteria 8840
24 Ga0070660_100013879 3300005339 Bacteria 5795
25 Ga0070660_100024114 3300005339 Bacteria 4512
26 Ga0070660_100027168 3300005339 Bacteria 4269
27 Ga0070660_100046110 3300005339 Bacteria 3339
28 Ga0070660_100046950 3300005339 Bacteria 3311
29 Ga0070691_10018373 3300005341 Bacteria 3223
30 Ga0070687_100135740 3300005343 Bacteria 1426
31 Ga0070669_100266689 3300005353 Bacteria 1368
32 Ga0070669_100583378 3300005353 Bacteria 935
33 Ga0070675_100042638 3300005354 Bacteria 3708
34 Ga0070671_100038527 3300005355 Bacteria 3968
35 Ga0070671_100145452 3300005355 Bacteria 2001
36 Ga0070674_100003374 3300005356 Bacteria 8948
37 Ga0070674_100111554 3300005356 Bacteria 2009
38 Ga0070673_100060263 3300005364 Bacteria 3007
39 Ga0070659_100018223 3300005366 Bacteria 5297
40 Ga0070659_100023749 3300005366 Bacteria 4694
41 Ga0070703_10015282 3300005406 Bacteria 2197
42 Ga0070709_10303318 3300005434 Bacteria 1167
43 Ga0070714_100048180 3300005435 Bacteria 3623
44 Ga0070714_100078992 3300005435 Bacteria 2860
45 Ga0070714_100164482 3300005435 Bacteria 2010
46 Ga0070714_100234816 3300005435 Bacteria 1690
47 Ga0070714_100299524 3300005435 Bacteria 1498
48 Ga0070714_100367450 3300005435 Bacteria 1354
49 Ga0070713_100477649 3300005436 Bacteria 1174
50 Ga0070701_10191125 3300005438 Bacteria 1204
51 Ga0070711_100226527 3300005439 Bacteria 1456
52 Ga0070705_100181094 3300005440 Bacteria 1427
53 Ga0070700_100055165 3300005441 Bacteria 2486
54 Ga0070708_100025981 3300005445 Bacteria 5007
55 Ga0070663_100126702 3300005455 Bacteria 1935
56 Ga0070663_100492408 3300005455 Bacteria 1017
57 Ga0070678_100060472 3300005456 Bacteria 2789
58 Ga0070678_100322496 3300005456 Bacteria 1319
59 Ga0070662_100018355 3300005457 Bacteria 4731
60 Ga0070662_100139103 3300005457 Bacteria 1880
61 Ga0070681_10002997 3300005458 Bacteria 15669
62 Ga0070681_10009081 3300005458 Bacteria 9773
63 Ga0070681_10012261 3300005458 Bacteria 8500
64 Ga0070681_10038403 3300005458 Bacteria 4800
65 Ga0070681_10038979 3300005458 Bacteria 4764
66 Ga0070681_10060395 3300005458 Bacteria 3768
67 Ga0070681_10078234 3300005458 Bacteria 3264
68 Ga0070681_10160837 3300005458 Bacteria 2169
69 Ga0070681_10267247 3300005458 Bacteria 1622
70 Ga0068867_100066108 3300005459 Bacteria 2692
71 Ga0070685_10163036 3300005466 Bacteria 1422
72 Ga0070707_100088735 3300005468 Bacteria 2992
73 Ga0070707_100229148 3300005468 Bacteria 1809
74 Ga0070698_100052237 3300005471 Bacteria 4159
75 Ga0070699_100344329 3300005518 Bacteria 1342
76 Ga0070699_100390143 3300005518 Bacteria 1258
77 Ga0070679_100017533 3300005530 Bacteria 6930
78 Ga0070679_100064292 3300005530 Bacteria 3656
79 Ga0070679_100086211 3300005530 Bacteria 3127
80 Ga0070679_100234251 3300005530 Bacteria 1795
81 Ga0070679_100274085 3300005530 Bacteria 1641
82 Ga0070679_100280468 3300005530 Bacteria 1619
83 Ga0070684_100022447 3300005535 Bacteria 5263
84 Ga0070684_100040845 3300005535 Bacteria 3996
85 Ga0070684_100181112 3300005535 Bacteria 1916
86 Ga0070684_100219451 3300005535 Bacteria 1735
87 Ga0070684_100287350 3300005535 Bacteria 1507
88 Ga0070684_100370011 3300005535 Bacteria 1319
89 Ga0068853_100217258 3300005539 Bacteria 1744
90 Ga0068853_100368309 3300005539 Bacteria 1340
91 Ga0070672_100056793 3300005543 Bacteria 3071
92 Ga0070686_100018134 3300005544 Bacteria 4125
93 Ga0070696_100066659 3300005546 Bacteria 2525
94 Ga0070693_100021500 3300005547 Bacteria 3418
95 Ga0070693_100316799 3300005547 Unclassified 1057
96 Ga0070665_100082694 3300005548 Bacteria 3216
97 Ga0070704_100024915 3300005549 Bacteria 3931
98 Ga0070704_100052021 3300005549 Bacteria 2887
99 Ga0068855_100025827 3300005563 Bacteria 7024
100 Ga0068855_100058058 3300005563 Bacteria 4533
101 Ga0068855_100206146 3300005563 Bacteria 2212
102 Ga0068855_100461680 3300005563 Bacteria 1385
103 Ga0070664_100061947 3300005564 Bacteria 3189
104 Ga0070664_100231726 3300005564 Bacteria 1655
105 Ga0070664_100393275 3300005564 Bacteria 1267
106 Ga0068857_100026268 3300005577 Bacteria 5130
107 Ga0068857_100221115 3300005577 Bacteria 1730
108 Ga0068854_100014289 3300005578 Bacteria 5232
109 Ga0068856_100132550 3300005614 Bacteria 2497
110 Ga0068856_100152106 3300005614 Bacteria 2323
111 Ga0070702_100004495 3300005615 Bacteria 6377
112 Ga0070702_100188782 3300005615 Bacteria 1354
113 Ga0068852_100003736 3300005616 Bacteria 10679
114 Ga0068852_100043103 3300005616 Bacteria 3825
115 Ga0068852_100470387 3300005616 Bacteria 1247
116 Ga0068864_100011671 3300005618 Bacteria 7254
117 Ga0068866_10017527 3300005718 Bacteria 3222
118 Ga0068866_10166302 3300005718 Bacteria 1291
119 Ga0068861_100125218 3300005719 Bacteria 2078
120 Ga0068861_100191041 3300005719 Bacteria 1712
121 Ga0068851_10014724 3300005834 Bacteria 3717
122 Ga0068863_100133091 3300005841 Bacteria 2374
123 Ga0068858_100277130 3300005842 Bacteria 1596
124 Ga0070717_10024957 3300006028 Bacteria 4748
125 Ga0070717_10464380 3300006028 Bacteria 1142
126 Ga0070715_10172311 3300006163 Bacteria 1079
127 Ga0070716_100096256 3300006173 Bacteria 1804
128 Ga0070712_100035246 3300006175 Bacteria 3396
129 Ga0070712_100140200 3300006175 Bacteria 1844
130 Ga0070712_100225769 3300006175 Bacteria 1485
131 Ga0070712_100296248 3300006175 Bacteria 1308
132 Ga0097621_100188384 3300006237 Bacteria 1786
133 Ga0068871_100040468 3300006358 Bacteria 3733
134 Ga0075428_100207657 3300006844 Bacteria 2117
135 Ga0075428_100553993 3300006844 Bacteria 1229
136 Ga0075433_10170640 3300006852 Bacteria 1936
137 Ga0068865_100016443 3300006881 Bacteria 4734
138 Ga0068865_100153818 3300006881 Bacteria 1748
139 Ga0105244_10081253 3300009036 Bacteria 1604
140 Ga0105240_10039720 3300009093 Bacteria 6024
141 Ga0105240_10171967 3300009093 Bacteria 2565
142 Ga0111539_10064740 3300009094 Bacteria 4324
143 Ga0111539_10251050 3300009094 Bacteria 2060
144 Ga0111539_10524669 3300009094 Bacteria 1380
145 Ga0111539_10928260 3300009094 Unclassified 1012
146 Ga0105245_10168634 3300009098 Bacteria 2083
147 Ga0105245_10179593 3300009098 Bacteria 2021
148 Ga0105245_10773344 3300009098 Bacteria 997
149 Ga0105247_10009894 3300009101 Bacteria 5777
150 Ga0114129_10293217 3300009147 Bacteria 2170
151 Ga0114129_10756069 3300009147 Bacteria 1244
152 Ga0105243_10002451 3300009148 Bacteria 15499
153 Ga0105243_10115235 3300009148 Bacteria 2256
154 Ga0105243_10119907 3300009148 Bacteria 2216
155 Ga0105243_10576389 3300009148 Bacteria 1079
156 Ga0105241_10260673 3300009174 Bacteria 1473
157 Ga0105242_10016117 3300009176 Bacteria 5807
158 Ga0105242_10043982 3300009176 Bacteria 3614
159 Ga0105242_10075049 3300009176 Bacteria 2814
160 Ga0105248_10018986 3300009177 Bacteria 7601
161 Ga0105248_10211061 3300009177 Bacteria 2188
162 Ga0105248_10546152 3300009177 Bacteria 1307
163 Ga0105248_10665184 3300009177 Bacteria 1175
164 Ga0105237_10071550 3300009545 Bacteria 3463
165 Ga0105237_10713500 3300009545 Bacteria 1009
166 Ga0105237_10715473 3300009545 Bacteria 1008
167 Ga0105238_10052518 3300009551 Bacteria 4097
168 Ga0105238_10080572 3300009551 Bacteria 3245
169 Ga0105239_10286392 3300010375 Bacteria 1855
170 Ga0105246_10523435 3300011119 Bacteria 1011
171 Ga0157373_10125070 3300013100 Bacteria 1808
172 Ga0157371_10005827 3300013102 Bacteria 10309
173 Ga0157371_10201219 3300013102 Bacteria 1428
174 Ga0157370_10006496 3300013104 Bacteria 12881
175 Ga0157370_10034384 3300013104 Bacteria 4937
176 Ga0157369_10003204 3300013105 Bacteria 19516
177 Ga0157369_10007590 3300013105 Bacteria 12481
178 Ga0157369_10013260 3300013105 Bacteria 9325
179 Ga0157369_10037754 3300013105 Bacteria 5287
180 Ga0157369_10106314 3300013105 Bacteria 2987
181 Ga0157378_10666091 3300013297 Bacteria 1058
182 Ga0163162_10099765 3300013306 Bacteria 2995
183 Ga0157372_10031239 3300013307 Bacteria 5831
184 Ga0157372_10068961 3300013307 Bacteria 3977
185 Ga0157372_10079283 3300013307 Bacteria 3713
186 Ga0157372_10171509 3300013307 Bacteria 2510
187 Ga0157372_10270441 3300013307 Bacteria 1975
188 Ga0157372_10541901 3300013307 Bacteria 1357
189 Ga0157375_10046183 3300013308 Bacteria 4244
190 Ga0157375_10053424 3300013308 Bacteria 3975
191 Ga0157375_10125507 3300013308 Bacteria 2681
192 Ga0157375_10262542 3300013308 Bacteria 1888
193 Ga0163163_10127717 3300014325 Bacteria 2581
194 Ga0157380_10137478 3300014326 Bacteria 2094
195 Ga0157377_10006673 3300014745 Bacteria 5521
196 Ga0157377_10059652 3300014745 Bacteria 2175
197 Ga0157377_10169397 3300014745 Bacteria 1365
198 Ga0157379_10071390 3300014968 Bacteria 3106
199 Ga0157376_10106728 3300014969 Bacteria 2457
200 Ga0157376_10509218 3300014969 Bacteria 1184
201 Ga0163161_10049482 3300017792 Bacteria 3038
202 Ga0163161_10064823 3300017792 Bacteria 2666
203 Ga0206356_10891718 3300020070 Bacteria 1871
204 Ga0206354_11005491 3300020081 Bacteria 2330
205 Ga0207656_10072976 3300025321 Bacteria 1529
206 Ga0207642_10009889 3300025899 Bacteria 3337
207 Ga0207642_10151262 3300025899 Bacteria 1235
208 Ga0207688_10006489 3300025901 Bacteria 6368
209 Ga0207688_10171337 3300025901 Bacteria 1291
210 Ga0207647_10163792 3300025904 Bacteria 1296
211 Ga0207699_10097040 3300025906 Bacteria 1862
212 Ga0207645_10188511 3300025907 Bacteria 1355
213 Ga0207643_10017328 3300025908 Bacteria 3938
214 Ga0207643_10044252 3300025908 Bacteria 2513
215 Ga0207705_10018516 3300025909 Bacteria 4979
216 Ga0207705_10034624 3300025909 Bacteria 3611
217 Ga0207705_10059850 3300025909 Bacteria 2750
218 Ga0207705_10102736 3300025909 Bacteria 2105
219 Ga0207707_10011086 3300025912 Bacteria 7838
220 Ga0207707_10026623 3300025912 Bacteria 5054
221 Ga0207707_10038112 3300025912 Bacteria 4200
222 Ga0207707_10079271 3300025912 Bacteria 2868
223 Ga0207707_10117834 3300025912 Bacteria 2321
224 Ga0207707_10386292 3300025912 Archaea 1203
225 Ga0207695_10052376 3300025913 Bacteria 4277
226 Ga0207671_10528238 3300025914 Bacteria 941
227 Ga0207693_10024658 3300025915 Bacteria 4770
228 Ga0207693_10035532 3300025915 Bacteria 3929
229 Ga0207693_10119011 3300025915 Bacteria 2074
230 Ga0207663_10039238 3300025916 Bacteria 2868
231 Ga0207663_10289587 3300025916 Bacteria 1219
232 Ga0207660_10033723 3300025917 Bacteria 3544
233 Ga0207660_10039291 3300025917 Bacteria 3308
234 Ga0207660_10101264 3300025917 Bacteria 2152
235 Ga0207662_10029628 3300025918 Bacteria 3172
236 Ga0207657_10000184 3300025919 Bacteria 64813
237 Ga0207657_10001102 3300025919 Bacteria 28705
238 Ga0207657_10001813 3300025919 Bacteria 23057
239 Ga0207657_10002821 3300025919 Bacteria 18677
240 Ga0207657_10008652 3300025919 Bacteria 10304
241 Ga0207657_10015564 3300025919 Bacteria 7364
242 Ga0207657_10058870 3300025919 Bacteria 3304
243 Ga0207652_10019656 3300025921 Bacteria 5558
244 Ga0207652_10032721 3300025921 Bacteria 4374
245 Ga0207652_10034259 3300025921 Bacteria 4278
246 Ga0207652_10082933 3300025921 Bacteria 2806
247 Ga0207652_10083156 3300025921 Bacteria 2802
248 Ga0207652_10265297 3300025921 Bacteria 1549
249 Ga0207652_10284121 3300025921 Bacteria 1493
250 Ga0207681_10074757 3300025923 Bacteria 2375
251 Ga0207681_10213761 3300025923 Bacteria 1488
252 Ga0207681_10417063 3300025923 Bacteria 1087
253 Ga0207650_10169099 3300025925 Bacteria 1736
254 Ga0207687_10004118 3300025927 Bacteria 9737
255 Ga0207687_10088979 3300025927 Bacteria 2247
256 Ga0207700_10000004 3300025928 Bacteria 443409
257 Ga0207700_10290409 3300025928 Bacteria 1409
258 Ga0207664_10004998 3300025929 Bacteria 9012
259 Ga0207664_10018066 3300025929 Bacteria 5182
260 Ga0207664_10097287 3300025929 Bacteria 2424
261 Ga0207664_10103417 3300025929 Bacteria 2357
262 Ga0207664_10107660 3300025929 Bacteria 2313
263 Ga0207664_10307603 3300025929 Bacteria 1396
264 Ga0207644_10037980 3300025931 Bacteria 3390
265 Ga0207644_10111604 3300025931 Bacteria 2068
266 Ga0207644_10302035 3300025931 Bacteria 1290
267 Ga0207690_10184769 3300025932 Bacteria 1572
268 Ga0207706_10093156 3300025933 Bacteria 2649
269 Ga0207706_10167273 3300025933 Bacteria 1932
270 Ga0207686_10100705 3300025934 Bacteria 1928
271 Ga0207709_10180948 3300025935 Bacteria 1489
272 Ga0207670_10175985 3300025936 Bacteria 1608
273 Ga0207704_10068128 3300025938 Bacteria 2242
274 Ga0207665_10078319 3300025939 Bacteria 2270
275 Ga0207665_10123749 3300025939 Bacteria 1829
276 Ga0207691_10010073 3300025940 Bacteria 9073
277 Ga0207711_10362268 3300025941 Unclassified 1343
278 Ga0207711_10526158 3300025941 Bacteria 1103
279 Ga0207689_10007803 3300025942 Bacteria 9366
280 Ga0207689_10021216 3300025942 Bacteria 5460
281 Ga0207661_10018666 3300025944 Bacteria 5155
282 Ga0207661_10018699 3300025944 Bacteria 5152
283 Ga0207661_10121804 3300025944 Bacteria 2221
284 Ga0207661_10143294 3300025944 Bacteria 2058
285 Ga0207661_10163636 3300025944 Bacteria 1932
286 Ga0207661_10372083 3300025944 Bacteria 1292
287 Ga0207661_10396159 3300025944 Bacteria 1251
288 Ga0207679_10159654 3300025945 Bacteria 1844
289 Ga0207679_10202327 3300025945 Bacteria 1660
290 Ga0207667_10022396 3300025949 Bacteria 6982
291 Ga0207667_10103617 3300025949 Bacteria 2934
292 Ga0207667_10269191 3300025949 Bacteria 1742
293 Ga0207667_10487150 3300025949 Bacteria 1251
294 Ga0207668_10461660 3300025972 Bacteria 1086
295 Ga0207640_10015218 3300025981 Bacteria 4449
296 Ga0207640_10084087 3300025981 Bacteria 2184
297 Ga0207640_10437841 3300025981 Bacteria 1074
298 Ga0207639_10162059 3300026041 Bacteria 1886
299 Ga0207639_10243361 3300026041 Bacteria 1565
300 Ga0207639_10361080 3300026041 Bacteria 1300
301 Ga0207678_10035141 3300026067 Bacteria 4364
302 Ga0207678_10264978 3300026067 Bacteria 1473
303 Ga0207678_10337564 3300026067 Bacteria 1298
304 Ga0207708_10049570 3300026075 Bacteria 3198
305 Ga0207702_10062790 3300026078 Bacteria 3174
306 Ga0207641_10210921 3300026088 Bacteria 1796
307 Ga0207648_10052637 3300026089 Bacteria 3560
308 Ga0207674_10029668 3300026116 Bacteria 5756
309 Ga0207674_10181245 3300026116 Bacteria 2058
310 Ga0207675_100057982 3300026118 Bacteria 3614
311 Ga0207675_100439433 3300026118 Bacteria 1291
312 Ga0207683_10025396 3300026121 Bacteria 5111
313 Ga0207683_10032826 3300026121 Bacteria 4510
314 Ga0207698_10141839 3300026142 Bacteria 2071
315 Ga0207428_10106398 3300027907 Bacteria 2163
316 Ga0207428_10284644 3300027907 Bacteria 1226
317 Ga0268266_10258902 3300028379 Bacteria 1612
318 Ga0265338_10003587 3300028800 Bacteria 21674
319 Ga0265330_10041187 3300031235 Bacteria 2049
320 Ga0265327_10004631 3300031251 Bacteria 12068
321 Ga0265327_10054116 3300031251 Bacteria 2078
322 Ga0307408_100103172 3300031548 Bacteria 2177
323 Ga0265314_10011243 3300031711 Bacteria 7406
324 Ga0265342_10058878 3300031712 Bacteria 2270
325 Ga0307416_100357982 3300032002 Bacteria 1480
326 Ga0373944_0001625 3300035089 Bacteria 5679
327 Ga0373952_0044233 3300035092 Bacteria 1040
328 Ga0373936_0040501 3300035113 Bacteria 1866
329 Ga0373945_0020198 3300035116 Bacteria 2278
330 Ga0373943_0040205 3300035170 Bacteria 2257
331 Ga0373943_0068118 3300035170 Bacteria 1796
332 Ga0373943_0186407 3300035170 Bacteria 1143
333 Ga0373946_0031637 3300035171 Bacteria 2121
334 Ga0373961_0004830 3300035241 Bacteria 3242
335 Ga0373935_0037579 3300035692 Bacteria 3031
336 Ga0373935_0097691 3300035692 Bacteria 1932
337 Ga0373947_0021137 3300035725 Bacteria 3765
338 Ga0373947_0091658 3300035725 Bacteria 1896
339 Ga0373937_0056645 3300036401 Bacteria 3601
340 Ga0373925_0021198 3300037068 Bacteria 4735
341 Ga0373925_0108675 3300037068 Bacteria 2140
342 Ga0395899_0015874 3300037312 Bacteria 5742
343 Ga0395899_0017639 3300037312 Bacteria 5436
344 Ga0395899_0026619 3300037312 Bacteria 4364
345 Ga0395899_0085343 3300037312 Bacteria 2294
346 Ga0395899_0118461 3300037312 Bacteria 1898
347 Ga0395900_0031296 3300037418 Bacteria 5466
348 Ga0395900_0041601 3300037418 Bacteria 4737
349 Ga0395900_0228178 3300037418 Bacteria 1874
350 Ga0395900_0292732 3300037418 Bacteria 1616
351 Ga0395900_0296783 3300037418 Bacteria 1603
352 Ga0395898_0002551 3300037466 Bacteria 21372
353 Ga0395898_0002750 3300037466 Bacteria 20274
354 Ga0395898_0003518 3300037466 Bacteria 17457
355 Ga0395898_0008370 3300037466 Bacteria 10936
356 Ga0395898_0018405 3300037466 Bacteria 7122
357 Ga0395898_0056987 3300037466 Bacteria 3807
358 Ga0395898_0139869 3300037466 Bacteria 2317
359 Ga0395898_0367935 3300037466 Bacteria 1371
360 Ga0395898_0807330 3300037466 Bacteria 878
361 Ga0395905_0003194 3300037471 Bacteria 17647
362 Ga0395905_0029723 3300037471 Bacteria 5150
363 Ga0395905_0104208 3300037471 Bacteria 2663
364 Ga0395905_0321730 3300037471 Unclassified 1436
365 Ga0395905_0361459 3300037471 Bacteria 1344
366 Ga0395901_0002628 3300038443 Bacteria 18168
367 Ga0395901_0007364 3300038443 Bacteria 11106
368 Ga0395901_0013761 3300038443 Bacteria 8223
369 Ga0395901_0053763 3300038443 Bacteria 4184
370 Ga0395901_0060477 3300038443 Bacteria 3942
371 Ga0395901_0103066 3300038443 Bacteria 2994
372 Ga0395901_0171890 3300038443 Bacteria 2273
373 Ga0436365_1897806 3300039437 Bacteria 1858
374 Ga0436363_0735095 3300039450 Bacteria 2385
375 Ga0451795_0239597 3300041456 Unclassified 1036
376 Ga0451807_1325858 3300041486 Bacteria 1576
377 Ga0451849_0911131 3300041505 Bacteria 959
378 Ga0450906_016223 3300042145 Bacteria 1350
379 Ga0439458_0013433 3300042157 Bacteria 1842
380 Ga0450901_010079 3300042533 Bacteria 977
381 Ga0466965_0053099 3300044683 Bacteria 2014
382 Ga0466966_0001789 3300044684 Bacteria 13940
383 Ga0466966_0007034 3300044684 Bacteria 7450
384 Ga0466966_0053195 3300044684 Bacteria 2569
385 Ga0466966_0086931 3300044684 Bacteria 1943
386 Ga0466961_0000987 3300044693 Bacteria 17620
387 Ga0466961_0183459 3300044693 Bacteria 1299
388 Ga0466961_0299975 3300044693 Bacteria 981
389 Ga0466963_0021458 3300044694 Bacteria 4075
390 Ga0466963_0037151 3300044694 Bacteria 3179
391 Ga0466963_0083023 3300044694 Bacteria 2173
392 Ga0466963_0117670 3300044694 Bacteria 1827
393 Ga0466971_0000626 3300044719 Bacteria 14107
394 Ga0466971_0127469 3300044719 Bacteria 1180
395 Ga0466968_0029284 3300044735 Bacteria 2277
396 Ga0466970_0087233 3300044765 Bacteria 1692
397 Ga0466957_0025962 3300044842 Bacteria 3473
398 Ga0466957_0166601 3300044842 Bacteria 1433
399 Ga0466960_0111096 3300044901 Bacteria 1424
400 Ga0466960_0169418 3300044901 Bacteria 1178
401 Ga0466959_0005013 3300045049 Bacteria 8992
402 Ga0466959_0011239 3300045049 Bacteria 6423
403 Ga0466959_0080800 3300045049 Bacteria 2343
404 Ga0451576_0273178 3300045051 Bacteria 1767
405 Ga0466958_0007140 3300045836 Bacteria 6122
406 Ga0466958_0029238 3300045836 Bacteria 3270
407 Ga0466958_0034040 3300045836 Bacteria 3037
408 Ga0466967_0000517 3300045976 Bacteria 18757
409 Ga0466967_0006542 3300045976 Bacteria 8266
410 Ga0466967_0009114 3300045976 Bacteria 7340
411 Ga0466967_0048641 3300045976 Bacteria 3704
412 Ga0466967_0054518 3300045976 Bacteria 3519
413 Ga0466967_0114560 3300045976 Bacteria 2482
414 Ga0466967_0139096 3300045976 Bacteria 2260
415 Ga0466967_0335028 3300045976 Bacteria 1462
416 Ga0466967_0351658 3300045976 Bacteria 1426
417 Ga0466967_0492127 3300045976 Bacteria 1202
418 Ga0495592_0156530 3300046454 Bacteria 1571
419 Ga0495603_0097478 3300046455 Bacteria 1717
420 Ga0495629_0000769 3300046459 Bacteria 25883
421 Ga0495629_0073701 3300046459 Bacteria 2384
422 Ga0495629_0112372 3300046459 Bacteria 1899
423 Ga0495629_0112829 3300046459 Bacteria 1895
424 Ga0495629_0197731 3300046459 Bacteria 1390
425 Ga0495641_0000416 3300046461 Bacteria 35566
426 Ga0495641_0063902 3300046461 Bacteria 1658
427 Ga0495641_0087234 3300046461 Bacteria 1396
428 Ga0495641_0095174 3300046461 Bacteria 1330
429 Ga0495651_0005047 3300046462 Bacteria 10081
430 Ga0495651_0081857 3300046462 Bacteria 2436
431 Ga0495651_0088107 3300046462 Bacteria 2333
432 Ga0495651_0282272 3300046462 Bacteria 1121
433 Ga0495653_0242159 3300046463 Bacteria 1201
434 Ga0495582_0007390 3300046473 Bacteria 6084
435 Ga0495639_0003265 3300046475 Bacteria 7040
436 Ga0495662_0072958 3300046476 Bacteria 1664
437 Ga0495664_0009790 3300046477 Bacteria 5374
438 Ga0495608_0016345 3300046511 Bacteria 5134
439 Ga0495608_0019890 3300046511 Bacteria 4617
440 Ga0495608_0110392 3300046511 Bacteria 1768
441 Ga0495618_0120776 3300046514 Bacteria 1678
442 Ga0495628_0286320 3300046516 Bacteria 1222
443 Ga0495630_0061003 3300046517 Bacteria 2832
444 Ga0495630_0080398 3300046517 Bacteria 2459
445 Ga0495630_0190563 3300046517 Bacteria 1564
446 Ga0495652_0020731 3300046529 Bacteria 5842
447 Ga0495652_0149802 3300046529 Bacteria 1824
448 Ga0495665_0048472 3300046531 Bacteria 2252
449 Ga0495640_0048738 3300046533 Bacteria 2925
450 Ga0495640_0057971 3300046533 Bacteria 2642
451 Ga0495640_0070983 3300046533 Bacteria 2338
452 Ga0495640_0094791 3300046533 Bacteria 1966
453 Ga0495587_0071751 3300046536 Bacteria 2014
454 Ga0495587_0096677 3300046536 Bacteria 1703
455 Ga0495667_0022614 3300046559 Bacteria 4236
456 Ga0495667_0074126 3300046559 Bacteria 2216
457 Ga0495634_0325716 3300046642 Bacteria 924
458 Ga0495635_0034363 3300046663 Bacteria 3516
459 Ga0495635_0094182 3300046663 Bacteria 2048
460 Ga0495635_0103021 3300046663 Bacteria 1950
461 Ga0495635_0257929 3300046663 Bacteria 1174
462 Ga0495659_0101754 3300046664 Bacteria 1114
463 Ga0495599_0031639 3300046678 Bacteria 3321
464 Ga0495599_0085926 3300046678 Bacteria 1964
465 Ga0495623_0065995 3300046679 Bacteria 2262
466 Ga0495646_0049513 3300046680 Bacteria 2550
467 Ga0495647_0021319 3300046681 Bacteria 2332
468 Ga0495658_0002845 3300046683 Bacteria 8693
469 Ga0495658_0195370 3300046683 Bacteria 1259
470 Ga0495613_0008571 3300046689 Bacteria 7589
471 Ga0495613_0044551 3300046689 Bacteria 3282
472 Ga0495613_0139239 3300046689 Bacteria 1735
473 Ga0495624_0026650 3300046690 Bacteria 3786
474 Ga0495600_0019083 3300046809 Bacteria 4376
475 Ga0495600_0148575 3300046809 Bacteria 1518
476 Ga0495581_0001888 3300047315 Bacteria 11726
477 Ga0495604_0189867 3300047317 Bacteria 1432
478 Ga0495604_0225855 3300047317 Bacteria 1287
479 Ga0495674_0002574 3300047319 Bacteria 17681
480 Ga0495674_0017016 3300047319 Bacteria 6776
481 Ga0495674_0036268 3300047319 Bacteria 4440
482 Ga0495674_0235115 3300047319 Bacteria 1511
483 Ga0495674_0432725 3300047319 Bacteria 1059
484 Ga0495676_0002838 3300047321 Bacteria 15613
485 Ga0495680_0005259 3300047322 Bacteria 12219
486 Ga0495680_0036305 3300047322 Bacteria 3958
487 Ga0495680_0072709 3300047322 Bacteria 2615
488 Ga0495680_0213295 3300047322 Bacteria 1381
489 Ga0495675_0121348 3300047444 Bacteria 1628
490 Ga0495684_0021862 3300047471 Bacteria 4924
491 Ga0495684_0140987 3300047471 Bacteria 1807
492 Ga0495593_0052361 3300047673 Bacteria 2158
493 Ga0495602_0024643 3300048088 Bacteria 5835
494 Ga0495602_0128275 3300048088 Bacteria 2028
495 Ga0495614_0008887 3300048089 Bacteria 4457
496 Ga0496100_0014126 3300048903 Bacteria 4628
497 Ga0496100_0023759 3300048903 Bacteria 3730
498 Ga0496100_0076801 3300048903 Bacteria 2244
499 Ga0496100_0107455 3300048903 Bacteria 1933
500 Ga0496100_0420506 3300048903 Bacteria 1021
501 Ga0496101_0015904 3300048904 Bacteria 5076
502 Ga0496101_0046814 3300048904 Bacteria 3103
503 Ga0496101_0110487 3300048904 Bacteria 2069
504 Ga0496101_0210987 3300048904 Bacteria 1504
505 Ga0496102_0005054 3300048905 Bacteria 11168
506 Ga0496102_0016291 3300048905 Bacteria 6492
507 Ga0496102_0057754 3300048905 Bacteria 3544
508 Ga0496103_0119230 3300048906 Bacteria 1680
509 Ga0496104_0001220 3300048907 Bacteria 22113
510 Ga0496104_0010674 3300048907 Bacteria 8210
511 Ga0496104_0138121 3300048907 Bacteria 2342
512 Ga0496104_0192604 3300048907 Bacteria 1951
513 Ga0496104_0226447 3300048907 Bacteria 1782
514 Ga0496105_0005256 3300048908 Bacteria 9812
515 Ga0496105_0013286 3300048908 Bacteria 6534
516 Ga0496105_0052460 3300048908 Bacteria 3369
517 Ga0496105_0071273 3300048908 Bacteria 2872
518 Ga0496105_0166936 3300048908 Bacteria 1806
519 Ga0496105_0213207 3300048908 Bacteria 1573
520 Ga0496105_0439986 3300048908 Bacteria 1030
521 Ga0496106_0023223 3300048909 Bacteria 4607
522 Ga0496106_0120379 3300048909 Bacteria 2051
523 Ga0496106_0177093 3300048909 Bacteria 1692
524 Ga0496106_0266048 3300048909 Bacteria 1372
525 Ga0496107_0022695 3300048910 Bacteria 4436
526 Ga0496108_0006994 3300048911 Bacteria 9133
527 Ga0496108_0146040 3300048911 Bacteria 2039
528 Ga0496108_0333198 3300048911 Bacteria 1323
529 Ga0496109_0001867 3300048912 Bacteria 17461
530 Ga0496109_0025360 3300048912 Bacteria 5283
531 Ga0496109_0039951 3300048912 Bacteria 4248
532 Ga0496109_0256434 3300048912 Bacteria 1647
533 Ga0496110_0000789 3300048913 Bacteria 22109
534 Ga0496110_0009470 3300048913 Bacteria 7887
535 Ga0496110_0363934 3300048913 Bacteria 1318
536 Ga0496111_0020847 3300048914 Bacteria 4569
537 Ga0496111_0028582 3300048914 Bacteria 3952
538 Ga0496111_0077442 3300048914 Bacteria 2424
539 Ga0496111_0133045 3300048914 Bacteria 1841
540 Ga0496112_0004745 3300048915 Bacteria 11585
541 Ga0496112_0028006 3300048915 Bacteria 5435
542 Ga0496112_0031521 3300048915 Bacteria 5144
543 Ga0496112_0033426 3300048915 Bacteria 5000
544 Ga0496112_0127220 3300048915 Bacteria 2518
545 Ga0496112_0367059 3300048915 Bacteria 1381
546 Ga0496113_0226963 3300048916 Bacteria 1489
547 Ga0496114_0004135 3300048917 Bacteria 11226
548 Ga0496114_0021601 3300048917 Bacteria 5238
549 Ga0496114_0038561 3300048917 Bacteria 3954
550 Ga0496114_0107831 3300048917 Bacteria 2384
551 Ga0496114_0174793 3300048917 Bacteria 1873
552 Ga0496114_0329419 3300048917 Bacteria 1350
553 Ga0496114_0432692 3300048917 Bacteria 1165
554 Ga0496114_0475211 3300048917 Bacteria 1106
555 Ga0496115_0012193 3300048918 Bacteria 6464
556 Ga0496115_0016676 3300048918 Bacteria 5599
557 Ga0496115_0153938 3300048918 Bacteria 1899
558 Ga0496115_0362581 3300048918 Bacteria 1181
559 Ga0501031_0044463 3300049568 Bacteria 2898
560 Ga0501031_0049191 3300049568 Bacteria 2747
561 Ga0501033_0010795 3300049570 Bacteria 7004
562 Ga0501036_0044140 3300049572 Bacteria 3775
563 Ga0501036_0118634 3300049572 Bacteria 2234
564 Ga0501038_0007471 3300049574 Bacteria 10082
565 Ga0501038_0115656 3300049574 Bacteria 2217
566 Ga0501039_0008698 3300049575 Bacteria 7728
567 Ga0501040_0026956 3300049576 Bacteria 3866
568 Ga0501040_0056751 3300049576 Bacteria 2688
569 Ga0501041_0005359 3300049577 Bacteria 7510
570 Ga0501042_0046637 3300049578 Bacteria 3089
571 Ga0501042_0096730 3300049578 Bacteria 2121
572 Ga0501043_0035987 3300049579 Bacteria 3894
573 Ga0501046_0041443 3300049580 Bacteria 3674
574 Ga0501047_0042837 3300049581 Bacteria 4373
575 Ga0501047_0247970 3300049581 Bacteria 1630
576 Ga0501048_0037529 3300049582 Bacteria 3479
577 Ga0501048_0058281 3300049582 Bacteria 2737
578 Ga0501067_0015442 3300049583 Bacteria 4228
579 Ga0501067_0162192 3300049583 Bacteria 1245
580 Ga0501068_0050778 3300049584 Bacteria 2507
581 Ga0501068_0123232 3300049584 Bacteria 1617
582 Ga0501068_0210441 3300049584 Bacteria 1235
583 Ga0501069_0058586 3300049585 Bacteria 2148
584 Ga0501069_0063765 3300049585 Bacteria 2058
585 Ga0501069_0086770 3300049585 Bacteria 1767
586 Ga0501070_0095607 3300049586 Bacteria 2458
587 Ga0501070_0221305 3300049586 Bacteria 1552
588 Ga0501070_0221987 3300049586 Bacteria 1549
589 Ga0501071_0034415 3300049587 Bacteria 3605
590 Ga0501071_0036159 3300049587 Bacteria 3521
591 Ga0501072_0015333 3300049588 Bacteria 5878
592 Ga0501072_0049517 3300049588 Bacteria 3307
593 Ga0501073_0039037 3300049589 Bacteria 3365
594 Ga0501074_0024457 3300049590 Bacteria 4390
595 Ga0501074_0073320 3300049590 Bacteria 2459
596 Ga0501075_0016149 3300049591 Bacteria 5373
597 Ga0501075_0034336 3300049591 Bacteria 3776
598 Ga0501076_0034879 3300049592 Bacteria 3935
599 Ga0501076_0073517 3300049592 Bacteria 2737
600 Ga0501077_0004335 3300049593 Bacteria 8598
601 Ga0501077_0005854 3300049593 Bacteria 7492
602 Ga0501079_0007567 3300049741 Bacteria 8224
603 Ga0501079_0101981 3300049741 Bacteria 2225
604 Ga0501079_0458960 3300049741 Bacteria 1001
605 Ga0501080_0051967 3300049742 Bacteria 3814
606 Ga0501080_0244475 3300049742 Bacteria 1637
607 Ga0501080_0262280 3300049742 Bacteria 1574
608 Ga0501080_0428149 3300049742 Bacteria 1188
609 Ga0501081_0089555 3300049743 Bacteria 2162
610 Ga0501081_0103950 3300049743 Bacteria 2010
611 Ga0501083_0079041 3300049744 Bacteria 2181
612 Ga0501035_0009056 3300049822 Bacteria 9258
613 Ga0501044_0138506 3300049823 Bacteria 2423
614 Ga0501045_0008053 3300049824 Bacteria 7342
615 Ga0501045_0046110 3300049824 Bacteria 3174
616 nmdc:mga03n38_107499_c1 3300050490 Bacteria 1354
617 nmdc:mga08y16_185060_c1 3300050511 Bacteria 2162
618 nmdc:mga08y16_210332_c1 3300050511 Bacteria 2015
619 nmdc:mga08y16_233519_c1 3300050511 Bacteria 1902
620 nmdc:mga08y16_507635_c1 3300050511 Bacteria 1224
621 nmdc:mga0n895_290391_c1 3300050512 Bacteria 1658
622 nmdc:mga0n895_44742_c1 3300050512 Bacteria 4317
623 nmdc:mga0rr50_225113_c1 3300050513 Bacteria 1550
624 nmdc:mga08x19_84286_c1 3300050514 Bacteria 2090
625 nmdc:mga0a205_28388_c1 3300050515 Bacteria 5350
626 Ga0495601_0051726 3300053077 Bacteria 2593
627 Ga0495612_0009586 3300053078 Bacteria 3922
628 Ga0495612_0033345 3300053078 Bacteria 2084
629 Ga0495655_0021544 3300053083 Bacteria 1460
630 Ga0495595_0009208 3300053084 Bacteria 4078
631 Ga0495595_0045800 3300053084 Bacteria 2013
632 Ga0495619_0011101 3300053085 Bacteria 5664
633 Ga0495619_0068639 3300053085 Bacteria 2368
634 Ga0495619_0086203 3300053085 Bacteria 2122
635 Ga0501084_0015418 3300054114 Bacteria 6336
636 Ga0501082_0046062 3300060353 Bacteria 3760
637 Ga0501082_0115057 3300060353 Bacteria 2329
638 Ga0466962_0002063 3300061719 Bacteria 9503
639 Ga0530510_0014068 3300061734 Bacteria 5641
640 Ga0530510_0098527 3300061734 Bacteria 2137
641 Ga0070712_100007635
642 JGI24739J22299_10028814
643 JGI24738J21930_10018717
644 Ga0070658_10015905
645 Ga0070658_10016947
646 Ga0070683_100014126
647 Ga0070683_100032326
648 Ga0070683_100034966
649 Ga0070683_100121831
650 Ga0070683_100129971
651 Ga0070683_100514828
652 Ga0070670_100035459
653 Ga0070670_100310792
654 Ga0070677_10076962
655 Ga0068869_100041652
656 Ga0070680_100001821
657 Ga0070680_100028815
658 Ga0070680_100339362
659 Ga0070682_100001999
660 Ga0070682_100079002
661 Ga0068868_100051750
662 Ga0068868_100060026
663 Ga0070660_100005411
664 Ga0070660_100013879
665 Ga0070660_100024114
666 Ga0070660_100027168
667 Ga0070660_100046110
668 Ga0070660_100046950
669 Ga0070691_10018373
670 Ga0070687_100135740
671 Ga0070669_100266689
672 Ga0070669_100583378
673 Ga0070675_100042638
674 Ga0070671_100038527
675 Ga0070671_100145452
676 Ga0070674_100003374
677 Ga0070674_100111554
678 Ga0070673_100060263
679 Ga0070659_100018223
680 Ga0070659_100023749
681 Ga0070703_10015282
682 Ga0070709_10303318
683 Ga0070714_100048180
684 Ga0070714_100078992
685 Ga0070714_100164482
686 Ga0070714_100234816
687 Ga0070714_100299524
688 Ga0070714_100367450
689 Ga0070713_100477649
690 Ga0070701_10191125
691 Ga0070711_100226527
692 Ga0070705_100181094
693 Ga0070700_100055165
694 Ga0070708_100025981
695 Ga0070663_100126702
696 Ga0070663_100492408
697 Ga0070678_100060472
698 Ga0070678_100322496
699 Ga0070662_100018355
700 Ga0070662_100139103
701 Ga0070681_10002997
702 Ga0070681_10009081
703 Ga0070681_10012261
704 Ga0070681_10038403
705 Ga0070681_10038979
706 Ga0070681_10060395
707 Ga0070681_10078234
708 Ga0070681_10160837
709 Ga0070681_10267247
710 Ga0068867_100066108
711 Ga0070685_10163036
712 Ga0070707_100088735
713 Ga0070707_100229148
714 Ga0070698_100052237
715 Ga0070699_100344329
716 Ga0070699_100390143
717 Ga0070679_100017533
718 Ga0070679_100064292
719 Ga0070679_100086211
720 Ga0070679_100234251
721 Ga0070679_100274085
722 Ga0070679_100280468
723 Ga0070684_100022447
724 Ga0070684_100040845
725 Ga0070684_100181112
726 Ga0070684_100219451
727 Ga0070684_100287350
728 Ga0070684_100370011
729 Ga0068853_100217258
730 Ga0068853_100368309
731 Ga0070672_100056793
732 Ga0070686_100018134
733 Ga0070696_100066659
734 Ga0070693_100021500
735 Ga0070693_100316799
736 Ga0070665_100082694
737 Ga0070704_100024915
738 Ga0070704_100052021
739 Ga0068855_100025827
740 Ga0068855_100058058
741 Ga0068855_100206146
742 Ga0068855_100461680
743 Ga0070664_100061947
744 Ga0070664_100231726
745 Ga0070664_100393275
746 Ga0068857_100026268
747 Ga0068857_100221115
748 Ga0068854_100014289
749 Ga0068856_100132550
750 Ga0068856_100152106
751 Ga0070702_100004495
752 Ga0070702_100188782
753 Ga0068852_100003736
754 Ga0068852_100043103
755 Ga0068852_100470387
756 Ga0068864_100011671
757 Ga0068866_10017527
758 Ga0068866_10166302
759 Ga0068861_100125218
760 Ga0068861_100191041
761 Ga0068851_10014724
762 Ga0068863_100133091
763 Ga0068858_100277130
764 Ga0070717_10024957
765 Ga0070717_10464380
766 Ga0070715_10172311
767 Ga0070716_100096256
768 Ga0070712_100035246
769 Ga0070712_100140200
770 Ga0070712_100225769
771 Ga0070712_100296248
772 Ga0097621_100188384
773 Ga0068871_100040468
774 Ga0075428_100207657
775 Ga0075428_100553993
776 Ga0075433_10170640
777 Ga0068865_100016443
778 Ga0068865_100153818
779 Ga0105244_10081253
780 Ga0105240_10039720
781 Ga0105240_10171967
782 Ga0111539_10064740
783 Ga0111539_10251050
784 Ga0111539_10524669
785 Ga0111539_10928260
786 Ga0105245_10168634
787 Ga0105245_10179593
788 Ga0105245_10773344
789 Ga0105247_10009894
790 Ga0114129_10293217
791 Ga0114129_10756069
792 Ga0105243_10002451
793 Ga0105243_10115235
794 Ga0105243_10119907
795 Ga0105243_10576389
796 Ga0105241_10260673
797 Ga0105242_10016117
798 Ga0105242_10043982
799 Ga0105242_10075049
800 Ga0105248_10018986
801 Ga0105248_10211061
802 Ga0105248_10546152
803 Ga0105248_10665184
804 Ga0105237_10071550
805 Ga0105237_10713500
806 Ga0105237_10715473
807 Ga0105238_10052518
808 Ga0105238_10080572
809 Ga0105239_10286392
810 Ga0105246_10523435
811 Ga0157373_10125070
812 Ga0157371_10005827
813 Ga0157371_10201219
814 Ga0157370_10006496
815 Ga0157370_10034384
816 Ga0157369_10003204
817 Ga0157369_10007590
818 Ga0157369_10013260
819 Ga0157369_10037754
820 Ga0157369_10106314
821 Ga0157378_10666091
822 Ga0163162_10099765
823 Ga0157372_10031239
824 Ga0157372_10068961
825 Ga0157372_10079283
826 Ga0157372_10171509
827 Ga0157372_10270441
828 Ga0157372_10541901
829 Ga0157375_10046183
830 Ga0157375_10053424
831 Ga0157375_10125507
832 Ga0157375_10262542
833 Ga0163163_10127717
834 Ga0157380_10137478
835 Ga0157377_10006673
836 Ga0157377_10059652
837 Ga0157377_10169397
838 Ga0157379_10071390
839 Ga0157376_10106728
840 Ga0157376_10509218
841 Ga0163161_10049482
842 Ga0163161_10064823
843 Ga0206356_10891718
844 Ga0206354_11005491
845 Ga0207656_10072976
846 Ga0207642_10009889
847 Ga0207642_10151262
848 Ga0207688_10006489
849 Ga0207688_10171337
850 Ga0207647_10163792
851 Ga0207699_10097040
852 Ga0207645_10188511
853 Ga0207643_10017328
854 Ga0207643_10044252
855 Ga0207705_10018516
856 Ga0207705_10034624
857 Ga0207705_10059850
858 Ga0207705_10102736
859 Ga0207707_10011086
860 Ga0207707_10026623
861 Ga0207707_10038112
862 Ga0207707_10079271
863 Ga0207707_10117834
864 Ga0207707_10386292
865 Ga0207695_10052376
866 Ga0207671_10528238
867 Ga0207693_10024658
868 Ga0207693_10035532
869 Ga0207693_10119011
870 Ga0207663_10039238
871 Ga0207663_10289587
872 Ga0207660_10033723
873 Ga0207660_10039291
874 Ga0207660_10101264
875 Ga0207662_10029628
876 Ga0207657_10000184
877 Ga0207657_10001102
878 Ga0207657_10001813
879 Ga0207657_10002821
880 Ga0207657_10008652
881 Ga0207657_10015564
882 Ga0207657_10058870
883 Ga0207652_10019656
884 Ga0207652_10032721
885 Ga0207652_10034259
886 Ga0207652_10082933
887 Ga0207652_10083156
888 Ga0207652_10265297
889 Ga0207652_10284121
890 Ga0207681_10074757
891 Ga0207681_10213761
892 Ga0207681_10417063
893 Ga0207650_10169099
894 Ga0207687_10004118
895 Ga0207687_10088979
896 Ga0207700_10000004
897 Ga0207700_10290409
898 Ga0207664_10004998
899 Ga0207664_10018066
900 Ga0207664_10097287
901 Ga0207664_10103417
902 Ga0207664_10107660
903 Ga0207664_10307603
904 Ga0207644_10037980
905 Ga0207644_10111604
906 Ga0207644_10302035
907 Ga0207690_10184769
908 Ga0207706_10093156
909 Ga0207706_10167273
910 Ga0207686_10100705
911 Ga0207709_10180948
912 Ga0207670_10175985
913 Ga0207704_10068128
914 Ga0207665_10078319
915 Ga0207665_10123749
916 Ga0207691_10010073
917 Ga0207711_10362268
918 Ga0207711_10526158
919 Ga0207689_10007803
920 Ga0207689_10021216
921 Ga0207661_10018666
922 Ga0207661_10018699
923 Ga0207661_10121804
924 Ga0207661_10143294
925 Ga0207661_10163636
926 Ga0207661_10372083
927 Ga0207661_10396159
928 Ga0207679_10159654
929 Ga0207679_10202327
930 Ga0207667_10022396
931 Ga0207667_10103617
932 Ga0207667_10269191
933 Ga0207667_10487150
934 Ga0207668_10461660
935 Ga0207640_10015218
936 Ga0207640_10084087
937 Ga0207640_10437841
938 Ga0207639_10162059
939 Ga0207639_10243361
940 Ga0207639_10361080
941 Ga0207678_10035141
942 Ga0207678_10264978
943 Ga0207678_10337564
944 Ga0207708_10049570
945 Ga0207702_10062790
946 Ga0207641_10210921
947 Ga0207648_10052637
948 Ga0207674_10029668
949 Ga0207674_10181245
950 Ga0207675_100057982
951 Ga0207675_100439433
952 Ga0207683_10025396
953 Ga0207683_10032826
954 Ga0207698_10141839
955 Ga0207428_10106398
956 Ga0207428_10284644
957 Ga0268266_10258902
958 Ga0265338_10003587
959 Ga0265330_10041187
960 Ga0265327_10004631
961 Ga0265327_10054116
962 Ga0307408_100103172
963 Ga0265314_10011243
964 Ga0265342_10058878
965 Ga0307416_100357982
966 Ga0373944_0001625
967 Ga0373952_0044233
968 Ga0373936_0040501
969 Ga0373945_0020198
970 Ga0373943_0040205
971 Ga0373943_0068118
972 Ga0373943_0186407
973 Ga0373946_0031637
974 Ga0373961_0004830
975 Ga0373935_0037579
976 Ga0373935_0097691
977 Ga0373947_0021137
978 Ga0373947_0091658
979 Ga0373937_0056645
980 Ga0373925_0021198
981 Ga0373925_0108675
982 Ga0395899_0015874
983 Ga0395899_0017639
984 Ga0395899_0026619
985 Ga0395899_0085343
986 Ga0395899_0118461
987 Ga0395900_0031296
988 Ga0395900_0041601
989 Ga0395900_0228178
990 Ga0395900_0292732
991 Ga0395900_0296783
992 Ga0395898_0002551
993 Ga0395898_0002750
994 Ga0395898_0003518
995 Ga0395898_0008370
996 Ga0395898_0018405
997 Ga0395898_0056987
998 Ga0395898_0139869
999 Ga0395898_0367935
1000 Ga0395898_0807330
1001 Ga0395905_0003194
1002 Ga0395905_0029723
1003 Ga0395905_0104208
1004 Ga0395905_0321730
1005 Ga0395905_0361459
1006 Ga0395901_0002628
1007 Ga0395901_0007364
1008 Ga0395901_0013761
1009 Ga0395901_0053763
1010 Ga0395901_0060477
1011 Ga0395901_0103066
1012 Ga0395901_0171890
1013 Ga0436365_1897806
1014 Ga0436363_0735095
1015 Ga0451795_0239597
1016 Ga0451807_1325858
1017 Ga0451849_0911131
1018 Ga0450906_016223
1019 Ga0439458_0013433
1020 Ga0450901_010079
1021 Ga0466965_0053099
1022 Ga0466966_0001789
1023 Ga0466966_0007034
1024 Ga0466966_0053195
1025 Ga0466966_0086931
1026 Ga0466961_0000987
1027 Ga0466961_0183459
1028 Ga0466961_0299975
1029 Ga0466963_0021458
1030 Ga0466963_0037151
1031 Ga0466963_0083023
1032 Ga0466963_0117670
1033 Ga0466971_0000626
1034 Ga0466971_0127469
1035 Ga0466968_0029284
1036 Ga0466970_0087233
1037 Ga0466957_0025962
1038 Ga0466957_0166601
1039 Ga0466960_0111096
1040 Ga0466960_0169418
1041 Ga0466959_0005013
1042 Ga0466959_0011239
1043 Ga0466959_0080800
1044 Ga0451576_0273178
1045 Ga0466958_0007140
1046 Ga0466958_0029238
1047 Ga0466958_0034040
1048 Ga0466967_0000517
1049 Ga0466967_0006542
1050 Ga0466967_0009114
1051 Ga0466967_0048641
1052 Ga0466967_0054518
1053 Ga0466967_0114560
1054 Ga0466967_0139096
1055 Ga0466967_0335028
1056 Ga0466967_0351658
1057 Ga0466967_0492127
1058 Ga0495592_0156530
1059 Ga0495603_0097478
1060 Ga0495629_0000769
1061 Ga0495629_0073701
1062 Ga0495629_0112372
1063 Ga0495629_0112829
1064 Ga0495629_0197731
1065 Ga0495641_0000416
1066 Ga0495641_0063902
1067 Ga0495641_0087234
1068 Ga0495641_0095174
1069 Ga0495651_0005047
1070 Ga0495651_0081857
1071 Ga0495651_0088107
1072 Ga0495651_0282272
1073 Ga0495653_0242159
1074 Ga0495582_0007390
1075 Ga0495639_0003265
1076 Ga0495662_0072958
1077 Ga0495664_0009790
1078 Ga0495608_0016345
1079 Ga0495608_0019890
1080 Ga0495608_0110392
1081 Ga0495618_0120776
1082 Ga0495628_0286320
1083 Ga0495630_0061003
1084 Ga0495630_0080398
1085 Ga0495630_0190563
1086 Ga0495652_0020731
1087 Ga0495652_0149802
1088 Ga0495665_0048472
1089 Ga0495640_0048738
1090 Ga0495640_0057971
1091 Ga0495640_0070983
1092 Ga0495640_0094791
1093 Ga0495587_0071751
1094 Ga0495587_0096677
1095 Ga0495667_0022614
1096 Ga0495667_0074126
1097 Ga0495634_0325716
1098 Ga0495635_0034363
1099 Ga0495635_0094182
1100 Ga0495635_0103021
1101 Ga0495635_0257929
1102 Ga0495659_0101754
1103 Ga0495599_0031639
1104 Ga0495599_0085926
1105 Ga0495623_0065995
1106 Ga0495646_0049513
1107 Ga0495647_0021319
1108 Ga0495658_0002845
1109 Ga0495658_0195370
1110 Ga0495613_0008571
1111 Ga0495613_0044551
1112 Ga0495613_0139239
1113 Ga0495624_0026650
1114 Ga0495600_0019083
1115 Ga0495600_0148575
1116 Ga0495581_0001888
1117 Ga0495604_0189867
1118 Ga0495604_0225855
1119 Ga0495674_0002574
1120 Ga0495674_0017016
1121 Ga0495674_0036268
1122 Ga0495674_0235115
1123 Ga0495674_0432725
1124 Ga0495676_0002838
1125 Ga0495680_0005259
1126 Ga0495680_0036305
1127 Ga0495680_0072709
1128 Ga0495680_0213295
1129 Ga0495675_0121348
1130 Ga0495684_0021862
1131 Ga0495684_0140987
1132 Ga0495593_0052361
1133 Ga0495602_0024643
1134 Ga0495602_0128275
1135 Ga0495614_0008887
1136 Ga0496100_0014126
1137 Ga0496100_0023759
1138 Ga0496100_0076801
1139 Ga0496100_0107455
1140 Ga0496100_0420506
1141 Ga0496101_0015904
1142 Ga0496101_0046814
1143 Ga0496101_0110487
1144 Ga0496101_0210987
1145 Ga0496102_0005054
1146 Ga0496102_0016291
1147 Ga0496102_0057754
1148 Ga0496103_0119230
1149 Ga0496104_0001220
1150 Ga0496104_0010674
1151 Ga0496104_0138121
1152 Ga0496104_0192604
1153 Ga0496104_0226447
1154 Ga0496105_0005256
1155 Ga0496105_0013286
1156 Ga0496105_0052460
1157 Ga0496105_0071273
1158 Ga0496105_0166936
1159 Ga0496105_0213207
1160 Ga0496105_0439986
1161 Ga0496106_0023223
1162 Ga0496106_0120379
1163 Ga0496106_0177093
1164 Ga0496106_0266048
1165 Ga0496107_0022695
1166 Ga0496108_0006994
1167 Ga0496108_0146040
1168 Ga0496108_0333198
1169 Ga0496109_0001867
1170 Ga0496109_0025360
1171 Ga0496109_0039951
1172 Ga0496109_0256434
1173 Ga0496110_0000789
1174 Ga0496110_0009470
1175 Ga0496110_0363934
1176 Ga0496111_0020847
1177 Ga0496111_0028582
1178 Ga0496111_0077442
1179 Ga0496111_0133045
1180 Ga0496112_0004745
1181 Ga0496112_0028006
1182 Ga0496112_0031521
1183 Ga0496112_0033426
1184 Ga0496112_0127220
1185 Ga0496112_0367059
1186 Ga0496113_0226963
1187 Ga0496114_0004135
1188 Ga0496114_0021601
1189 Ga0496114_0038561
1190 Ga0496114_0107831
1191 Ga0496114_0174793
1192 Ga0496114_0329419
1193 Ga0496114_0432692
1194 Ga0496114_0475211
1195 Ga0496115_0012193
1196 Ga0496115_0016676
1197 Ga0496115_0153938
1198 Ga0496115_0362581
1199 Ga0501031_0044463
1200 Ga0501031_0049191
1201 Ga0501033_0010795
1202 Ga0501036_0044140
1203 Ga0501036_0118634
1204 Ga0501038_0007471
1205 Ga0501038_0115656
1206 Ga0501039_0008698
1207 Ga0501040_0026956
1208 Ga0501040_0056751
1209 Ga0501041_0005359
1210 Ga0501042_0046637
1211 Ga0501042_0096730
1212 Ga0501043_0035987
1213 Ga0501046_0041443
1214 Ga0501047_0042837
1215 Ga0501047_0247970
1216 Ga0501048_0037529
1217 Ga0501048_0058281
1218 Ga0501067_0015442
1219 Ga0501067_0162192
1220 Ga0501068_0050778
1221 Ga0501068_0123232
1222 Ga0501068_0210441
1223 Ga0501069_0058586
1224 Ga0501069_0063765
1225 Ga0501069_0086770
1226 Ga0501070_0095607
1227 Ga0501070_0221305
1228 Ga0501070_0221987
1229 Ga0501071_0034415
1230 Ga0501071_0036159
1231 Ga0501072_0015333
1232 Ga0501072_0049517
1233 Ga0501073_0039037
1234 Ga0501074_0024457
1235 Ga0501074_0073320
1236 Ga0501075_0016149
1237 Ga0501075_0034336
1238 Ga0501076_0034879
1239 Ga0501076_0073517
1240 Ga0501077_0004335
1241 Ga0501077_0005854
1242 Ga0501079_0007567
1243 Ga0501079_0101981
1244 Ga0501079_0458960
1245 Ga0501080_0051967
1246 Ga0501080_0244475
1247 Ga0501080_0262280
1248 Ga0501080_0428149
1249 Ga0501081_0089555
1250 Ga0501081_0103950
1251 Ga0501083_0079041
1252 Ga0501035_0009056
1253 Ga0501044_0138506
1254 Ga0501045_0008053
1255 Ga0501045_0046110
1256 nmdc:mga03n38_107499_c1
1257 nmdc:mga08y16_185060_c1
1258 nmdc:mga08y16_210332_c1
1259 nmdc:mga08y16_233519_c1
1260 nmdc:mga08y16_507635_c1
1261 nmdc:mga0n895_290391_c1
1262 nmdc:mga0n895_44742_c1
1263 nmdc:mga0rr50_225113_c1
1264 nmdc:mga08x19_84286_c1
1265 nmdc:mga0a205_28388_c1
1266 Ga0495601_0051726
1267 Ga0495612_0009586
1268 Ga0495612_0033345
1269 Ga0495655_0021544
1270 Ga0495595_0009208
1271 Ga0495595_0045800
1272 Ga0495619_0011101
1273 Ga0495619_0068639
1274 Ga0495619_0086203
1275 Ga0501084_0015418
1276 Ga0501082_0046062
1277 Ga0501082_0115057
1278 Ga0466962_0002063
1279 Ga0530510_0014068
1280 Ga0530510_0098527

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

95

283

0.84

Map