F471637

General Info

Members Datasets Scaffolds Average Seq Length
639 283 625 300

Family's Representative Sequence

Representative Sequence 3300046530|Ga0495654_0001760|Ga0495654_0001760_9385_10443
Length 352
Sequence LFRNGNASETVIFPLGQATMTRRRQFRTADGSEDKMATQFNFEHSAVRSQFLTDSFQRGLAHWNRERLRPALPCDTWRRALERDTRMLRLEGAFLEELRLGVVAEAARAPRDATGFVAWFEDLRENGRGQNDPLFPWLAEHATRDELRWFFEQEAAGEAGFDDLVAYTQIKMPIRPKLELSRNYWDEMGRGNLAGVHGLMLDILVETLEVQPAIPTTVWESLALANAMTAMATSRRYAWHSVGALGVIELTAPGRSASVAAGLRRIGLSGKQRRYFDLHAVLDIKHSTEWNAEILFPAVSEDPARGQAIAEGALIRLQCGERCFDRYRTHLWEGTGRSQSFRRTRMVATQAP

Samples

Sample ID Description Type Environment
1 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
2 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
3 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
4 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
5 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
6 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
7 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
8 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
9 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
10 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
11 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
12 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
13 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
14 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
15 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
16 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
17 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
18 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
19 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
20 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
21 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
22 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
23 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
24 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
25 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
26 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
27 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
28 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
29 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
30 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
31 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
32 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
33 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
34 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
35 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
36 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
37 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
38 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
39 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
40 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
41 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
42 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
43 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
44 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
45 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
46 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
47 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
48 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
49 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
50 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
51 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
52 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
53 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
54 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
55 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
56 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
57 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
58 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
63 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
64 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
65 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
66 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
67 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
68 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
69 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
70 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
71 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
72 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
73 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
74 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
75 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
122 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
123 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
124 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
126 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
127 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
132 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
134 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
136 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
185 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
186 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
187 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
188 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
193 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
194 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
195 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
196 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
199 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
200 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
201 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
202 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
203 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
204 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
205 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
206 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
207 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
208 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
209 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
210 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
211 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
212 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
213 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
214 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
215 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
216 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
217 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
218 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
219 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
220 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
221 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
222 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
223 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
224 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
225 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
226 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
227 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
228 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
229 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
230 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
231 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
232 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
233 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
234 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
237 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
238 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
239 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
244 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
245 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
246 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
247 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
248 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
249 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
250 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
251 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
252 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
253 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
254 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
255 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
256 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
260 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
261 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
262 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
263 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
264 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
265 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
266 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
267 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
268 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
269 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
270 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
271 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
272 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
273 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
274 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
275 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
276 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
277 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
278 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
279 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
280 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
281 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
282 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
283 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.5
Metatranscriptomes 0.31
Isolates 2.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.15
Nodule 0
Rhizoplane 3.91
Rhizosphere 75.59
Stem 0
Stem Tuber 0
Unclassified 7.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000009 3300001904 Bacteria 35855
2 JGI24741J21665_1007124 3300001915 Bacteria 2191
3 JGI24752J21851_1000050 3300001976 Bacteria 14615
4 JGI24740J21852_10010195 3300001979 Bacteria 3632
5 JGI24739J22299_10038711 3300001989 Bacteria 1601
6 JGI24739J22299_10041907 3300001989 Bacteria 1520
7 JGI24737J22298_10007618 3300001990 Bacteria 3647
8 JGI24737J22298_10012165 3300001990 Bacteria 2807
9 JGI24743J22301_10008836 3300001991 Bacteria 1775
10 JGI24735J21928_10000718 3300002067 Bacteria 11757
11 JGI24735J21928_10002287 3300002067 Bacteria 6682
12 JGI24735J21928_10003851 3300002067 Bacteria 5078
13 JGI24735J21928_10005230 3300002067 Bacteria 4313
14 JGI24735J21928_10014732 3300002067 Bacteria 2447
15 JGI24735J21928_10027713 3300002067 Bacteria 1696
16 JGI24750J21931_1000069 3300002070 Bacteria 15037
17 JGI24748J21848_1000066 3300002074 Bacteria 39384
18 JGI24738J21930_10000786 3300002075 Bacteria 9083
19 JGI24738J21930_10001035 3300002075 Bacteria 7922
20 JGI24738J21930_10002257 3300002075 Bacteria 5107
21 JGI24749J21850_1001470 3300002076 Bacteria 3330
22 JGI24744J21845_10002036 3300002077 Bacteria 4096
23 JGI24034J26672_10000015 3300002239 Bacteria 137655
24 JGI24751J29686_10000054 3300002459 Bacteria 65209
25 JGI24751J29686_10000291 3300002459 Bacteria 19080
26 JGI25150J39212_1000717 3300002774 Bacteria 11871
27 JGI25150J39212_1001280 3300002774 Bacteria 7194
28 JGI25151J46595_10010967 3300003187 Bacteria 4188
29 JGI25165J46597_1000112 3300003214 Bacteria 147097
30 JGI25153J46596_10000183 3300003215 Bacteria 61802
31 JGI25153J46596_10002050 3300003215 Bacteria 11872
32 rootH2_10112808 3300003320 Bacteria 1293
33 rootL2_10047630 3300003322 Bacteria 3536
34 Ga0055537_1000848 3300003773 Bacteria 14862
35 Ga0055537_1003838 3300003773 Bacteria 4497
36 Ga0055530_10011102 3300003791 Bacteria 3264
37 Ga0055530_10013222 3300003791 Bacteria 2826
38 Ga0055530_10034255 3300003791 Bacteria 1299
39 Ga0055540_1000185 3300003792 Bacteria 60356
40 Ga0055531_10000073 3300003794 Bacteria 109510
41 Ga0055531_10000088 3300003794 Bacteria 100973
42 Ga0055531_10012567 3300003794 Bacteria 3972
43 Ga0065165_1003262 3300005262 Bacteria 11713
44 Ga0070658_10000089 3300005327 Bacteria 83791
45 Ga0070658_10001860 3300005327 Bacteria 17781
46 Ga0070658_10002861 3300005327 Bacteria 14332
47 Ga0070658_10007939 3300005327 Bacteria 8543
48 Ga0070658_10014655 3300005327 Bacteria 6290
49 Ga0070658_10026070 3300005327 Bacteria 4689
50 Ga0070658_10056600 3300005327 Bacteria 3188
51 Ga0070658_10087735 3300005327 Bacteria 2561
52 Ga0070658_10224410 3300005327 Bacteria 1590
53 Ga0070676_10000273 3300005328 Bacteria 22756
54 Ga0070690_100000025 3300005330 Bacteria 69409
55 Ga0070670_100000003 3300005331 Bacteria 529510
56 Ga0070670_100013049 3300005331 Bacteria 7116
57 Ga0070670_100043150 3300005331 Bacteria 3877
58 Ga0070670_100258340 3300005331 Bacteria 1518
59 Ga0068869_100001713 3300005334 Bacteria 13097
60 Ga0070666_10000015 3300005335 Bacteria 208372
61 Ga0070666_10012707 3300005335 Bacteria 5321
62 Ga0068868_100000023 3300005338 Bacteria 85334
63 Ga0070660_100000395 3300005339 Bacteria 28996
64 Ga0070660_100005483 3300005339 Bacteria 8790
65 Ga0070660_100031097 3300005339 Bacteria 4007
66 Ga0070660_100043923 3300005339 Bacteria 3416
67 Ga0070660_100056089 3300005339 Bacteria 3047
68 Ga0070660_100082477 3300005339 Bacteria 2525
69 Ga0070660_100159350 3300005339 Bacteria 1818
70 Ga0070689_100177108 3300005340 Bacteria 1730
71 Ga0070661_100000001 3300005344 Bacteria 424830
72 Ga0070661_100003899 3300005344 Bacteria 10265
73 Ga0070661_100199509 3300005344 Bacteria 1528
74 Ga0070661_100292769 3300005344 Bacteria 1265
75 Ga0070668_100000058 3300005347 Bacteria 69744
76 Ga0070668_100000871 3300005347 Bacteria 20995
77 Ga0070668_100006974 3300005347 Bacteria 8371
78 Ga0070668_100009791 3300005347 Bacteria 7106
79 Ga0070668_100058590 3300005347 Bacteria 2980
80 Ga0070668_100100637 3300005347 Bacteria 2290
81 Ga0070669_100000049 3300005353 Bacteria 115183
82 Ga0070669_100000059 3300005353 Bacteria 108504
83 Ga0070669_100045337 3300005353 Bacteria 3204
84 Ga0070669_100156971 3300005353 Bacteria 1765
85 Ga0070669_100258172 3300005353 Bacteria 1390
86 Ga0070675_100005402 3300005354 Bacteria 9769
87 Ga0070671_100000596 3300005355 Bacteria 25831
88 Ga0070671_100000769 3300005355 Bacteria 23061
89 Ga0070671_100003748 3300005355 Bacteria 11935
90 Ga0070673_100000001 3300005364 Bacteria 239842
91 Ga0070673_100036299 3300005364 Bacteria 3744
92 Ga0070688_100003242 3300005365 Bacteria 8341
93 Ga0070659_100294471 3300005366 Bacteria 1352
94 Ga0070667_100000019 3300005367 Bacteria 224710
95 Ga0070667_100002399 3300005367 Bacteria 16403
96 Ga0070667_100014765 3300005367 Bacteria 6452
97 Ga0070667_100033180 3300005367 Bacteria 4312
98 Ga0070667_100206806 3300005367 Bacteria 1743
99 Ga0070663_100000781 3300005455 Bacteria 17354
100 Ga0070663_100007003 3300005455 Bacteria 6829
101 Ga0070678_100036691 3300005456 Bacteria 3433
102 Ga0070662_100303745 3300005457 Bacteria 1297
103 Ga0070662_100544865 3300005457 Bacteria 972
104 Ga0070681_10018969 3300005458 Bacteria 6885
105 Ga0068867_100000027 3300005459 Bacteria 90445
106 Ga0070685_10000297 3300005466 Bacteria 31390
107 Ga0070679_100000025 3300005530 Bacteria 118724
108 Ga0070679_100012883 3300005530 Bacteria 8005
109 Ga0070679_100413237 3300005530 Bacteria 1295
110 Ga0070684_100248718 3300005535 Bacteria 1625
111 Ga0068853_100002147 3300005539 Bacteria 14677
112 Ga0068853_100024873 3300005539 Bacteria 5023
113 Ga0068853_100041919 3300005539 Bacteria 3912
114 Ga0068853_100125456 3300005539 Bacteria 2293
115 Ga0068853_100149069 3300005539 Bacteria 2104
116 Ga0068853_100314894 3300005539 Bacteria 1450
117 Ga0070672_100166188 3300005543 Bacteria 1833
118 Ga0070672_100277166 3300005543 Bacteria 1417
119 Ga0070686_100000006 3300005544 Bacteria 243316
120 Ga0070665_100000217 3300005548 Bacteria 97947
121 Ga0070665_100000432 3300005548 Bacteria 61004
122 Ga0070665_100004395 3300005548 Bacteria 14826
123 Ga0070665_100066493 3300005548 Bacteria 3616
124 Ga0068855_100000092 3300005563 Bacteria 107195
125 Ga0068855_100003616 3300005563 Bacteria 18897
126 Ga0068855_100013002 3300005563 Bacteria 10044
127 Ga0068855_100049683 3300005563 Bacteria 4946
128 Ga0068855_100050702 3300005563 Bacteria 4890
129 Ga0068855_100259763 3300005563 Bacteria 1935
130 Ga0068855_100292032 3300005563 Bacteria 1807
131 Ga0068855_100333623 3300005563 Bacteria 1674
132 Ga0068855_100538335 3300005563 Bacteria 1265
133 Ga0070664_100001213 3300005564 Bacteria 20558
134 Ga0070664_100116401 3300005564 Bacteria 2337
135 Ga0068857_100119456 3300005577 Bacteria 2372
136 Ga0068857_100182624 3300005577 Bacteria 1909
137 Ga0068854_100000359 3300005578 Bacteria 29216
138 Ga0068854_100000684 3300005578 Bacteria 20204
139 Ga0068854_100072591 3300005578 Bacteria 2520
140 Ga0068854_100109932 3300005578 Bacteria 2077
141 Ga0068854_100276738 3300005578 Bacteria 1350
142 Ga0068854_100425282 3300005578 Bacteria 1104
143 Ga0068856_100022467 3300005614 Bacteria 6133
144 Ga0068856_100047623 3300005614 Bacteria 4224
145 Ga0068856_100061877 3300005614 Bacteria 3697
146 Ga0068856_100408516 3300005614 Bacteria 1377
147 Ga0068852_100000619 3300005616 Bacteria 23305
148 Ga0068852_100000679 3300005616 Bacteria 22324
149 Ga0068852_100001858 3300005616 Bacteria 14364
150 Ga0068852_100097188 3300005616 Bacteria 2649
151 Ga0068852_100118527 3300005616 Unclassified 2419
152 Ga0068852_100142304 3300005616 Bacteria 2221
153 Ga0068852_100297297 3300005616 Bacteria 1561
154 Ga0068852_100490974 3300005616 Bacteria 1221
155 Ga0068859_100005160 3300005617 Bacteria 13267
156 Ga0068859_100017939 3300005617 Bacteria 7113
157 Ga0068864_100000005 3300005618 Bacteria 400840
158 Ga0068864_100010503 3300005618 Bacteria 7652
159 Ga0068864_100100756 3300005618 Unclassified 2561
160 Ga0068861_100004083 3300005719 Bacteria 9787
161 Ga0068861_100012847 3300005719 Bacteria 5848
162 Ga0068851_10020930 3300005834 Bacteria 3172
163 Ga0068851_10054392 3300005834 Bacteria 2039
164 Ga0068851_10146254 3300005834 Bacteria 1289
165 Ga0068863_100000012 3300005841 Bacteria 229774
166 Ga0068863_100000063 3300005841 Bacteria 118269
167 Ga0068863_100000108 3300005841 Bacteria 87921
168 Ga0068863_100000635 3300005841 Bacteria 35541
169 Ga0068863_100003594 3300005841 Bacteria 15302
170 Ga0068863_100568024 3300005841 Bacteria 1121
171 Ga0068858_100000138 3300005842 Bacteria 77033
172 Ga0068858_100000582 3300005842 Bacteria 38264
173 Ga0068858_100001300 3300005842 Bacteria 25802
174 Ga0068860_100000008 3300005843 Bacteria 427367
175 Ga0068860_100000042 3300005843 Bacteria 227404
176 Ga0068860_100000050 3300005843 Bacteria 208372
177 Ga0068860_100000573 3300005843 Bacteria 44277
178 Ga0068860_100072849 3300005843 Bacteria 3265
179 Ga0068862_100000001 3300005844 Bacteria 523031
180 Ga0068862_100000062 3300005844 Bacteria 126792
181 Ga0068862_100000660 3300005844 Bacteria 35378
182 Ga0075364_10040314 3300006051 Bacteria 3028
183 Ga0075366_10015689 3300006195 Bacteria 4348
184 Ga0075366_10089611 3300006195 Bacteria 1843
185 Ga0075370_10003349 3300006353 Bacteria 7616
186 Ga0075370_10062891 3300006353 Bacteria 2115
187 Ga0068871_100018441 3300006358 Bacteria 5304
188 Ga0068871_100114841 3300006358 Unclassified 2269
189 Ga0068865_100000030 3300006881 Bacteria 88854
190 Ga0068865_100067282 3300006881 Bacteria 2530
191 Ga0097620_100005160 3300006931 Bacteria 13267
192 Ga0097620_100017941 3300006931 Bacteria 7113
193 Ga0105240_10047881 3300009093 Bacteria 5407
194 Ga0105240_10131661 3300009093 Bacteria 2999
195 Ga0105240_10375205 3300009093 Bacteria 1607
196 Ga0105245_10008944 3300009098 Bacteria 8737
197 Ga0105247_10004563 3300009101 Bacteria 8831
198 Ga0105243_10000389 3300009148 Bacteria 46747
199 Ga0105241_10026726 3300009174 Bacteria 4296
200 Ga0105242_10008704 3300009176 Bacteria 7787
201 Ga0105248_10019086 3300009177 Bacteria 7582
202 Ga0105248_10077072 3300009177 Bacteria 3747
203 Ga0105248_10170304 3300009177 Bacteria 2454
204 Ga0105248_10212649 3300009177 Bacteria 2179
205 Ga0105237_10036476 3300009545 Bacteria 4975
206 Ga0105237_10041638 3300009545 Bacteria 4632
207 Ga0105237_10180984 3300009545 Bacteria 2108
208 Ga0105238_10003375 3300009551 Bacteria 15935
209 Ga0105238_10096853 3300009551 Bacteria 2936
210 Ga0105238_10143257 3300009551 Bacteria 2366
211 Ga0105249_10000034 3300009553 Bacteria 208378
212 Ga0105249_10003540 3300009553 Bacteria 13504
213 Ga0105249_10017619 3300009553 Bacteria 6342
214 Ga0105249_10037725 3300009553 Bacteria 4384
215 Ga0105249_10314151 3300009553 Bacteria 1576
216 Ga0105148_103213 3300009978 Bacteria 1157
217 Ga0105239_10002815 3300010375 Bacteria 21750
218 Ga0105239_10008242 3300010375 Bacteria 11884
219 Ga0105239_10116932 3300010375 Bacteria 2959
220 Ga0105246_10001451 3300011119 Bacteria 14059
221 Ga0157326_1000187 3300012513 Bacteria 6975
222 Ga0157373_10001067 3300013100 Bacteria 21059
223 Ga0157373_10029409 3300013100 Bacteria 3958
224 Ga0157373_10156076 3300013100 Bacteria 1605
225 Ga0157371_10057528 3300013102 Bacteria 2757
226 Ga0157370_10000213 3300013104 Bacteria 73863
227 Ga0157370_10000377 3300013104 Bacteria 56059
228 Ga0157370_10012920 3300013104 Bacteria 8631
229 Ga0157370_10034274 3300013104 Bacteria 4945
230 Ga0157369_10014696 3300013105 Bacteria 8832
231 Ga0157369_10028725 3300013105 Bacteria 6151
232 Ga0157369_10037278 3300013105 Bacteria 5323
233 Ga0157369_10137799 3300013105 Bacteria 2583
234 Ga0157374_10004957 3300013296 Bacteria 11172
235 Ga0157374_10042871 3300013296 Bacteria 4177
236 Ga0157378_10005590 3300013297 Bacteria 11012
237 Ga0157372_10002249 3300013307 Bacteria 20957
238 Ga0157372_10030216 3300013307 Bacteria 5925
239 Ga0157372_10085010 3300013307 Bacteria 3588
240 Ga0157372_10279167 3300013307 Bacteria 1942
241 Ga0157375_10019153 3300013308 Bacteria 6217
242 Ga0163163_10012276 3300014325 Bacteria 7801
243 Ga0157380_10005251 3300014326 Bacteria 9049
244 Ga0157377_10014544 3300014745 Bacteria 4006
245 Ga0157379_10023993 3300014968 Bacteria 5414
246 Ga0157376_10000145 3300014969 Bacteria 48872
247 Ga0183363_1003 3300015690 Bacteria 421263
248 Ga0163161_10000051 3300017792 Bacteria 122360
249 Ga0163161_10046298 3300017792 Bacteria 3138
250 Ga0206356_10079795 3300020070 Bacteria 5947
251 Ga0213876_10000004 3300021384 Bacteria 943822
252 Ga0213876_10010373 3300021384 Bacteria 5002
253 Ga0207427_102069 3300025231 Bacteria 5937
254 Ga0207425_1000005 3300025245 Bacteria 900502
255 Ga0207425_1000358 3300025245 Bacteria 31539
256 Ga0209148_1000133 3300025254 Bacteria 171351
257 Ga0209148_1003245 3300025254 Bacteria 4623
258 Ga0209129_1000526 3300025258 Bacteria 26748
259 Ga0209129_1001181 3300025258 Bacteria 15025
260 Ga0209233_1000078 3300025261 Bacteria 348118
261 Ga0209565_1000044 3300025263 Bacteria 229969
262 Ga0209455_1001477 3300025272 Bacteria 10575
263 Ga0209673_1012060 3300025273 Bacteria 3513
264 Ga0209673_1015836 3300025273 Bacteria 2844
265 Ga0209676_1000288 3300025292 Bacteria 103217
266 Ga0209676_1017157 3300025292 Bacteria 2575
267 Ga0209025_1000128 3300025294 Bacteria 198859
268 Ga0209025_1000202 3300025294 Bacteria 145750
269 Ga0209564_1000378 3300025295 Bacteria 81676
270 Ga0209564_1004768 3300025295 Bacteria 8099
271 Ga0209758_1000002 3300025297 Bacteria 1400310
272 Ga0209758_1000763 3300025297 Bacteria 46387
273 Ga0209050_1000001 3300025298 Bacteria 3563507
274 Ga0209050_1000010 3300025298 Bacteria 980454
275 Ga0209050_1010583 3300025298 Bacteria 4520
276 Ga0209050_1013813 3300025298 Bacteria 3547
277 Ga0207426_1008714 3300025302 Bacteria 4065
278 Ga0209051_1000209 3300025303 Bacteria 102832
279 Ga0209051_1031200 3300025303 Bacteria 2055
280 Ga0209257_1000027 3300025304 Bacteria 703541
281 Ga0209257_1000111 3300025304 Bacteria 234809
282 Ga0209257_1002519 3300025304 Bacteria 18001
283 Ga0209257_1032792 3300025304 Bacteria 1642
284 Ga0207656_10003640 3300025321 Bacteria 5323
285 Ga0207656_10009353 3300025321 Bacteria 3638
286 Ga0207656_10036960 3300025321 Bacteria 2052
287 Ga0207656_10106249 3300025321 Bacteria 1292
288 Ga0207680_10000007 3300025903 Bacteria 623574
289 Ga0207680_10071182 3300025903 Bacteria 2155
290 Ga0207647_10001490 3300025904 Bacteria 17990
291 Ga0207647_10002241 3300025904 Bacteria 14733
292 Ga0207647_10014781 3300025904 Bacteria 5369
293 Ga0207647_10019114 3300025904 Bacteria 4613
294 Ga0207647_10031922 3300025904 Bacteria 3387
295 Ga0207645_10001531 3300025907 Bacteria 18888
296 Ga0207705_10000004 3300025909 Bacteria 705756
297 Ga0207705_10000018 3300025909 Bacteria 319792
298 Ga0207705_10000140 3300025909 Bacteria 78223
299 Ga0207705_10000501 3300025909 Bacteria 33386
300 Ga0207705_10031238 3300025909 Bacteria 3800
301 Ga0207705_10038357 3300025909 Bacteria 3430
302 Ga0207705_10047112 3300025909 Bacteria 3099
303 Ga0207705_10196371 3300025909 Bacteria 1528
304 Ga0207654_10010935 3300025911 Bacteria 4621
305 Ga0207695_10003039 3300025913 Bacteria 24047
306 Ga0207695_10006157 3300025913 Bacteria 15640
307 Ga0207695_10027764 3300025913 Bacteria 6297
308 Ga0207695_10028622 3300025913 Bacteria 6171
309 Ga0207695_10035780 3300025913 Bacteria 5378
310 Ga0207671_10000658 3300025914 Bacteria 45037
311 Ga0207671_10023011 3300025914 Bacteria 4703
312 Ga0207657_10002796 3300025919 Bacteria 18786
313 Ga0207657_10004427 3300025919 Bacteria 14864
314 Ga0207657_10011895 3300025919 Bacteria 8612
315 Ga0207657_10020658 3300025919 Bacteria 6218
316 Ga0207657_10059233 3300025919 Bacteria 3292
317 Ga0207657_10065785 3300025919 Bacteria 3089
318 Ga0207657_10086401 3300025919 Bacteria 2625
319 Ga0207657_10089779 3300025919 Bacteria 2566
320 Ga0207649_10000018 3300025920 Bacteria 225137
321 Ga0207652_10000042 3300025921 Bacteria 130485
322 Ga0207652_10003061 3300025921 Bacteria 13962
323 Ga0207652_10030072 3300025921 Bacteria 4546
324 Ga0207652_10383643 3300025921 Bacteria 1268
325 Ga0207681_10000005 3300025923 Bacteria 555724
326 Ga0207681_10000089 3300025923 Bacteria 79526
327 Ga0207681_10008485 3300025923 Bacteria 6279
328 Ga0207681_10049644 3300025923 Bacteria 2837
329 Ga0207694_10001347 3300025924 Bacteria 21148
330 Ga0207650_10000004 3300025925 Bacteria 743372
331 Ga0207650_10011464 3300025925 Bacteria 6102
332 Ga0207644_10000070 3300025931 Bacteria 74994
333 Ga0207644_10000089 3300025931 Bacteria 65175
334 Ga0207644_10008514 3300025931 Bacteria 6712
335 Ga0207644_10098122 3300025931 Bacteria 2195
336 Ga0207690_10014596 3300025932 Bacteria 4745
337 Ga0207690_10312392 3300025932 Bacteria 1233
338 Ga0207706_10013575 3300025933 Bacteria 7400
339 Ga0207706_10019069 3300025933 Bacteria 6171
340 Ga0207706_10026390 3300025933 Bacteria 5200
341 Ga0207706_10138359 3300025933 Bacteria 2142
342 Ga0207686_10004004 3300025934 Bacteria 7908
343 Ga0207709_10000432 3300025935 Bacteria 40012
344 Ga0207670_10121888 3300025936 Bacteria 1897
345 Ga0207704_10000032 3300025938 Bacteria 108408
346 Ga0207691_10107251 3300025940 Bacteria 2487
347 Ga0207691_10237096 3300025940 Bacteria 1578
348 Ga0207711_10002399 3300025941 Bacteria 16740
349 Ga0207711_10117061 3300025941 Bacteria 2376
350 Ga0207711_10393773 3300025941 Bacteria 1286
351 Ga0207689_10000108 3300025942 Bacteria 68132
352 Ga0207679_10011015 3300025945 Bacteria 5837
353 Ga0207667_10000013 3300025949 Bacteria 435875
354 Ga0207667_10003455 3300025949 Bacteria 19507
355 Ga0207667_10003691 3300025949 Bacteria 18874
356 Ga0207667_10009398 3300025949 Bacteria 11521
357 Ga0207667_10051393 3300025949 Bacteria 4346
358 Ga0207667_10096687 3300025949 Bacteria 3048
359 Ga0207667_10108763 3300025949 Bacteria 2860
360 Ga0207667_10229111 3300025949 Bacteria 1903
361 Ga0207651_10000001 3300025960 Bacteria 516823
362 Ga0207651_10353563 3300025960 Unclassified 1238
363 Ga0207712_10000004 3300025961 Bacteria 614655
364 Ga0207712_10013710 3300025961 Bacteria 5197
365 Ga0207712_10039334 3300025961 Bacteria 3240
366 Ga0207668_10000061 3300025972 Bacteria 89620
367 Ga0207668_10000358 3300025972 Bacteria 29357
368 Ga0207668_10003325 3300025972 Bacteria 9413
369 Ga0207668_10047399 3300025972 Bacteria 2942
370 Ga0207668_10063810 3300025972 Bacteria 2600
371 Ga0207668_10172522 3300025972 Bacteria 1697
372 Ga0207640_10000050 3300025981 Bacteria 96203
373 Ga0207640_10002692 3300025981 Bacteria 9510
374 Ga0207640_10035325 3300025981 Bacteria 3127
375 Ga0207640_10075969 3300025981 Bacteria 2279
376 Ga0207640_10138330 3300025981 Bacteria 1771
377 Ga0207640_10146865 3300025981 Bacteria 1727
378 Ga0207658_10000002 3300025986 Bacteria 1364188
379 Ga0207658_10000368 3300025986 Bacteria 44362
380 Ga0207658_10000921 3300025986 Bacteria 24296
381 Ga0207658_10006338 3300025986 Bacteria 8076
382 Ga0207658_10050966 3300025986 Bacteria 3048
383 Ga0207677_10000214 3300026023 Bacteria 46317
384 Ga0207703_10000208 3300026035 Bacteria 68360
385 Ga0207703_10001141 3300026035 Bacteria 25115
386 Ga0207703_10004612 3300026035 Bacteria 11272
387 Ga0207703_10060748 3300026035 Bacteria 3091
388 Ga0207639_10071907 3300026041 Bacteria 2707
389 Ga0207639_10132077 3300026041 Bacteria 2068
390 Ga0207639_10181866 3300026041 Bacteria 1789
391 Ga0207639_10354292 3300026041 Bacteria 1312
392 Ga0207639_10491974 3300026041 Bacteria 1119
393 Ga0207678_10001972 3300026067 Bacteria 18697
394 Ga0207678_10024856 3300026067 Bacteria 5230
395 Ga0207678_10088667 3300026067 Bacteria 2644
396 Ga0207702_10002016 3300026078 Bacteria 19681
397 Ga0207702_10007774 3300026078 Bacteria 9103
398 Ga0207702_10075178 3300026078 Bacteria 2918
399 Ga0207702_10103595 3300026078 Bacteria 2517
400 Ga0207702_10420165 3300026078 Bacteria 1293
401 Ga0207641_10000024 3300026088 Bacteria 250751
402 Ga0207641_10000081 3300026088 Bacteria 139770
403 Ga0207641_10000242 3300026088 Bacteria 70950
404 Ga0207641_10000428 3300026088 Bacteria 48639
405 Ga0207641_10004275 3300026088 Bacteria 12415
406 Ga0207648_10000073 3300026089 Bacteria 94751
407 Ga0207676_10000006 3300026095 Bacteria 681936
408 Ga0207676_10001031 3300026095 Bacteria 21326
409 Ga0207676_10007870 3300026095 Bacteria 7579
410 Ga0207676_10023277 3300026095 Bacteria 4567
411 Ga0207676_10139390 3300026095 Unclassified 2074
412 Ga0207674_10009096 3300026116 Bacteria 11398
413 Ga0207674_10120844 3300026116 Bacteria 2587
414 Ga0207674_10200910 3300026116 Bacteria 1943
415 Ga0207675_100000195 3300026118 Bacteria 55663
416 Ga0207675_100000449 3300026118 Bacteria 39979
417 Ga0207675_100048741 3300026118 Bacteria 3953
418 Ga0207683_10060690 3300026121 Bacteria 3324
419 Ga0207698_10000177 3300026142 Bacteria 39133
420 Ga0207698_10000282 3300026142 Bacteria 30876
421 Ga0207698_10000551 3300026142 Bacteria 21787
422 Ga0207698_10002487 3300026142 Bacteria 10928
423 Ga0207698_10013072 3300026142 Bacteria 5465
424 Ga0207698_10017195 3300026142 Bacteria 4899
425 Ga0207698_10166715 3300026142 Unclassified 1934
426 Ga0207698_10232847 3300026142 Bacteria 1673
427 Ga0268266_10000225 3300028379 Bacteria 98082
428 Ga0268266_10001194 3300028379 Bacteria 32065
429 Ga0268266_10003778 3300028379 Bacteria 14831
430 Ga0268266_10024500 3300028379 Bacteria 5132
431 Ga0268265_10000001 3300028380 Bacteria 1230727
432 Ga0268265_10000086 3300028380 Bacteria 119049
433 Ga0268265_10000443 3300028380 Bacteria 43700
434 Ga0268265_10032281 3300028380 Bacteria 3793
435 Ga0268265_10517876 3300028380 Bacteria 1127
436 Ga0268264_10000001 3300028381 Bacteria 1221000
437 Ga0268264_10000003 3300028381 Bacteria 1141976
438 Ga0268264_10000018 3300028381 Bacteria 495324
439 Ga0268264_10000582 3300028381 Bacteria 44285
440 Ga0268264_10053926 3300028381 Bacteria 3356
441 Ga0307408_100245214 3300031548 Bacteria 1475
442 Ga0307408_100316910 3300031548 Bacteria 1312
443 Ga0307405_10000411 3300031731 Bacteria 16128
444 Ga0307413_10096605 3300031824 Bacteria 1940
445 Ga0307413_10298302 3300031824 Bacteria 1221
446 Ga0307410_10073015 3300031852 Bacteria 2384
447 Ga0307410_10156318 3300031852 Bacteria 1703
448 Ga0307407_10036704 3300031903 Bacteria 2703
449 Ga0307407_10105516 3300031903 Bacteria 1758
450 Ga0307412_10007309 3300031911 Bacteria 6263
451 Ga0307412_10035621 3300031911 Bacteria 3181
452 Ga0307412_10079330 3300031911 Bacteria 2264
453 Ga0307409_100069416 3300031995 Bacteria 2792
454 Ga0307409_100298575 3300031995 Bacteria 1497
455 Ga0307416_100381856 3300032002 Bacteria 1439
456 Ga0307414_10085486 3300032004 Bacteria 2324
457 Ga0307414_10112317 3300032004 Bacteria 2077
458 Ga0307414_10292523 3300032004 Bacteria 1374
459 Ga0307414_10396469 3300032004 Bacteria 1197
460 Ga0307411_10006090 3300032005 Bacteria 5997
461 Ga0307411_10122243 3300032005 Bacteria 1886
462 Ga0307415_100067994 3300032126 Bacteria 2492
463 Ga0307415_100258585 3300032126 Bacteria 1419
464 Ga0307415_100290690 3300032126 Bacteria 1349
465 Ga0373931_0017780 3300035691 Bacteria 3523
466 Ga0395899_0000738 3300037312 Bacteria 32643
467 Ga0395899_0088008 3300037312 Bacteria 2253
468 Ga0395899_0105694 3300037312 Bacteria 2027
469 Ga0395900_0037794 3300037418 Bacteria 4976
470 Ga0395900_0115007 3300037418 Bacteria 2761
471 Ga0395900_0211434 3300037418 Bacteria 1958
472 Ga0395900_0336603 3300037418 Bacteria 1486
473 Ga0395900_0449130 3300037418 Bacteria 1246
474 Ga0395898_0140661 3300037466 Bacteria 2310
475 Ga0395905_0009734 3300037471 Bacteria 9377
476 Ga0395905_0081524 3300037471 Bacteria 3032
477 Ga0395905_0094200 3300037471 Bacteria 2809
478 Ga0395901_0010937 3300038443 Bacteria 9194
479 Ga0395901_0032639 3300038443 Bacteria 5370
480 Ga0395901_0408089 3300038443 Bacteria 1395
481 Ga0395901_0423162 3300038443 Bacteria 1365
482 Ga0436365_0970858 3300039437 Bacteria 175279
483 Ga0436365_1912822 3300039437 Bacteria 6964
484 Ga0436362_0554113 3300039453 Bacteria 162652
485 Ga0439436_0032271 3300041404 Bacteria 1519
486 Ga0439461_0000692 3300041410 Bacteria 4893
487 Ga0439461_0006523 3300041410 Bacteria 2036
488 Ga0439465_0019979 3300041413 Bacteria 2095
489 Ga0451802_0164837 3300041460 Bacteria 4076
490 Ga0451806_147161 3300041462 Bacteria 1687
491 Ga0451845_0691060 3300041501 Bacteria 1389
492 Ga0439431_0015155 3300041997 Bacteria 1792
493 Ga0439445_0009749 3300042004 Bacteria 2266
494 Ga0439445_0015609 3300042004 Bacteria 1861
495 Ga0439432_005638 3300042006 Bacteria 4500
496 Ga0439432_011482 3300042006 Bacteria 3053
497 Ga0439449_0035763 3300042007 Bacteria 1848
498 Ga0439452_010709 3300042010 Bacteria 2656
499 Ga0439434_0002010 3300042435 Bacteria 5882
500 Ga0466973_0329061 3300044659 Bacteria 1000
501 Ga0466966_0018607 3300044684 Bacteria 4578
502 Ga0466961_0017276 3300044693 Bacteria 4632
503 Ga0466968_0153012 3300044735 Bacteria 1061
504 Ga0466970_0011892 3300044765 Bacteria 4440
505 Ga0466970_0063036 3300044765 Bacteria 1988
506 Ga0466960_0095633 3300044901 Bacteria 1521
507 Ga0466959_0000595 3300045049 Bacteria 21075
508 Ga0466958_0065403 3300045836 Bacteria 2219
509 Ga0466967_0005080 3300045976 Bacteria 9032
510 Ga0466967_0089127 3300045976 Bacteria 2801
511 Ga0466967_0113310 3300045976 Bacteria 2494
512 Ga0466967_0179583 3300045976 Bacteria 1996
513 Ga0495638_0039366 3300046460 Bacteria 3001
514 Ga0495606_0000121 3300046507 Bacteria 132126
515 Ga0495606_0000470 3300046507 Bacteria 66278
516 Ga0495606_0006944 3300046507 Bacteria 10296
517 Ga0495610_0002658 3300046512 Bacteria 14758
518 Ga0495637_0005503 3300046520 Bacteria 6438
519 Ga0495643_0025411 3300046522 Bacteria 3351
520 Ga0495654_0001760 3300046530 Bacteria 14505
521 Ga0495668_0003468 3300046616 Bacteria 11770
522 Ga0495673_0031395 3300047469 Bacteria 2487
523 Ga0495673_0078544 3300047469 Bacteria 1371
524 Ga0495681_0002165 3300047470 Bacteria 14238
525 Ga0495681_0026871 3300047470 Bacteria 2987
526 Ga0495686_0000070 3300047472 Bacteria 216642
527 Ga0495686_0000916 3300047472 Bacteria 36998
528 Ga0495686_0003451 3300047472 Bacteria 13697
529 Ga0495686_0006254 3300047472 Bacteria 9164
530 Ga0495686_0008429 3300047472 Bacteria 7560
531 Ga0495686_0018399 3300047472 Bacteria 4689
532 Ga0495686_0021831 3300047472 Bacteria 4243
533 Ga0495686_0199892 3300047472 Bacteria 1148
534 Ga0496100_0152848 3300048903 Bacteria 1648
535 Ga0496102_0017559 3300048905 Bacteria 6267
536 Ga0496102_0214159 3300048905 Bacteria 1816
537 Ga0496103_0000276 3300048906 Bacteria 48842
538 Ga0496103_0001574 3300048906 Bacteria 15064
539 Ga0496104_0036265 3300048907 Bacteria 4610
540 Ga0496104_0064916 3300048907 Bacteria 3463
541 Ga0496104_0092725 3300048907 Bacteria 2888
542 Ga0496105_0007414 3300048908 Bacteria 8490
543 Ga0496106_0073028 3300048909 Bacteria 2624
544 Ga0496108_0034222 3300048911 Bacteria 4220
545 Ga0496108_0260133 3300048911 Bacteria 1510
546 Ga0496109_0267487 3300048912 Bacteria 1610
547 Ga0496110_0073215 3300048913 Bacteria 3041
548 Ga0496110_0228185 3300048913 Bacteria 1693
549 Ga0496111_0103663 3300048914 Bacteria 2092
550 Ga0496111_0121340 3300048914 Bacteria 1930
551 Ga0496112_0077300 3300048915 Unclassified 3291
552 Ga0496112_0145740 3300048915 Bacteria 2336
553 Ga0496113_0006385 3300048916 Bacteria 7465
554 Ga0496113_0023851 3300048916 Bacteria 4342
555 Ga0496115_0000732 3300048918 Bacteria 24253
556 Ga0496116_0010912 3300048919 Bacteria 7570
557 Ga0496117_0000633 3300048920 Bacteria 56618
558 Ga0496117_0009277 3300048920 Bacteria 9193
559 Ga0496117_0010610 3300048920 Bacteria 8359
560 Ga0496117_0026459 3300048920 Bacteria 4539
561 Ga0496117_0034784 3300048920 Bacteria 3791
562 Ga0496117_0078406 3300048920 Bacteria 2181
563 Ga0496118_0000654 3300048921 Bacteria 56618
564 Ga0496118_0000863 3300048921 Bacteria 47989
565 Ga0496118_0024761 3300048921 Bacteria 5170
566 Ga0496121_0010783 3300048924 Bacteria 10244
567 Ga0496121_0097232 3300048924 Bacteria 2282
568 Ga0496121_0114216 3300048924 Bacteria 2053
569 Ga0496121_0122065 3300048924 Bacteria 1966
570 Ga0496122_0004991 3300048925 Bacteria 16060
571 Ga0496122_0055013 3300048925 Bacteria 2982
572 Ga0496123_0000536 3300048926 Bacteria 65382
573 Ga0496123_0019760 3300048926 Bacteria 5296
574 Ga0496123_0027511 3300048926 Bacteria 4233
575 Ga0496124_0000664 3300048927 Bacteria 56618
576 Ga0496124_0020087 3300048927 Bacteria 6185
577 Ga0496124_0059577 3300048927 Bacteria 3206
578 Ga0496124_0115593 3300048927 Bacteria 2153
579 Ga0496124_0135082 3300048927 Bacteria 1954
580 Ga0496124_0174951 3300048927 Bacteria 1658
581 Ga0496125_0002663 3300048928 Bacteria 22825
582 Ga0496125_0050287 3300048928 Bacteria 3452
583 Ga0496125_0053689 3300048928 Bacteria 3301
584 Ga0496125_0190670 3300048928 Bacteria 1354
585 Ga0496126_0003583 3300048929 Bacteria 19467
586 Ga0496126_0038592 3300048929 Bacteria 4442
587 Ga0496126_0130268 3300048929 Bacteria 2174
588 Ga0501307_004736 3300049162 Bacteria 1405
589 Ga0501033_0042941 3300049570 Bacteria 3369
590 Ga0501047_0087339 3300049581 Bacteria 2996
591 Ga0501249_000126 3300049679 Bacteria 23726
592 Ga0501241_031214 3300049758 Bacteria 1007
593 Ga0501035_0096486 3300049822 Bacteria 2598
594 nmdc:mga00v17_15270_c2 3300050491 Bacteria 2762
595 nmdc:mga0k408_8473_c1 3300050493 Bacteria 4350
596 nmdc:mga07m45_18459_c1 3300050496 Bacteria 3765
597 Ga0500643_000001 3300053087 Bacteria 1440111
598 Ga0500643_000235 3300053087 Bacteria 51395
599 Ga0500643_010870 3300053087 Bacteria 3361
600 Ga0500646_0014788 3300053090 Bacteria 2028
601 Ga0500647_0116129 3300053091 Bacteria 1269
602 Ga0500566_0005806 3300053094 Bacteria 7336
603 Ga0500562_000643 3300053108 Bacteria 8440
604 Ga0500592_000096 3300053116 Bacteria 19420
605 Ga0500592_000260 3300053116 Bacteria 9403
606 Ga0500592_000267 3300053116 Bacteria 9241
607 Ga0500595_001329 3300053119 Bacteria 13395
608 Ga0500597_003974 3300053120 Bacteria 4494
609 Ga0500618_015198 3300053125 Bacteria 1948
610 Ga0500658_0004824 3300053134 Bacteria 5030
611 Ga0500658_0007545 3300053134 Bacteria 4020
612 Ga0500658_0080836 3300053134 Bacteria 1389
613 Ga0500559_0009417 3300053136 Bacteria 4228
614 Ga0500568_0000245 3300053139 Bacteria 46212
615 Ga0500568_0005002 3300053139 Bacteria 6948
616 Ga0500568_0006969 3300053139 Bacteria 5601
617 Ga0500577_0044425 3300053142 Bacteria 1637
618 Ga0500604_0013002 3300053151 Bacteria 2252
619 Ga0500616_0000140 3300053153 Bacteria 122250
620 Ga0500616_0053362 3300053153 Bacteria 2121
621 Ga0500622_0010459 3300053156 Bacteria 5092
622 Ga0500624_000016 3300053157 Bacteria 134804
623 Ga0500627_0000119 3300053158 Bacteria 24541
624 Ga0500627_0000686 3300053158 Bacteria 8974
625 Ga0500637_0000007 3300053178 Bacteria 93788

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049570 Ga0501033_0042941 Ga0501033_0042941_582_1520 264
2 3300002067 JGI24735J21928_10000718 JGI24735J21928_1000071815 281
3 3300005339 Ga0070660_100043923 Ga0070660_1000439231 281
4 3300025919 Ga0207657_10059233 Ga0207657_100592333 281
5 3300025933 Ga0207706_10019069 Ga0207706_100190694 281
6 3300025945 Ga0207679_10011015 Ga0207679_100110152 281
7 3300005327 Ga0070658_10007939 Ga0070658_100079398 285
8 3300005355 Ga0070671_100003748 Ga0070671_10000374812 285
9 3300005364 Ga0070673_100036299 Ga0070673_1000362992 285
10 3300005614 Ga0068856_100061877 Ga0068856_1000618772 285
11 3300005616 Ga0068852_100118527 Ga0068852_1001185273 285
12 3300005618 Ga0068864_100100756 Ga0068864_1001007562 285
13 3300005834 Ga0068851_10054392 Ga0068851_100543922 285
14 3300025931 Ga0207644_10098122 Ga0207644_100981222 285
15 3300025960 Ga0207651_10353563 Ga0207651_103535632 285
16 3300026078 Ga0207702_10075178 Ga0207702_100751782 285
17 3300026095 Ga0207676_10139390 Ga0207676_101393902 285
18 3300026142 Ga0207698_10166715 Ga0207698_101667152 285
19 3300045976 Ga0466967_0089127 Ga0466967_0089127_1777_2670 285
20 3300048903 Ga0496100_0152848 Ga0496100_0152848_276_1169 285
21 3300048907 Ga0496104_0092725 Ga0496104_0092725_894_1787 285
22 3300048911 Ga0496108_0034222 Ga0496108_0034222_2076_2969 285
23 3300048912 Ga0496109_0267487 Ga0496109_0267487_351_1244 285
24 3300048914 Ga0496111_0121340 Ga0496111_0121340_859_1752 285
25 3300048915 Ga0496112_0077300 Ga0496112_0077300_910_1803 285
26 3300048916 Ga0496113_0023851 Ga0496113_0023851_2443_3336 285
27 3300025909 Ga0207705_10038357 Ga0207705_100383573 287
28 3300005367 Ga0070667_100206806 Ga0070667_1002068062 288
29 iso_pu_bacteria 2775507255 2778123457 288
30 3300009098 Ga0105245_10008944 Ga0105245_100089449 290
31 3300009148 Ga0105243_10000389 Ga0105243_1000038948 290
32 3300009174 Ga0105241_10026726 Ga0105241_100267264 290
33 3300009176 Ga0105242_10008704 Ga0105242_100087046 290
34 3300009545 Ga0105237_10041638 Ga0105237_100416385 290
35 3300009551 Ga0105238_10096853 Ga0105238_100968532 290
36 3300009553 Ga0105249_10037725 Ga0105249_100377252 290
37 3300010375 Ga0105239_10008242 Ga0105239_100082423 290
38 3300010375 Ga0105239_10116932 Ga0105239_101169324 290
39 3300011119 Ga0105246_10001451 Ga0105246_1000145110 290
40 3300013100 Ga0157373_10029409 Ga0157373_100294094 290
41 3300013296 Ga0157374_10004957 Ga0157374_100049578 290
42 3300013296 Ga0157374_10042871 Ga0157374_100428712 290
43 3300013297 Ga0157378_10005590 Ga0157378_100055905 290
44 3300013308 Ga0157375_10019153 Ga0157375_100191534 290
45 3300014745 Ga0157377_10014544 Ga0157377_100145445 290
46 3300014969 Ga0157376_10000145 Ga0157376_1000014549 290
47 3300037418 Ga0395900_0449130 Ga0395900_0449130_65_940 290
48 3300049822 Ga0501035_0096486 Ga0501035_0096486_1137_2015 290
49 iso_pu_bacteria 2885429604 2885431671 290
50 iso_pu_bacteria 2919138771 2919142354 290
51 3300005344 Ga0070661_100000001 Ga0070661_10000000196 291
52 3300005458 Ga0070681_10018969 Ga0070681_100189692 291
53 3300005530 Ga0070679_100000025 Ga0070679_100000025106 291
54 3300025919 Ga0207657_10065785 Ga0207657_100657852 291
55 3300025920 Ga0207649_10000018 Ga0207649_10000018115 291
56 3300025921 Ga0207652_10000042 Ga0207652_10000042105 291
57 3300002067 JGI24735J21928_10002287 JGI24735J21928_100022874 292
58 3300002075 JGI24738J21930_10000786 JGI24738J21930_100007868 292
59 3300005327 Ga0070658_10002861 Ga0070658_100028613 292
60 3300005339 Ga0070660_100082477 Ga0070660_1000824772 292
61 3300005344 Ga0070661_100003899 Ga0070661_1000038999 292
62 3300005344 Ga0070661_100199509 Ga0070661_1001995092 292
63 3300005455 Ga0070663_100007003 Ga0070663_1000070035 292
64 3300005457 Ga0070662_100303745 Ga0070662_1003037451 292
65 3300005539 Ga0068853_100024873 Ga0068853_1000248734 292
66 3300005563 Ga0068855_100003616 Ga0068855_10000361616 292
67 3300005563 Ga0068855_100292032 Ga0068855_1002920323 292
68 3300005564 Ga0070664_100001213 Ga0070664_10000121317 292
69 3300005578 Ga0068854_100000359 Ga0068854_10000035925 292
70 3300005578 Ga0068854_100072591 Ga0068854_1000725914 292
71 3300005614 Ga0068856_100047623 Ga0068856_1000476234 292
72 3300005616 Ga0068852_100000619 Ga0068852_10000061917 292
73 3300005616 Ga0068852_100000679 Ga0068852_10000067912 292
74 3300006195 Ga0075366_10015689 Ga0075366_100156898 292
75 3300009093 Ga0105240_10047881 Ga0105240_100478812 292
76 3300009545 Ga0105237_10036476 Ga0105237_100364762 292
77 3300009551 Ga0105238_10003375 Ga0105238_1000337511 292
78 3300009553 Ga0105249_10017619 Ga0105249_100176196 292
79 3300010375 Ga0105239_10002815 Ga0105239_1000281517 292
80 3300013100 Ga0157373_10001067 Ga0157373_1000106717 292
81 3300013102 Ga0157371_10057528 Ga0157371_100575284 292
82 3300013104 Ga0157370_10000377 Ga0157370_1000037711 292
83 3300013104 Ga0157370_10012920 Ga0157370_1001292012 292
84 3300013105 Ga0157369_10014696 Ga0157369_100146965 292
85 3300013307 Ga0157372_10002249 Ga0157372_1000224911 292
86 3300017792 Ga0163161_10046298 Ga0163161_100462984 292
87 3300025321 Ga0207656_10009353 Ga0207656_100093532 292
88 3300025904 Ga0207647_10019114 Ga0207647_100191143 292
89 3300025904 Ga0207647_10031922 Ga0207647_100319222 292
90 3300025909 Ga0207705_10000004 Ga0207705_10000004355 292
91 3300025913 Ga0207695_10003039 Ga0207695_1000303918 292
92 3300025913 Ga0207695_10027764 Ga0207695_100277644 292
93 3300025913 Ga0207695_10035780 Ga0207695_100357807 292
94 3300025949 Ga0207667_10003455 Ga0207667_1000345512 292
95 3300025981 Ga0207640_10002692 Ga0207640_100026926 292
96 3300025981 Ga0207640_10075969 Ga0207640_100759692 292
97 3300026041 Ga0207639_10181866 Ga0207639_101818662 292
98 3300026041 Ga0207639_10491974 Ga0207639_104919741 292
99 3300026142 Ga0207698_10000177 Ga0207698_1000017732 292
100 3300026142 Ga0207698_10000282 Ga0207698_1000028224 292
101 3300026142 Ga0207698_10013072 Ga0207698_100130723 292
102 3300026142 Ga0207698_10232847 Ga0207698_102328473 292
103 3300031903 Ga0307407_10105516 Ga0307407_101055162 292
104 3300037312 Ga0395899_0000738 Ga0395899_0000738_18858_19739 292
105 3300037418 Ga0395900_0115007 Ga0395900_0115007_1137_2018 292
106 3300046512 Ga0495610_0002658 Ga0495610_0002658_12190_13104 292
107 3300046520 Ga0495637_0005503 Ga0495637_0005503_2228_3142 292
108 3300047470 Ga0495681_0002165 Ga0495681_0002165_996_1910 292
109 3300047472 Ga0495686_0003451 Ga0495686_0003451_12128_13042 292
110 3300048906 Ga0496103_0000276 Ga0496103_0000276_35409_36287 292
111 3300048913 Ga0496110_0073215 Ga0496110_0073215_1444_2331 292
112 3300048919 Ga0496116_0010912 Ga0496116_0010912_1073_1951 292
113 3300048920 Ga0496117_0000633 Ga0496117_0000633_43166_44044 292
114 3300048921 Ga0496118_0000654 Ga0496118_0000654_12575_13453 292
115 3300048924 Ga0496121_0097232 Ga0496121_0097232_1205_2092 292
116 3300048925 Ga0496122_0004991 Ga0496122_0004991_4633_5520 292
117 3300048926 Ga0496123_0019760 Ga0496123_0019760_2546_3433 292
118 3300048927 Ga0496124_0000664 Ga0496124_0000664_12575_13453 292
119 3300048927 Ga0496124_0059577 Ga0496124_0059577_1568_2455 292
120 3300048927 Ga0496124_0174951 Ga0496124_0174951_663_1550 292
121 3300048928 Ga0496125_0002663 Ga0496125_0002663_18493_19380 292
122 3300048928 Ga0496125_0190670 Ga0496125_0190670_296_1264 292
123 3300050493 nmdc:mga0k408_8473_c1 nmdc:mga0k408_8473_c1_38_943 292
124 3300053091 Ga0500647_0116129 Ga0500647_0116129_142_1050 292
125 3300053108 Ga0500562_000643 Ga0500562_000643_5229_6137 292
126 3300053120 Ga0500597_003974 Ga0500597_003974_1922_2869 292
127 3300053157 Ga0500624_000016 Ga0500624_000016_61198_62145 292
128 3300053178 Ga0500637_0000007 Ga0500637_0000007_61216_62163 292
129 3300005347 Ga0070668_100009791 Ga0070668_1000097912 293
130 3300005535 Ga0070684_100248718 Ga0070684_1002487183 293
131 3300005539 Ga0068853_100149069 Ga0068853_1001490692 293
132 3300005616 Ga0068852_100297297 Ga0068852_1002972972 293
133 3300006358 Ga0068871_100114841 Ga0068871_1001148412 293
134 3300009551 Ga0105238_10143257 Ga0105238_101432573 293
135 3300013105 Ga0157369_10137799 Ga0157369_101377992 293
136 3300020070 Ga0206356_10079795 Ga0206356_100797952 293
137 3300025972 Ga0207668_10172522 Ga0207668_101725222 293
138 3300026041 Ga0207639_10132077 Ga0207639_101320772 293
139 3300053090 Ga0500646_0014788 Ga0500646_0014788_962_1879 293
140 3300053156 Ga0500622_0010459 Ga0500622_0010459_1545_2462 293
141 iso_pu_bacteria 2599185354 2600203543 293
142 iso_pu_bacteria 2643221622 2644125548 293
143 iso_pu_bacteria 2751185897 2753765546 293
144 iso_pu_bacteria 2879163058 2879165330 293
145 iso_pu_bacteria 2882806704 2882809431 293
146 iso_pu_bacteria 2895880812 2895884125 293
147 3300005353 Ga0070669_100045337 Ga0070669_1000453374 294
148 3300005353 Ga0070669_100156971 Ga0070669_1001569712 294
149 3300005367 Ga0070667_100033180 Ga0070667_1000331805 294
150 3300005548 Ga0070665_100004395 Ga0070665_1000043953 294
151 3300005563 Ga0068855_100333623 Ga0068855_1003336231 294
152 3300005841 Ga0068863_100000063 Ga0068863_10000006335 294
153 3300005843 Ga0068860_100000008 Ga0068860_100000008319 294
154 3300009177 Ga0105248_10170304 Ga0105248_101703042 294
155 3300025923 Ga0207681_10049644 Ga0207681_100496442 294
156 3300025941 Ga0207711_10393773 Ga0207711_103937732 294
157 3300025986 Ga0207658_10006338 Ga0207658_100063389 294
158 3300026035 Ga0207703_10060748 Ga0207703_100607483 294
159 3300026088 Ga0207641_10000081 Ga0207641_1000008155 294
160 3300026095 Ga0207676_10023277 Ga0207676_100232773 294
161 3300028379 Ga0268266_10003778 Ga0268266_100037783 294
162 3300028381 Ga0268264_10000018 Ga0268264_10000018217 294
163 3300031852 Ga0307410_10073015 Ga0307410_100730152 294
164 3300031995 Ga0307409_100298575 Ga0307409_1002985752 294
165 3300032004 Ga0307414_10396469 Ga0307414_103964692 294
166 3300048907 Ga0496104_0036265 Ga0496104_0036265_973_1857 294
167 3300048908 Ga0496105_0007414 Ga0496105_0007414_1741_2625 294
168 3300048929 Ga0496126_0038592 Ga0496126_0038592_139_1029 294
169 3300049581 Ga0501047_0087339 Ga0501047_0087339_1232_2164 294
170 3300053087 Ga0500643_000001 Ga0500643_000001_419982_420929 294
171 3300053125 Ga0500618_015198 Ga0500618_015198_820_1719 294
172 iso_pu_bacteria 2582581305 2585261307 294
173 iso_pu_bacteria 2643221605 2644037732 294
174 3300005327 Ga0070658_10014655 Ga0070658_100146554 295
175 3300005327 Ga0070658_10224410 Ga0070658_102244102 295
176 3300005339 Ga0070660_100056089 Ga0070660_1000560893 295
177 3300005530 Ga0070679_100012883 Ga0070679_1000128835 295
178 3300005530 Ga0070679_100413237 Ga0070679_1004132372 295
179 3300013307 Ga0157372_10279167 Ga0157372_102791672 295
180 3300025909 Ga0207705_10000501 Ga0207705_1000050123 295
181 3300025909 Ga0207705_10047112 Ga0207705_100471122 295
182 3300025919 Ga0207657_10011895 Ga0207657_100118952 295
183 3300025921 Ga0207652_10003061 Ga0207652_100030616 295
184 3300025921 Ga0207652_10030072 Ga0207652_100300722 295
185 3300025921 Ga0207652_10383643 Ga0207652_103836432 295
186 3300026067 Ga0207678_10088667 Ga0207678_100886672 295
187 3300032004 Ga0307414_10112317 Ga0307414_101123172 295
188 3300032126 Ga0307415_100067994 Ga0307415_1000679942 295
189 3300032126 Ga0307415_100290690 Ga0307415_1002906901 295
190 3300041460 Ga0451802_0164837 Ga0451802_0164837_1832_2722 295
191 3300041462 Ga0451806_147161 Ga0451806_147161_101_1009 295
192 3300041501 Ga0451845_0691060 Ga0451845_0691060_139_1047 295
193 3300042006 Ga0439432_011482 Ga0439432_011482_1282_2175 295
194 3300042007 Ga0439449_0035763 Ga0439449_0035763_273_1166 295
195 3300044659 Ga0466973_0329061 Ga0466973_0329061_75_965 295
196 3300046522 Ga0495643_0025411 Ga0495643_0025411_2040_3002 295
197 3300053116 Ga0500592_000267 Ga0500592_000267_5774_6664 295
198 3300053139 Ga0500568_0005002 Ga0500568_0005002_5311_6306 295
199 iso_pu_bacteria 2643221541 2643731170 295
200 iso_pu_bacteria 2643221606 2644045324 295
201 iso_pu_bacteria 2643221671 2644391899 295
202 3300001915 JGI24741J21665_1007124 JGI24741J21665_10071242 296
203 3300001989 JGI24739J22299_10038711 JGI24739J22299_100387112 296
204 3300001989 JGI24739J22299_10041907 JGI24739J22299_100419071 296
205 3300001990 JGI24737J22298_10012165 JGI24737J22298_100121653 296
206 3300001991 JGI24743J22301_10008836 JGI24743J22301_100088363 296
207 3300002067 JGI24735J21928_10003851 JGI24735J21928_100038516 296
208 3300002067 JGI24735J21928_10005230 JGI24735J21928_100052302 296
209 3300002067 JGI24735J21928_10027713 JGI24735J21928_100277132 296
210 3300002075 JGI24738J21930_10001035 JGI24738J21930_100010355 296
211 3300002077 JGI24744J21845_10002036 JGI24744J21845_100020362 296
212 3300002774 JGI25150J39212_1000717 JGI25150J39212_10007174 296
213 3300003214 JGI25165J46597_1000112 JGI25165J46597_100011259 296
214 3300003215 JGI25153J46596_10002050 JGI25153J46596_1000205010 296
215 3300003320 rootH2_10112808 rootH2_101128081 296
216 3300003322 rootL2_10047630 rootL2_100476302 296
217 3300005327 Ga0070658_10000089 Ga0070658_1000008916 296
218 3300005327 Ga0070658_10001860 Ga0070658_1000186010 296
219 3300005327 Ga0070658_10026070 Ga0070658_100260706 296
220 3300005327 Ga0070658_10087735 Ga0070658_100877353 296
221 3300005328 Ga0070676_10000273 Ga0070676_1000027315 296
222 3300005334 Ga0068869_100001713 Ga0068869_1000017139 296
223 3300005338 Ga0068868_100000023 Ga0068868_10000002344 296
224 3300005339 Ga0070660_100000395 Ga0070660_1000003952 296
225 3300005339 Ga0070660_100005483 Ga0070660_1000054834 296
226 3300005339 Ga0070660_100031097 Ga0070660_1000310974 296
227 3300005339 Ga0070660_100159350 Ga0070660_1001593502 296
228 3300005353 Ga0070669_100258172 Ga0070669_1002581721 296
229 3300005354 Ga0070675_100005402 Ga0070675_1000054029 296
230 3300005364 Ga0070673_100000001 Ga0070673_10000000188 296
231 3300005366 Ga0070659_100294471 Ga0070659_1002944712 296
232 3300005455 Ga0070663_100000781 Ga0070663_1000007818 296
233 3300005456 Ga0070678_100036691 Ga0070678_1000366912 296
234 3300005457 Ga0070662_100544865 Ga0070662_1005448651 296
235 3300005459 Ga0068867_100000027 Ga0068867_1000000273 296
236 3300005539 Ga0068853_100041919 Ga0068853_1000419194 296
237 3300005539 Ga0068853_100314894 Ga0068853_1003148942 296
238 3300005543 Ga0070672_100166188 Ga0070672_1001661882 296
239 3300005543 Ga0070672_100277166 Ga0070672_1002771662 296
240 3300005563 Ga0068855_100000092 Ga0068855_10000009248 296
241 3300005563 Ga0068855_100049683 Ga0068855_1000496833 296
242 3300005577 Ga0068857_100182624 Ga0068857_1001826241 296
243 3300005578 Ga0068854_100000684 Ga0068854_1000006844 296
244 3300005578 Ga0068854_100276738 Ga0068854_1002767382 296
245 3300005614 Ga0068856_100022467 Ga0068856_1000224675 296
246 3300005843 Ga0068860_100072849 Ga0068860_1000728492 296
247 3300006358 Ga0068871_100018441 Ga0068871_1000184413 296
248 3300006881 Ga0068865_100000030 Ga0068865_1000000303 296
249 3300006881 Ga0068865_100067282 Ga0068865_1000672822 296
250 3300009093 Ga0105240_10131661 Ga0105240_101316614 296
251 3300013104 Ga0157370_10000213 Ga0157370_1000021354 296
252 3300013105 Ga0157369_10037278 Ga0157369_100372784 296
253 3300013307 Ga0157372_10030216 Ga0157372_100302167 296
254 3300013307 Ga0157372_10085010 Ga0157372_100850104 296
255 3300015690 Ga0183363_1003 Ga0183363_1003402 296
256 3300025231 Ga0207427_102069 Ga0207427_1020693 296
257 3300025245 Ga0207425_1000358 Ga0207425_100035827 296
258 3300025254 Ga0209148_1000133 Ga0209148_1000133100 296
259 3300025254 Ga0209148_1003245 Ga0209148_10032455 296
260 3300025258 Ga0209129_1001181 Ga0209129_10011815 296
261 3300025261 Ga0209233_1000078 Ga0209233_100007885 296
262 3300025272 Ga0209455_1001477 Ga0209455_10014773 296
263 3300025294 Ga0209025_1000202 Ga0209025_1000202122 296
264 3300025297 Ga0209758_1000763 Ga0209758_100076327 296
265 3300025321 Ga0207656_10036960 Ga0207656_100369602 296
266 3300025904 Ga0207647_10002241 Ga0207647_1000224111 296
267 3300025904 Ga0207647_10014781 Ga0207647_100147813 296
268 3300025907 Ga0207645_10001531 Ga0207645_100015315 296
269 3300025909 Ga0207705_10000018 Ga0207705_10000018220 296
270 3300025909 Ga0207705_10000140 Ga0207705_1000014025 296
271 3300025909 Ga0207705_10031238 Ga0207705_100312382 296
272 3300025913 Ga0207695_10028622 Ga0207695_100286222 296
273 3300025914 Ga0207671_10023011 Ga0207671_100230115 296
274 3300025919 Ga0207657_10002796 Ga0207657_100027962 296
275 3300025919 Ga0207657_10004427 Ga0207657_100044275 296
276 3300025919 Ga0207657_10086401 Ga0207657_100864014 296
277 3300025919 Ga0207657_10089779 Ga0207657_100897792 296
278 3300025931 Ga0207644_10008514 Ga0207644_100085143 296
279 3300025932 Ga0207690_10014596 Ga0207690_100145964 296
280 3300025933 Ga0207706_10026390 Ga0207706_100263904 296
281 3300025934 Ga0207686_10004004 Ga0207686_100040046 296
282 3300025935 Ga0207709_10000432 Ga0207709_1000043230 296
283 3300025938 Ga0207704_10000032 Ga0207704_1000003256 296
284 3300025940 Ga0207691_10107251 Ga0207691_101072512 296
285 3300025940 Ga0207691_10237096 Ga0207691_102370962 296
286 3300025942 Ga0207689_10000108 Ga0207689_1000010810 296
287 3300025949 Ga0207667_10000013 Ga0207667_1000001358 296
288 3300025949 Ga0207667_10009398 Ga0207667_100093988 296
289 3300025960 Ga0207651_10000001 Ga0207651_10000001381 296
290 3300025961 Ga0207712_10013710 Ga0207712_100137104 296
291 3300025981 Ga0207640_10000050 Ga0207640_1000005051 296
292 3300026023 Ga0207677_10000214 Ga0207677_100002145 296
293 3300026067 Ga0207678_10001972 Ga0207678_1000197214 296
294 3300026078 Ga0207702_10002016 Ga0207702_1000201618 296
295 3300026078 Ga0207702_10103595 Ga0207702_101035952 296
296 3300026089 Ga0207648_10000073 Ga0207648_1000007389 296
297 3300026116 Ga0207674_10200910 Ga0207674_102009101 296
298 3300026121 Ga0207683_10060690 Ga0207683_100606904 296
299 3300028381 Ga0268264_10053926 Ga0268264_100539262 296
300 3300031824 Ga0307413_10298302 Ga0307413_102983021 296
301 3300031852 Ga0307410_10156318 Ga0307410_101563182 296
302 3300031903 Ga0307407_10036704 Ga0307407_100367044 296
303 3300031995 Ga0307409_100069416 Ga0307409_1000694163 296
304 3300032004 Ga0307414_10292523 Ga0307414_102925232 296
305 3300032005 Ga0307411_10006090 Ga0307411_100060908 296
306 3300032126 Ga0307415_100258585 Ga0307415_1002585852 296
307 3300035691 Ga0373931_0017780 Ga0373931_0017780_2298_3236 296
308 3300037312 Ga0395899_0088008 Ga0395899_0088008_40_933 296
309 3300037312 Ga0395899_0105694 Ga0395899_0105694_632_1525 296
310 3300037418 Ga0395900_0037794 Ga0395900_0037794_2296_3189 296
311 3300037418 Ga0395900_0211434 Ga0395900_0211434_327_1220 296
312 3300037418 Ga0395900_0336603 Ga0395900_0336603_402_1295 296
313 3300037466 Ga0395898_0140661 Ga0395898_0140661_1233_2126 296
314 3300037471 Ga0395905_0009734 Ga0395905_0009734_2453_3415 296
315 3300037471 Ga0395905_0081524 Ga0395905_0081524_1942_2835 296
316 3300037471 Ga0395905_0094200 Ga0395905_0094200_1557_2450 296
317 3300038443 Ga0395901_0010937 Ga0395901_0010937_1911_2804 296
318 3300038443 Ga0395901_0032639 Ga0395901_0032639_1006_1968 296
319 3300038443 Ga0395901_0408089 Ga0395901_0408089_347_1240 296
320 3300038443 Ga0395901_0423162 Ga0395901_0423162_375_1268 296
321 3300044684 Ga0466966_0018607 Ga0466966_0018607_1298_2191 296
322 3300044693 Ga0466961_0017276 Ga0466961_0017276_3287_4180 296
323 3300044735 Ga0466968_0153012 Ga0466968_0153012_150_1043 296
324 3300044765 Ga0466970_0011892 Ga0466970_0011892_1203_2096 296
325 3300044765 Ga0466970_0063036 Ga0466970_0063036_981_1874 296
326 3300044901 Ga0466960_0095633 Ga0466960_0095633_153_1046 296
327 3300045049 Ga0466959_0000595 Ga0466959_0000595_19021_19914 296
328 3300045836 Ga0466958_0065403 Ga0466958_0065403_110_1003 296
329 3300045976 Ga0466967_0005080 Ga0466967_0005080_7285_8229 296
330 3300045976 Ga0466967_0179583 Ga0466967_0179583_288_1181 296
331 3300048915 Ga0496112_0145740 Ga0496112_0145740_981_1934 296
332 3300048916 Ga0496113_0006385 Ga0496113_0006385_2933_3886 296
333 3300048920 Ga0496117_0010610 Ga0496117_0010610_1759_2652 296
334 3300048924 Ga0496121_0010783 Ga0496121_0010783_1612_2505 296
335 3300048924 Ga0496121_0122065 Ga0496121_0122065_670_1563 296
336 3300048925 Ga0496122_0055013 Ga0496122_0055013_785_1678 296
337 3300048926 Ga0496123_0000536 Ga0496123_0000536_23695_24588 296
338 3300048926 Ga0496123_0027511 Ga0496123_0027511_3177_4070 296
339 3300048927 Ga0496124_0020087 Ga0496124_0020087_5243_6136 296
340 3300048928 Ga0496125_0050287 Ga0496125_0050287_2381_3274 296
341 3300048929 Ga0496126_0130268 Ga0496126_0130268_638_1531 296
342 3300002459 JGI24751J29686_10000054 JGI24751J29686_1000005415 297
343 3300002459 JGI24751J29686_10000291 JGI24751J29686_1000029114 297
344 3300002774 JGI25150J39212_1001280 JGI25150J39212_10012804 297
345 3300003187 JGI25151J46595_10010967 JGI25151J46595_100109671 297
346 3300003215 JGI25153J46596_10000183 JGI25153J46596_1000018312 297
347 3300003773 Ga0055537_1003838 Ga0055537_10038382 297
348 3300003791 Ga0055530_10011102 Ga0055530_100111022 297
349 3300003791 Ga0055530_10013222 Ga0055530_100132222 297
350 3300003791 Ga0055530_10034255 Ga0055530_100342551 297
351 3300003794 Ga0055531_10000073 Ga0055531_100000733 297
352 3300003794 Ga0055531_10012567 Ga0055531_100125672 297
353 3300005262 Ga0065165_1003262 Ga0065165_10032623 297
354 3300005331 Ga0070670_100000003 Ga0070670_100000003452 297
355 3300005331 Ga0070670_100258340 Ga0070670_1002583402 297
356 3300005347 Ga0070668_100006974 Ga0070668_1000069744 297
357 3300005347 Ga0070668_100058590 Ga0070668_1000585902 297
358 3300005347 Ga0070668_100100637 Ga0070668_1001006373 297
359 3300005353 Ga0070669_100000049 Ga0070669_10000004915 297
360 3300005367 Ga0070667_100002399 Ga0070667_10000239918 297
361 3300005539 Ga0068853_100002147 Ga0068853_1000021475 297
362 3300005539 Ga0068853_100125456 Ga0068853_1001254561 297
363 3300005563 Ga0068855_100013002 Ga0068855_1000130024 297
364 3300005563 Ga0068855_100050702 Ga0068855_1000507025 297
365 3300005563 Ga0068855_100259763 Ga0068855_1002597632 297
366 3300005577 Ga0068857_100119456 Ga0068857_1001194563 297
367 3300005578 Ga0068854_100109932 Ga0068854_1001099322 297
368 3300005578 Ga0068854_100425282 Ga0068854_1004252822 297
369 3300005616 Ga0068852_100001858 Ga0068852_10000185811 297
370 3300005616 Ga0068852_100097188 Ga0068852_1000971882 297
371 3300005616 Ga0068852_100142304 Ga0068852_1001423043 297
372 3300005617 Ga0068859_100005160 Ga0068859_10000516011 297
373 3300005618 Ga0068864_100000005 Ga0068864_100000005320 297
374 3300005719 Ga0068861_100004083 Ga0068861_10000408310 297
375 3300005834 Ga0068851_10146254 Ga0068851_101462542 297
376 3300005841 Ga0068863_100003594 Ga0068863_10000359412 297
377 3300005841 Ga0068863_100568024 Ga0068863_1005680241 297
378 3300005842 Ga0068858_100001300 Ga0068858_1000013007 297
379 3300005843 Ga0068860_100000573 Ga0068860_10000057323 297
380 3300005844 Ga0068862_100000001 Ga0068862_100000001119 297
381 3300006353 Ga0075370_10003349 Ga0075370_100033497 297
382 3300006931 Ga0097620_100005160 Ga0097620_10000516011 297
383 3300009093 Ga0105240_10375205 Ga0105240_103752052 297
384 3300009177 Ga0105248_10077072 Ga0105248_100770724 297
385 3300009177 Ga0105248_10212649 Ga0105248_102126492 297
386 3300009978 Ga0105148_103213 Ga0105148_1032131 297
387 3300021384 Ga0213876_10010373 Ga0213876_100103734 297
388 3300025245 Ga0207425_1000005 Ga0207425_1000005472 297
389 3300025258 Ga0209129_1000526 Ga0209129_10005262 297
390 3300025263 Ga0209565_1000044 Ga0209565_100004453 297
391 3300025273 Ga0209673_1015836 Ga0209673_10158363 297
392 3300025292 Ga0209676_1017157 Ga0209676_10171572 297
393 3300025294 Ga0209025_1000128 Ga0209025_1000128110 297
394 3300025295 Ga0209564_1004768 Ga0209564_10047682 297
395 3300025297 Ga0209758_1000002 Ga0209758_1000002872 297
396 3300025298 Ga0209050_1000010 Ga0209050_1000010823 297
397 3300025298 Ga0209050_1010583 Ga0209050_10105832 297
398 3300025298 Ga0209050_1013813 Ga0209050_10138133 297
399 3300025302 Ga0207426_1008714 Ga0207426_10087144 297
400 3300025303 Ga0209051_1031200 Ga0209051_10312002 297
401 3300025304 Ga0209257_1000027 Ga0209257_1000027465 297
402 3300025304 Ga0209257_1002519 Ga0209257_10025198 297
403 3300025304 Ga0209257_1032792 Ga0209257_10327922 297
404 3300025321 Ga0207656_10106249 Ga0207656_101062492 297
405 3300025923 Ga0207681_10000005 Ga0207681_10000005271 297
406 3300025925 Ga0207650_10000004 Ga0207650_10000004450 297
407 3300025933 Ga0207706_10013575 Ga0207706_100135753 297
408 3300025941 Ga0207711_10002399 Ga0207711_1000239918 297
409 3300025941 Ga0207711_10117061 Ga0207711_101170613 297
410 3300025949 Ga0207667_10003691 Ga0207667_100036917 297
411 3300025949 Ga0207667_10051393 Ga0207667_100513932 297
412 3300025949 Ga0207667_10108763 Ga0207667_101087633 297
413 3300025949 Ga0207667_10229111 Ga0207667_102291113 297
414 3300025972 Ga0207668_10003325 Ga0207668_100033253 297
415 3300025972 Ga0207668_10047399 Ga0207668_100473992 297
416 3300025972 Ga0207668_10063810 Ga0207668_100638104 297
417 3300025981 Ga0207640_10146865 Ga0207640_101468652 297
418 3300025986 Ga0207658_10000368 Ga0207658_1000036823 297
419 3300025986 Ga0207658_10050966 Ga0207658_100509664 297
420 3300026035 Ga0207703_10004612 Ga0207703_100046128 297
421 3300026041 Ga0207639_10354292 Ga0207639_103542921 297
422 3300026078 Ga0207702_10420165 Ga0207702_104201652 297
423 3300026088 Ga0207641_10004275 Ga0207641_100042755 297
424 3300026095 Ga0207676_10000006 Ga0207676_10000006262 297
425 3300026116 Ga0207674_10009096 Ga0207674_100090968 297
426 3300026118 Ga0207675_100000195 Ga0207675_10000019510 297
427 3300026142 Ga0207698_10000551 Ga0207698_100005515 297
428 3300026142 Ga0207698_10002487 Ga0207698_1000248710 297
429 3300028380 Ga0268265_10000001 Ga0268265_10000001911 297
430 3300028380 Ga0268265_10517876 Ga0268265_105178762 297
431 3300028381 Ga0268264_10000582 Ga0268264_1000058223 297
432 3300031548 Ga0307408_100316910 Ga0307408_1003169101 297
433 3300031731 Ga0307405_10000411 Ga0307405_100004115 297
434 3300031911 Ga0307412_10007309 Ga0307412_100073095 297
435 3300031911 Ga0307412_10035621 Ga0307412_100356214 297
436 3300031911 Ga0307412_10079330 Ga0307412_100793301 297
437 3300032002 Ga0307416_100381856 Ga0307416_1003818563 297
438 3300039437 Ga0436365_1912822 Ga0436365_1912822_3097_3993 297
439 3300041404 Ga0439436_0032271 Ga0439436_0032271_38_934 297
440 3300041410 Ga0439461_0000692 Ga0439461_0000692_2751_3647 297
441 3300041410 Ga0439461_0006523 Ga0439461_0006523_1023_1919 297
442 3300041413 Ga0439465_0019979 Ga0439465_0019979_375_1271 297
443 3300041997 Ga0439431_0015155 Ga0439431_0015155_238_1134 297
444 3300042004 Ga0439445_0009749 Ga0439445_0009749_375_1271 297
445 3300042004 Ga0439445_0015609 Ga0439445_0015609_290_1186 297
446 3300042006 Ga0439432_005638 Ga0439432_005638_2788_3684 297
447 3300042010 Ga0439452_010709 Ga0439452_010709_968_1864 297
448 3300042435 Ga0439434_0002010 Ga0439434_0002010_949_1845 297
449 3300046460 Ga0495638_0039366 Ga0495638_0039366_841_1740 297
450 3300046507 Ga0495606_0000470 Ga0495606_0000470_2627_3526 297
451 3300047469 Ga0495673_0031395 Ga0495673_0031395_958_1857 297
452 3300047470 Ga0495681_0026871 Ga0495681_0026871_1964_2860 297
453 3300047472 Ga0495686_0000916 Ga0495686_0000916_34414_35313 297
454 3300047472 Ga0495686_0008429 Ga0495686_0008429_3438_4337 297
455 3300047472 Ga0495686_0018399 Ga0495686_0018399_2099_2998 297
456 3300047472 Ga0495686_0021831 Ga0495686_0021831_2963_3862 297
457 3300048905 Ga0496102_0214159 Ga0496102_0214159_612_1508 297
458 3300048911 Ga0496108_0260133 Ga0496108_0260133_479_1375 297
459 3300048913 Ga0496110_0228185 Ga0496110_0228185_416_1312 297
460 3300048914 Ga0496111_0103663 Ga0496111_0103663_751_1647 297
461 3300048918 Ga0496115_0000732 Ga0496115_0000732_2974_3870 297
462 3300048920 Ga0496117_0009277 Ga0496117_0009277_2174_3073 297
463 3300048920 Ga0496117_0078406 Ga0496117_0078406_498_1394 297
464 3300048921 Ga0496118_0000863 Ga0496118_0000863_16246_17145 297
465 3300048924 Ga0496121_0114216 Ga0496121_0114216_152_1051 297
466 3300048927 Ga0496124_0115593 Ga0496124_0115593_868_1764 297
467 3300048927 Ga0496124_0135082 Ga0496124_0135082_1039_1938 297
468 3300048929 Ga0496126_0003583 Ga0496126_0003583_15278_16174 297
469 3300049758 Ga0501241_031214 Ga0501241_031214_101_997 297
470 3300050496 nmdc:mga07m45_18459_c1 nmdc:mga07m45_18459_c1_1041_1937 297
471 3300053087 Ga0500643_000235 Ga0500643_000235_29064_29957 297
472 3300053087 Ga0500643_010870 Ga0500643_010870_1307_2203 297
473 3300053094 Ga0500566_0005806 Ga0500566_0005806_4569_5465 297
474 3300053116 Ga0500592_000096 Ga0500592_000096_17253_18149 297
475 3300053119 Ga0500595_001329 Ga0500595_001329_11338_12234 297
476 3300053134 Ga0500658_0004824 Ga0500658_0004824_2943_3839 297
477 3300053134 Ga0500658_0007545 Ga0500658_0007545_442_1425 297
478 3300053134 Ga0500658_0080836 Ga0500658_0080836_115_1011 297
479 3300053139 Ga0500568_0006969 Ga0500568_0006969_969_1865 297
480 3300053151 Ga0500604_0013002 Ga0500604_0013002_744_1640 297
481 3300053153 Ga0500616_0053362 Ga0500616_0053362_1092_1991 297
482 3300053158 Ga0500627_0000119 Ga0500627_0000119_1265_2161 297
483 3300001904 JGI24736J21556_1000009 JGI24736J21556_100000912 298
484 3300001976 JGI24752J21851_1000050 JGI24752J21851_10000504 298
485 3300001979 JGI24740J21852_10010195 JGI24740J21852_100101952 298
486 3300001990 JGI24737J22298_10007618 JGI24737J22298_100076181 298
487 3300002067 JGI24735J21928_10014732 JGI24735J21928_100147323 298
488 3300002070 JGI24750J21931_1000069 JGI24750J21931_100006910 298
489 3300002074 JGI24748J21848_1000066 JGI24748J21848_100006625 298
490 3300002075 JGI24738J21930_10002257 JGI24738J21930_100022574 298
491 3300002076 JGI24749J21850_1001470 JGI24749J21850_10014704 298
492 3300002239 JGI24034J26672_10000015 JGI24034J26672_1000001525 298
493 3300003773 Ga0055537_1000848 Ga0055537_100084813 298
494 3300003792 Ga0055540_1000185 Ga0055540_100018547 298
495 3300003794 Ga0055531_10000088 Ga0055531_1000008858 298
496 3300005327 Ga0070658_10056600 Ga0070658_100566003 298
497 3300005330 Ga0070690_100000025 Ga0070690_10000002524 298
498 3300005331 Ga0070670_100013049 Ga0070670_1000130494 298
499 3300005331 Ga0070670_100043150 Ga0070670_1000431502 298
500 3300005335 Ga0070666_10000015 Ga0070666_10000015203 298
501 3300005335 Ga0070666_10012707 Ga0070666_100127078 298
502 3300005340 Ga0070689_100177108 Ga0070689_1001771082 298
503 3300005344 Ga0070661_100292769 Ga0070661_1002927692 298
504 3300005347 Ga0070668_100000058 Ga0070668_10000005859 298
505 3300005347 Ga0070668_100000871 Ga0070668_1000008715 298
506 3300005353 Ga0070669_100000059 Ga0070669_100000059103 298
507 3300005355 Ga0070671_100000596 Ga0070671_10000059616 298
508 3300005355 Ga0070671_100000769 Ga0070671_10000076914 298
509 3300005365 Ga0070688_100003242 Ga0070688_1000032429 298
510 3300005367 Ga0070667_100000019 Ga0070667_10000001953 298
511 3300005367 Ga0070667_100014765 Ga0070667_1000147657 298
512 3300005466 Ga0070685_10000297 Ga0070685_1000029724 298
513 3300005544 Ga0070686_100000006 Ga0070686_10000000650 298
514 3300005548 Ga0070665_100000217 Ga0070665_10000021789 298
515 3300005548 Ga0070665_100000432 Ga0070665_10000043251 298
516 3300005548 Ga0070665_100066493 Ga0070665_1000664935 298
517 3300005563 Ga0068855_100538335 Ga0068855_1005383352 298
518 3300005564 Ga0070664_100116401 Ga0070664_1001164012 298
519 3300005614 Ga0068856_100408516 Ga0068856_1004085162 298
520 3300005616 Ga0068852_100490974 Ga0068852_1004909741 298
521 3300005617 Ga0068859_100017939 Ga0068859_1000179393 298
522 3300005618 Ga0068864_100010503 Ga0068864_1000105037 298
523 3300005719 Ga0068861_100012847 Ga0068861_1000128472 298
524 3300005834 Ga0068851_10020930 Ga0068851_100209302 298
525 3300005841 Ga0068863_100000012 Ga0068863_10000001277 298
526 3300005841 Ga0068863_100000108 Ga0068863_10000010876 298
527 3300005841 Ga0068863_100000635 Ga0068863_10000063522 298
528 3300005842 Ga0068858_100000138 Ga0068858_10000013836 298
529 3300005842 Ga0068858_100000582 Ga0068858_10000058216 298
530 3300005843 Ga0068860_100000042 Ga0068860_100000042128 298
531 3300005843 Ga0068860_100000050 Ga0068860_100000050204 298
532 3300005844 Ga0068862_100000062 Ga0068862_10000006225 298
533 3300005844 Ga0068862_100000660 Ga0068862_1000006607 298
534 3300006051 Ga0075364_10040314 Ga0075364_100403142 298
535 3300006195 Ga0075366_10089611 Ga0075366_100896112 298
536 3300006353 Ga0075370_10062891 Ga0075370_100628912 298
537 3300006931 Ga0097620_100017941 Ga0097620_1000179413 298
538 3300009101 Ga0105247_10004563 Ga0105247_100045637 298
539 3300009177 Ga0105248_10019086 Ga0105248_100190868 298
540 3300009545 Ga0105237_10180984 Ga0105237_101809842 298
541 3300009553 Ga0105249_10000034 Ga0105249_1000003423 298
542 3300009553 Ga0105249_10003540 Ga0105249_1000354013 298
543 3300009553 Ga0105249_10314151 Ga0105249_103141511 298
544 3300012513 Ga0157326_1000187 Ga0157326_10001874 298
545 3300013100 Ga0157373_10156076 Ga0157373_101560762 298
546 3300013104 Ga0157370_10034274 Ga0157370_100342744 298
547 3300013105 Ga0157369_10028725 Ga0157369_100287253 298
548 3300014325 Ga0163163_10012276 Ga0163163_100122767 298
549 3300014326 Ga0157380_10005251 Ga0157380_1000525110 298
550 3300014968 Ga0157379_10023993 Ga0157379_100239932 298
551 3300017792 Ga0163161_10000051 Ga0163161_10000051129 298
552 3300021384 Ga0213876_10000004 Ga0213876_10000004577 298
553 3300025273 Ga0209673_1012060 Ga0209673_10120601 298
554 3300025292 Ga0209676_1000288 Ga0209676_100028846 298
555 3300025295 Ga0209564_1000378 Ga0209564_100037819 298
556 3300025298 Ga0209050_1000001 Ga0209050_10000011585 298
557 3300025303 Ga0209051_1000209 Ga0209051_100020958 298
558 3300025304 Ga0209257_1000111 Ga0209257_1000111136 298
559 3300025321 Ga0207656_10003640 Ga0207656_100036403 298
560 3300025903 Ga0207680_10000007 Ga0207680_10000007427 298
561 3300025903 Ga0207680_10071182 Ga0207680_100711824 298
562 3300025904 Ga0207647_10001490 Ga0207647_1000149015 298
563 3300025909 Ga0207705_10196371 Ga0207705_101963712 298
564 3300025911 Ga0207654_10010935 Ga0207654_100109356 298
565 3300025913 Ga0207695_10006157 Ga0207695_100061573 298
566 3300025914 Ga0207671_10000658 Ga0207671_1000065845 298
567 3300025919 Ga0207657_10020658 Ga0207657_100206583 298
568 3300025923 Ga0207681_10000089 Ga0207681_1000008935 298
569 3300025923 Ga0207681_10008485 Ga0207681_100084859 298
570 3300025924 Ga0207694_10001347 Ga0207694_1000134716 298
571 3300025925 Ga0207650_10011464 Ga0207650_100114641 298
572 3300025931 Ga0207644_10000070 Ga0207644_1000007035 298
573 3300025931 Ga0207644_10000089 Ga0207644_1000008948 298
574 3300025932 Ga0207690_10312392 Ga0207690_103123922 298
575 3300025933 Ga0207706_10138359 Ga0207706_101383592 298
576 3300025936 Ga0207670_10121888 Ga0207670_101218882 298
577 3300025949 Ga0207667_10096687 Ga0207667_100966871 298
578 3300025961 Ga0207712_10000004 Ga0207712_10000004415 298
579 3300025961 Ga0207712_10039334 Ga0207712_100393342 298
580 3300025972 Ga0207668_10000061 Ga0207668_1000006140 298
581 3300025972 Ga0207668_10000358 Ga0207668_100003585 298
582 3300025981 Ga0207640_10035325 Ga0207640_100353252 298
583 3300025981 Ga0207640_10138330 Ga0207640_101383302 298
584 3300025986 Ga0207658_10000002 Ga0207658_1000000281 298
585 3300025986 Ga0207658_10000921 Ga0207658_100009216 298
586 3300026035 Ga0207703_10000208 Ga0207703_1000020839 298
587 3300026035 Ga0207703_10001141 Ga0207703_1000114123 298
588 3300026041 Ga0207639_10071907 Ga0207639_100719073 298
589 3300026067 Ga0207678_10024856 Ga0207678_100248565 298
590 3300026078 Ga0207702_10007774 Ga0207702_100077742 298
591 3300026088 Ga0207641_10000024 Ga0207641_1000002499 298
592 3300026088 Ga0207641_10000242 Ga0207641_1000024245 298
593 3300026088 Ga0207641_10000428 Ga0207641_1000042829 298
594 3300026095 Ga0207676_10001031 Ga0207676_1000103111 298
595 3300026095 Ga0207676_10007870 Ga0207676_100078703 298
596 3300026116 Ga0207674_10120844 Ga0207674_101208442 298
597 3300026118 Ga0207675_100000449 Ga0207675_10000044938 298
598 3300026118 Ga0207675_100048741 Ga0207675_1000487412 298
599 3300026142 Ga0207698_10017195 Ga0207698_100171954 298
600 3300028379 Ga0268266_10000225 Ga0268266_1000022524 298
601 3300028379 Ga0268266_10001194 Ga0268266_1000119414 298
602 3300028379 Ga0268266_10024500 Ga0268266_100245005 298
603 3300028380 Ga0268265_10000086 Ga0268265_10000086119 298
604 3300028380 Ga0268265_10000443 Ga0268265_1000044339 298
605 3300028380 Ga0268265_10032281 Ga0268265_100322813 298
606 3300028381 Ga0268264_10000001 Ga0268264_10000001406 298
607 3300028381 Ga0268264_10000003 Ga0268264_10000003429 298
608 3300031548 Ga0307408_100245214 Ga0307408_1002452142 298
609 3300031824 Ga0307413_10096605 Ga0307413_100966052 298
610 3300032004 Ga0307414_10085486 Ga0307414_100854864 298
611 3300032005 Ga0307411_10122243 Ga0307411_101222433 298
612 3300039437 Ga0436365_0970858 Ga0436365_0970858_39768_40682 298
613 3300039453 Ga0436362_0554113 Ga0436362_0554113_70996_71910 298
614 3300045976 Ga0466967_0113310 Ga0466967_0113310_1539_2441 298
615 3300046507 Ga0495606_0000121 Ga0495606_0000121_73843_74742 298
616 3300046507 Ga0495606_0006944 Ga0495606_0006944_5863_6768 298
617 3300046530 Ga0495654_0001760 Ga0495654_0001760_9385_10443 298
618 3300046616 Ga0495668_0003468 Ga0495668_0003468_3816_4874 298
619 3300047469 Ga0495673_0078544 Ga0495673_0078544_338_1249 298
620 3300047472 Ga0495686_0000070 Ga0495686_0000070_133040_133972 298
621 3300047472 Ga0495686_0006254 Ga0495686_0006254_5526_6473 298
622 3300047472 Ga0495686_0199892 Ga0495686_0199892_164_1120 298
623 3300048905 Ga0496102_0017559 Ga0496102_0017559_2485_3501 298
624 3300048906 Ga0496103_0001574 Ga0496103_0001574_2436_3452 298
625 3300048907 Ga0496104_0064916 Ga0496104_0064916_900_1940 298
626 3300048909 Ga0496106_0073028 Ga0496106_0073028_32_1048 298
627 3300048920 Ga0496117_0026459 Ga0496117_0026459_2259_3269 298
628 3300048920 Ga0496117_0034784 Ga0496117_0034784_2799_3746 298
629 3300048921 Ga0496118_0024761 Ga0496118_0024761_1261_2277 298
630 3300048928 Ga0496125_0053689 Ga0496125_0053689_1950_2855 298
631 3300049162 Ga0501307_004736 Ga0501307_004736_468_1385 298
632 3300049679 Ga0501249_000126 Ga0501249_000126_20480_21397 298
633 3300050491 nmdc:mga00v17_15270_c2 nmdc:mga00v17_15270_c2_1079_1993 298
634 3300053116 Ga0500592_000260 Ga0500592_000260_6806_7753 298
635 3300053136 Ga0500559_0009417 Ga0500559_0009417_649_1590 298
636 3300053139 Ga0500568_0000245 Ga0500568_0000245_13107_14015 298
637 3300053142 Ga0500577_0044425 Ga0500577_0044425_382_1299 298
638 3300053153 Ga0500616_0000140 Ga0500616_0000140_51309_52217 298
639 3300053158 Ga0500627_0000686 Ga0500627_0000686_3541_4599 298

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14518

Haem_oxygenas_2

Iron-containing redox enzyme

148

321

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6vzy-assembly1.cif.gz_B crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 with a diiron(ii) central domain cofactor 0.7659 15 296
6vzy-assembly1.cif.gz_A crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 with a diiron(ii) central domain cofactor 0.7596 15 296
1otw-assembly1.cif.gz_A crystal structure of pqqc in complex with pqq and a putative h2o2 0.7552 73 297
8e8w-assembly1.cif.gz_A crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 mononuclear fe(ii) structure on the hdo cofactor assembly pathway 0.7411 15 296
1rcw-assembly2.cif.gz_C-2 crystal structure of ct610 from chlamydia trachomatis 0.7368 58 288
ID Description Score Start End Superfamily
1rcwC00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.7621 76 288 1.20.910.10
1rcwC00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.7559 76 288 1.20.910.10
3bjdA02 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.7351 93 297 1.20.910.10
1iw1A00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.708 66 291 1.20.910.10
af_Q0J3L2_49_284_1.20.910.10 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.682 77 290 1.20.910.10
ID Description Score Start End GO Terms
AF-A0A4Q3BUP7-F1-model_v4 Iron-containing redox enzyme family protein 0.9968 148 297
AF-A0A534YAS0-F1-model_v4 Iron-containing redox enzyme family protein 0.9915 18 294
AF-A0A2A2K2C7-F1-model_v4 Iron-containing redox enzyme family protein 0.9914 10 293
AF-A0A4Q2ZPS1-F1-model_v4 Iron-containing redox enzyme family protein 0.9913 13 229
AF-A0A0Q4C8K0-F1-model_v4 Iron-containing redox enzyme family protein 0.9912 15 298 GO:0016491

Feature Viewer

pLDDT pTM Quality
93.71 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map