F471537

General Info

Members Datasets Scaffolds Average Seq Length
638 307 625 240

Family's Representative Sequence

Representative Sequence 3300044693|Ga0466961_0133963|Ga0466961_0133963_381_1157
Length 258
Sequence LFYWFLKFVAIGPIAHLVYRPRAQGADNIPRTGAAILASNHLSAADWIFMPLSISRRVTFLAKAEYFTGTGVKGFLQRVFFAGSGQVPIDRTNASAAEDAIRTGVRMLGEGRLLGIYPEGTRSPDGRLYRGKTGVARMALDTGVPVIPVAMVYRRRTLPFGLKVPFAGKLVRVEVVFGKPLDFSRYAGLSGDRFVERSITDEIMYEIMTLSGQEYVDVYGAQVKKTMDDTGASAVEVVRKLTPPMAEVGDRVPESLAG

Samples

Sample ID Description Type Environment
1 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
2 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
3 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
4 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
5 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
6 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
7 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
8 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
9 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
10 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
11 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
12 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
13 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
14 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
15 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
16 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
17 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
18 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
112 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
174 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
175 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
176 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
177 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
178 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
179 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
180 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
181 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
183 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
186 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
187 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
188 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
189 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
190 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
191 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
192 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
193 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
194 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
195 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
196 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
197 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
198 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
199 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
200 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
201 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
202 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
203 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
204 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
205 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
206 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
207 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
208 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
209 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
210 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
211 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
212 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
213 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
214 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
215 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
216 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
217 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
218 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
219 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
220 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
221 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
222 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
223 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
224 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
225 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
226 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
227 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
228 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
229 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
230 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
231 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
232 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
233 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
234 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
237 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
238 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
239 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
240 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
241 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
242 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
243 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
244 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
245 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
246 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
247 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
248 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
249 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
250 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
251 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
252 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
253 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
254 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
255 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
256 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
257 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
258 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
259 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
260 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
271 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
272 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
273 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
274 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
275 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
276 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
278 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
279 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
280 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
281 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
282 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
283 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
284 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
285 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
286 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
287 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
288 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
289 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
290 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
291 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
292 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
293 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
294 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
295 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
296 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
297 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
298 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
299 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
300 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
301 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
302 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
303 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
304 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
305 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
306 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
307 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.96
Metatranscriptomes 0
Isolates 2.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.2
Nodule 0.16
Rhizoplane 12.23
Rhizosphere 64.42
Stem 0
Stem Tuber 0
Unclassified 7.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10014965 3300001991 Bacteria 1434
2 JGI24745J21846_1003720 3300002073 Bacteria 1607
3 JGI24744J21845_10000009 3300002077 Bacteria 22522
4 JGI24744J21845_10002625 3300002077 Bacteria 3671
5 JGI24742J22300_10013785 3300002244 Bacteria 1354
6 rootH2_10083697 3300003320 Bacteria 3900
7 rootH1_10101351 3300003323 Bacteria 3705
8 Ga0055540_1000134 3300003792 Bacteria 73612
9 Ga0055540_1002706 3300003792 Bacteria 9128
10 Ga0055540_1003818 3300003792 Bacteria 7093
11 Ga0055540_1007916 3300003792 Bacteria 3914
12 Ga0070676_10062815 3300005328 Bacteria 2211
13 Ga0070683_100433906 3300005329 Bacteria 1253
14 Ga0070690_100068918 3300005330 Bacteria 2295
15 Ga0070670_100114719 3300005331 Bacteria 2322
16 Ga0068869_100016210 3300005334 Bacteria 5018
17 Ga0068869_100616676 3300005334 Bacteria 918
18 Ga0070666_10133633 3300005335 Bacteria 1725
19 Ga0070682_100021096 3300005337 Bacteria 3840
20 Ga0070682_100055105 3300005337 Bacteria 2497
21 Ga0070660_100076903 3300005339 Bacteria 2615
22 Ga0070689_100014639 3300005340 Bacteria 5703
23 Ga0070668_100004804 3300005347 Bacteria 10017
24 Ga0070668_100005168 3300005347 Bacteria 9678
25 Ga0070668_100006643 3300005347 Bacteria 8573
26 Ga0070669_100009947 3300005353 Bacteria 6767
27 Ga0070669_100376690 3300005353 Bacteria 1157
28 Ga0070671_100004858 3300005355 Bacteria 10689
29 Ga0070674_100000581 3300005356 Bacteria 18458
30 Ga0070688_100015237 3300005365 Bacteria 4368
31 Ga0070667_100000191 3300005367 Bacteria 73538
32 Ga0070667_100000249 3300005367 Bacteria 61169
33 Ga0070667_100014001 3300005367 Bacteria 6629
34 Ga0070667_100022877 3300005367 Bacteria 5183
35 Ga0070667_100167488 3300005367 Bacteria 1938
36 Ga0070709_10077038 3300005434 Bacteria 2167
37 Ga0070709_10112689 3300005434 Bacteria 1831
38 Ga0070710_10003776 3300005437 Bacteria 7164
39 Ga0070710_10005428 3300005437 Bacteria 6053
40 Ga0070701_10050054 3300005438 Bacteria 2162
41 Ga0070711_100001467 3300005439 Bacteria 12960
42 Ga0070711_100045002 3300005439 Bacteria 2999
43 Ga0070705_100004751 3300005440 Bacteria 6615
44 Ga0070705_100098840 3300005440 Bacteria 1838
45 Ga0070700_100005401 3300005441 Bacteria 6766
46 Ga0070700_100350648 3300005441 Bacteria 1094
47 Ga0070694_100011967 3300005444 Bacteria 5384
48 Ga0070708_100189708 3300005445 Bacteria 1922
49 Ga0070663_100035642 3300005455 Bacteria 3453
50 Ga0070663_100196850 3300005455 Bacteria 1571
51 Ga0070678_100008146 3300005456 Bacteria 6262
52 Ga0070678_100058911 3300005456 Bacteria 2821
53 Ga0070678_100163806 3300005456 Bacteria 1804
54 Ga0070662_100013537 3300005457 Bacteria 5430
55 Ga0070662_100161959 3300005457 Bacteria 1750
56 Ga0068867_100024024 3300005459 Bacteria 4367
57 Ga0068853_100028693 3300005539 Bacteria 4683
58 Ga0068853_100087656 3300005539 Bacteria 2732
59 Ga0068853_100173947 3300005539 Bacteria 1949
60 Ga0070695_100007477 3300005545 Bacteria 6471
61 Ga0070696_100004718 3300005546 Bacteria 9115
62 Ga0070693_100075378 3300005547 Bacteria 1997
63 Ga0070693_100105057 3300005547 Bacteria 1727
64 Ga0070693_100423955 3300005547 Bacteria 928
65 Ga0070665_100003487 3300005548 Bacteria 16749
66 Ga0070665_100045561 3300005548 Bacteria 4404
67 Ga0070665_100070529 3300005548 Bacteria 3501
68 Ga0070665_100380893 3300005548 Bacteria 1418
69 Ga0070704_100000677 3300005549 Bacteria 16532
70 Ga0070704_100699863 3300005549 Bacteria 898
71 Ga0068855_100040762 3300005563 Bacteria 5509
72 Ga0068854_100014805 3300005578 Bacteria 5149
73 Ga0068854_100072482 3300005578 Bacteria 2522
74 Ga0068856_100240195 3300005614 Bacteria 1827
75 Ga0070702_100103424 3300005615 Bacteria 1751
76 Ga0068852_100033994 3300005616 Bacteria 4240
77 Ga0068852_100045495 3300005616 Bacteria 3734
78 Ga0068852_100168834 3300005616 Bacteria 2049
79 Ga0068859_100001601 3300005617 Bacteria 23121
80 Ga0068859_100952406 3300005617 Bacteria 942
81 Ga0068864_100161505 3300005618 Bacteria 2037
82 Ga0068866_10000520 3300005718 Bacteria 17787
83 Ga0068866_10047924 3300005718 Bacteria 2157
84 Ga0068861_100003598 3300005719 Bacteria 10321
85 Ga0068861_100159822 3300005719 Bacteria 1857
86 Ga0068861_100755752 3300005719 Bacteria 908
87 Ga0068863_100010519 3300005841 Bacteria 8986
88 Ga0068863_100012939 3300005841 Bacteria 8048
89 Ga0068863_100082108 3300005841 Bacteria 3054
90 Ga0068858_100006097 3300005842 Bacteria 11762
91 Ga0068858_100014971 3300005842 Bacteria 7298
92 Ga0068858_100334928 3300005842 Bacteria 1448
93 Ga0068860_100000166 3300005843 Bacteria 108310
94 Ga0068860_100006908 3300005843 Bacteria 11380
95 Ga0068860_100234542 3300005843 Bacteria 1783
96 Ga0068862_100000003 3300005844 Bacteria 369793
97 Ga0068862_100088655 3300005844 Bacteria 2692
98 Ga0068862_100445674 3300005844 Bacteria 1219
99 Ga0081455_10067557 3300005937 Bacteria 2978
100 Ga0081538_10101894 3300005981 Bacteria 1443
101 Ga0075365_10255448 3300006038 Bacteria 1232
102 Ga0075365_10454083 3300006038 Bacteria 905
103 Ga0075363_100000454 3300006048 Bacteria 12853
104 Ga0075363_100001144 3300006048 Bacteria 9695
105 Ga0075363_100005022 3300006048 Bacteria 5854
106 Ga0075363_100018402 3300006048 Bacteria 3481
107 Ga0075363_100036166 3300006048 Bacteria 2589
108 Ga0075363_100039226 3300006048 Bacteria 2492
109 Ga0075363_100078622 3300006048 Bacteria 1801
110 Ga0075363_100249329 3300006048 Bacteria 1022
111 Ga0075364_10002046 3300006051 Bacteria 11255
112 Ga0075364_10005383 3300006051 Bacteria 7430
113 Ga0075364_10019149 3300006051 Bacteria 4293
114 Ga0075364_10032430 3300006051 Bacteria 3358
115 Ga0075364_10291537 3300006051 Bacteria 1110
116 Ga0075364_10406719 3300006051 Bacteria 929
117 Ga0070715_10016250 3300006163 Bacteria 2792
118 Ga0070715_10021834 3300006163 Bacteria 2488
119 Ga0070716_100010114 3300006173 Bacteria 4722
120 Ga0070712_100001110 3300006175 Bacteria 16202
121 Ga0070712_100064996 3300006175 Bacteria 2588
122 Ga0075362_10044195 3300006177 Bacteria 1975
123 Ga0075362_10114645 3300006177 Bacteria 1271
124 Ga0075367_10008558 3300006178 Bacteria 5307
125 Ga0075367_10225349 3300006178 Bacteria 1174
126 Ga0075369_10000607 3300006186 Bacteria 11369
127 Ga0075369_10011042 3300006186 Bacteria 3543
128 Ga0075369_10025324 3300006186 Bacteria 2465
129 Ga0075369_10026915 3300006186 Bacteria 2400
130 Ga0075369_10051736 3300006186 Bacteria 1779
131 Ga0075369_10154357 3300006186 Bacteria 1050
132 Ga0075369_10252892 3300006186 Bacteria 818
133 Ga0075366_10062099 3300006195 Bacteria 2221
134 Ga0097621_100112401 3300006237 Bacteria 2303
135 Ga0075370_10014652 3300006353 Bacteria 4186
136 Ga0075370_10015322 3300006353 Bacteria 4102
137 Ga0075370_10104268 3300006353 Bacteria 1643
138 Ga0068871_100027734 3300006358 Bacteria 4432
139 Ga0075428_100001482 3300006844 Bacteria 25105
140 Ga0075430_100086951 3300006846 Bacteria 2616
141 Ga0075431_100099832 3300006847 Bacteria 2995
142 Ga0068865_100004263 3300006881 Bacteria 8625
143 Ga0097620_100001601 3300006931 Bacteria 23121
144 Ga0097620_100952382 3300006931 Bacteria 942
145 Ga0105250_10209034 3300009092 Bacteria 825
146 Ga0105245_10000546 3300009098 Bacteria 34304
147 Ga0105245_10056831 3300009098 Bacteria 3518
148 Ga0105247_10000006 3300009101 Bacteria 416061
149 Ga0105247_10000268 3300009101 Bacteria 48320
150 Ga0105247_10013812 3300009101 Bacteria 4842
151 Ga0105247_10118664 3300009101 Bacteria 1712
152 Ga0114129_10006853 3300009147 Bacteria 16195
153 Ga0105243_10001875 3300009148 Bacteria 17930
154 Ga0105243_10422833 3300009148 Bacteria 1243
155 Ga0105241_10038459 3300009174 Bacteria 3606
156 Ga0105242_10001078 3300009176 Bacteria 21421
157 Ga0105242_10075637 3300009176 Bacteria 2804
158 Ga0105248_10000042 3300009177 Bacteria 167583
159 Ga0105248_10005867 3300009177 Bacteria 13493
160 Ga0105248_10021747 3300009177 Bacteria 7107
161 Ga0105237_10000175 3300009545 Bacteria 90284
162 Ga0105237_10008949 3300009545 Bacteria 10780
163 Ga0105237_10140080 3300009545 Bacteria 2413
164 Ga0105249_10000008 3300009553 Bacteria 341271
165 Ga0105249_10001494 3300009553 Bacteria 20512
166 Ga0105249_10037507 3300009553 Bacteria 4399
167 Ga0105249_10352031 3300009553 Bacteria 1492
168 Ga0099796_10020316 3300010159 Bacteria 2028
169 Ga0105239_10015485 3300010375 Bacteria 8448
170 Ga0105239_10057646 3300010375 Bacteria 4261
171 Ga0105239_10058072 3300010375 Bacteria 4245
172 Ga0105239_11229807 3300010375 Bacteria 863
173 Ga0105246_10773996 3300011119 Bacteria 849
174 Ga0157369_10527693 3300013105 Bacteria 1221
175 Ga0157374_10003900 3300013296 Bacteria 12523
176 Ga0157378_10000438 3300013297 Bacteria 40289
177 Ga0163162_10008681 3300013306 Bacteria 9890
178 Ga0163162_10081003 3300013306 Bacteria 3316
179 Ga0163162_10454178 3300013306 Bacteria 1413
180 Ga0157375_10002558 3300013308 Bacteria 15793
181 Ga0157375_10027547 3300013308 Bacteria 5313
182 Ga0157375_10590150 3300013308 Bacteria 1271
183 Ga0163163_10045891 3300014325 Bacteria 4291
184 Ga0163163_10134954 3300014325 Bacteria 2509
185 Ga0157380_10001136 3300014326 Bacteria 17184
186 Ga0157377_10041674 3300014745 Bacteria 2548
187 Ga0157377_10449361 3300014745 Bacteria 889
188 Ga0157379_10012283 3300014968 Bacteria 7480
189 Ga0157379_10048384 3300014968 Bacteria 3795
190 Ga0157376_10739286 3300014969 Bacteria 992
191 Ga0163161_10001864 3300017792 Bacteria 15389
192 Ga0163161_10454452 3300017792 Bacteria 1036
193 Ga0213876_10003702 3300021384 Bacteria 8672
194 Ga0209673_1002617 3300025273 Bacteria 12097
195 Ga0209051_1000076 3300025303 Bacteria 204355
196 Ga0209051_1003302 3300025303 Bacteria 10692
197 Ga0209051_1004832 3300025303 Bacteria 8107
198 Ga0209051_1008643 3300025303 Bacteria 5362
199 Ga0207653_10062752 3300025885 Bacteria 1256
200 Ga0207692_10001998 3300025898 Bacteria 7790
201 Ga0207692_10235668 3300025898 Bacteria 1091
202 Ga0207642_10000093 3300025899 Bacteria 23453
203 Ga0207710_10000114 3300025900 Bacteria 101498
204 Ga0207710_10004621 3300025900 Bacteria 5981
205 Ga0207688_10001107 3300025901 Bacteria 13835
206 Ga0207688_10056743 3300025901 Bacteria 2201
207 Ga0207680_10091542 3300025903 Bacteria 1935
208 Ga0207680_10356756 3300025903 Bacteria 1028
209 Ga0207647_10014725 3300025904 Bacteria 5385
210 Ga0207647_10200202 3300025904 Bacteria 1156
211 Ga0207685_10016984 3300025905 Bacteria 2341
212 Ga0207685_10070113 3300025905 Bacteria 1418
213 Ga0207699_10349614 3300025906 Bacteria 1043
214 Ga0207645_10015974 3300025907 Bacteria 4973
215 Ga0207705_10458973 3300025909 Bacteria 988
216 Ga0207654_10140491 3300025911 Bacteria 1539
217 Ga0207671_10008374 3300025914 Bacteria 8777
218 Ga0207671_10015547 3300025914 Bacteria 5952
219 Ga0207671_10026196 3300025914 Bacteria 4371
220 Ga0207693_10000694 3300025915 Bacteria 30256
221 Ga0207693_10002045 3300025915 Bacteria 17662
222 Ga0207663_10011346 3300025916 Bacteria 4782
223 Ga0207663_10032882 3300025916 Bacteria 3083
224 Ga0207657_10116159 3300025919 Bacteria 2205
225 Ga0207681_10007054 3300025923 Bacteria 6894
226 Ga0207681_10361613 3300025923 Bacteria 1164
227 Ga0207650_10168498 3300025925 Bacteria 1739
228 Ga0207687_10000192 3300025927 Bacteria 41036
229 Ga0207664_10113234 3300025929 Bacteria 2259
230 Ga0207664_10485016 3300025929 Bacteria 1106
231 Ga0207644_10035309 3300025931 Bacteria 3502
232 Ga0207644_10209552 3300025931 Bacteria 1540
233 Ga0207690_10006095 3300025932 Bacteria 7144
234 Ga0207690_10324383 3300025932 Bacteria 1211
235 Ga0207706_10050314 3300025933 Bacteria 3682
236 Ga0207706_10207358 3300025933 Bacteria 1718
237 Ga0207686_10000761 3300025934 Bacteria 19817
238 Ga0207686_10042042 3300025934 Bacteria 2791
239 Ga0207709_10003124 3300025935 Bacteria 9962
240 Ga0207709_10298266 3300025935 Bacteria 1197
241 Ga0207709_10352201 3300025935 Bacteria 1112
242 Ga0207670_10207166 3300025936 Bacteria 1493
243 Ga0207669_10000794 3300025937 Bacteria 13541
244 Ga0207669_10034952 3300025937 Bacteria 2854
245 Ga0207669_10322057 3300025937 Bacteria 1184
246 Ga0207704_10001730 3300025938 Bacteria 9776
247 Ga0207704_10211349 3300025938 Bacteria 1428
248 Ga0207665_10002960 3300025939 Bacteria 11381
249 Ga0207711_10004319 3300025941 Bacteria 12143
250 Ga0207711_10005647 3300025941 Bacteria 10569
251 Ga0207711_10080007 3300025941 Bacteria 2854
252 Ga0207711_10490822 3300025941 Bacteria 1144
253 Ga0207689_10013622 3300025942 Bacteria 6934
254 Ga0207689_10106862 3300025942 Bacteria 2300
255 Ga0207667_10215304 3300025949 Bacteria 1968
256 Ga0207712_10000011 3300025961 Bacteria 412321
257 Ga0207712_10007913 3300025961 Bacteria 6714
258 Ga0207712_10409967 3300025961 Bacteria 1141
259 Ga0207668_10001297 3300025972 Bacteria 14853
260 Ga0207668_10006197 3300025972 Bacteria 7061
261 Ga0207668_10441699 3300025972 Bacteria 1108
262 Ga0207640_10001367 3300025981 Bacteria 13196
263 Ga0207640_10086459 3300025981 Bacteria 2159
264 Ga0207658_10000071 3300025986 Bacteria 112481
265 Ga0207658_10001438 3300025986 Bacteria 18563
266 Ga0207658_10003482 3300025986 Bacteria 11118
267 Ga0207658_10028827 3300025986 Bacteria 3913
268 Ga0207677_10002641 3300026023 Bacteria 9433
269 Ga0207677_10082201 3300026023 Bacteria 2314
270 Ga0207703_10002411 3300026035 Bacteria 16246
271 Ga0207703_10013161 3300026035 Bacteria 6446
272 Ga0207639_10001924 3300026041 Bacteria 13948
273 Ga0207639_10333285 3300026041 Bacteria 1351
274 Ga0207678_10006766 3300026067 Bacteria 10165
275 Ga0207678_10046342 3300026067 Bacteria 3759
276 Ga0207678_10057966 3300026067 Bacteria 3333
277 Ga0207678_10130336 3300026067 Bacteria 2145
278 Ga0207678_10220019 3300026067 Bacteria 1625
279 Ga0207678_10234877 3300026067 Bacteria 1570
280 Ga0207708_10000587 3300026075 Bacteria 28161
281 Ga0207708_10316656 3300026075 Bacteria 1272
282 Ga0207708_10505728 3300026075 Bacteria 1013
283 Ga0207702_10192627 3300026078 Bacteria 1885
284 Ga0207641_10001975 3300026088 Bacteria 19593
285 Ga0207641_10012640 3300026088 Bacteria 6924
286 Ga0207641_10275978 3300026088 Bacteria 1579
287 Ga0207641_10329810 3300026088 Bacteria 1449
288 Ga0207648_10001309 3300026089 Bacteria 27704
289 Ga0207676_10038375 3300026095 Bacteria 3655
290 Ga0207675_100001516 3300026118 Bacteria 23283
291 Ga0207675_100015385 3300026118 Bacteria 7135
292 Ga0207675_100089981 3300026118 Bacteria 2885
293 Ga0207683_10000275 3300026121 Bacteria 46018
294 Ga0207683_10010271 3300026121 Bacteria 7983
295 Ga0207698_10241430 3300026142 Bacteria 1647
296 Ga0268266_10021095 3300028379 Bacteria 5551
297 Ga0268266_10040687 3300028379 Bacteria 3963
298 Ga0268266_10091359 3300028379 Bacteria 2669
299 Ga0268266_10335613 3300028379 Bacteria 1418
300 Ga0268266_10564552 3300028379 Bacteria 1091
301 Ga0268265_10000010 3300028380 Bacteria 370129
302 Ga0268265_10002946 3300028380 Bacteria 12471
303 Ga0268264_10000007 3300028381 Bacteria 815790
304 Ga0268264_10004702 3300028381 Bacteria 11600
305 Ga0265327_10022776 3300031251 Bacteria 3731
306 Ga0307405_10516291 3300031731 Bacteria 960
307 Ga0307413_10010210 3300031824 Bacteria 4540
308 Ga0307410_10067917 3300031852 Bacteria 2460
309 Ga0307406_10114405 3300031901 Bacteria 1863
310 Ga0307407_10243881 3300031903 Bacteria 1227
311 Ga0307409_100144777 3300031995 Bacteria 2053
312 Ga0307409_100226586 3300031995 Bacteria 1691
313 Ga0307411_10057291 3300032005 Bacteria 2573
314 Ga0307415_100038996 3300032126 Bacteria 3135
315 Ga0307415_100457750 3300032126 Bacteria 1105
316 Ga0373926_0000954 3300035083 Bacteria 8386
317 Ga0373940_0110420 3300035088 Bacteria 844
318 Ga0373952_0014883 3300035092 Bacteria 1563
319 Ga0373939_0139759 3300035114 Bacteria 872
320 Ga0373942_0039190 3300035207 Bacteria 1288
321 Ga0373962_0193217 3300035242 Bacteria 686
322 Ga0373931_0010828 3300035691 Bacteria 4389
323 Ga0373935_0013456 3300035692 Bacteria 4937
324 Ga0373947_0000002 3300035725 Bacteria 383924
325 Ga0373947_0273523 3300035725 Bacteria 1122
326 Ga0316584_0026131 3300036712 Bacteria 4289
327 Ga0395898_0186321 3300037466 Bacteria 1983
328 Ga0395901_0041482 3300038443 Bacteria 4770
329 Ga0436365_0768449 3300039437 Bacteria 3761
330 Ga0436365_1472485 3300039437 Bacteria 19466
331 Ga0436363_1552280 3300039450 Bacteria 1701
332 Ga0439461_0004455 3300041410 Bacteria 2340
333 Ga0439466_0024420 3300041411 Bacteria 2118
334 Ga0439466_0027114 3300041411 Bacteria 1985
335 Ga0439466_0048526 3300041411 Bacteria 1396
336 Ga0439465_0001917 3300041413 Bacteria 6818
337 Ga0439465_0002533 3300041413 Bacteria 5961
338 Ga0439465_0003858 3300041413 Bacteria 4890
339 Ga0451789_0481125 3300041443 Bacteria 1990
340 Ga0451791_0336379 3300041451 Bacteria 1404
341 Ga0451795_1118406 3300041456 Bacteria 2748
342 Ga0439431_0000791 3300041997 Bacteria 6836
343 Ga0439442_031856 3300042002 Bacteria 1101
344 Ga0439442_041894 3300042002 Bacteria 962
345 Ga0439445_0001479 3300042004 Bacteria 5116
346 Ga0439450_047649 3300042008 Bacteria 1011
347 Ga0439434_0014255 3300042435 Bacteria 2364
348 Ga0466969_0044608 3300044656 Bacteria 2204
349 Ga0466972_0004630 3300044658 Bacteria 6887
350 Ga0466972_0005419 3300044658 Bacteria 6392
351 Ga0466972_0006094 3300044658 Bacteria 6055
352 Ga0466972_0018036 3300044658 Bacteria 3530
353 Ga0466972_0052643 3300044658 Bacteria 1961
354 Ga0466972_0214054 3300044658 Bacteria 902
355 Ga0466965_0001293 3300044683 Bacteria 9967
356 Ga0466965_0007161 3300044683 Bacteria 5110
357 Ga0466965_0089381 3300044683 Bacteria 1565
358 Ga0466966_0002708 3300044684 Bacteria 11624
359 Ga0466966_0007481 3300044684 Bacteria 7238
360 Ga0466966_0031021 3300044684 Bacteria 3467
361 Ga0466966_0039461 3300044684 Bacteria 3041
362 Ga0466966_0051115 3300044684 Bacteria 2628
363 Ga0466961_0002435 3300044693 Bacteria 11547
364 Ga0466961_0095027 3300044693 Bacteria 1880
365 Ga0466961_0118247 3300044693 Bacteria 1665
366 Ga0466961_0133963 3300044693 Bacteria 1553
367 Ga0466961_0207690 3300044693 Bacteria 1209
368 Ga0466963_0021557 3300044694 Bacteria 4067
369 Ga0466963_0031951 3300044694 Bacteria 3405
370 Ga0466964_0044042 3300044706 Bacteria 1812
371 Ga0466964_0165316 3300044706 Bacteria 1037
372 Ga0466968_0001059 3300044735 Bacteria 9752
373 Ga0466968_0005573 3300044735 Bacteria 4716
374 Ga0466968_0011608 3300044735 Bacteria 3435
375 Ga0466970_0009717 3300044765 Bacteria 4867
376 Ga0466970_0064479 3300044765 Bacteria 1964
377 Ga0466970_0267114 3300044765 Bacteria 960
378 Ga0466957_0003131 3300044842 Bacteria 9007
379 Ga0466957_0016543 3300044842 Bacteria 4313
380 Ga0466957_0037442 3300044842 Bacteria 2921
381 Ga0466957_0070327 3300044842 Bacteria 2163
382 Ga0466957_0071835 3300044842 Bacteria 2141
383 Ga0466960_0000250 3300044901 Bacteria 18567
384 Ga0466960_0002318 3300044901 Bacteria 7146
385 Ga0466960_0052586 3300044901 Bacteria 1971
386 Ga0466960_0067075 3300044901 Bacteria 1776
387 Ga0466960_0215671 3300044901 Bacteria 1054
388 Ga0466960_0235860 3300044901 Bacteria 1011
389 Ga0466959_0010871 3300045049 Bacteria 6523
390 Ga0466959_0038977 3300045049 Bacteria 3511
391 Ga0466959_0086965 3300045049 Bacteria 2248
392 Ga0466959_0091046 3300045049 Bacteria 2190
393 Ga0466959_0116419 3300045049 Bacteria 1903
394 Ga0466959_0153334 3300045049 Bacteria 1623
395 Ga0466959_0155306 3300045049 Bacteria 1611
396 Ga0466958_0028446 3300045836 Bacteria 3314
397 Ga0466958_0066351 3300045836 Bacteria 2203
398 Ga0466958_0174056 3300045836 Bacteria 1364
399 Ga0466967_0009722 3300045976 Bacteria 7162
400 Ga0466967_0025879 3300045976 Bacteria 4847
401 Ga0466967_0092389 3300045976 Bacteria 2752
402 Ga0466967_0132359 3300045976 Bacteria 2316
403 Ga0466967_0161616 3300045976 Bacteria 2103
404 Ga0495629_0021149 3300046459 Bacteria 4643
405 Ga0495638_0004056 3300046460 Bacteria 11229
406 Ga0495638_0120841 3300046460 Bacteria 1548
407 Ga0495641_0062335 3300046461 Bacteria 1682
408 Ga0495580_0235945 3300046472 Bacteria 1255
409 Ga0495582_0023073 3300046473 Bacteria 3404
410 Ga0495606_0007438 3300046507 Bacteria 9799
411 Ga0495648_0001449 3300046524 Bacteria 23191
412 Ga0495666_0160849 3300046526 Bacteria 1041
413 Ga0495640_0201960 3300046533 Bacteria 1259
414 Ga0495611_0009134 3300046648 Bacteria 4191
415 Ga0495625_0211300 3300046660 Bacteria 1275
416 Ga0495658_0041410 3300046683 Bacteria 2566
417 Ga0495613_0450727 3300046689 Bacteria 872
418 Ga0495581_0009648 3300047315 Bacteria 5584
419 Ga0495674_0141610 3300047319 Bacteria 2021
420 Ga0495672_0003532 3300047320 Bacteria 13314
421 Ga0495672_0036289 3300047320 Bacteria 3028
422 Ga0495676_0057255 3300047321 Bacteria 3076
423 Ga0495673_0000367 3300047469 Bacteria 54316
424 Ga0495686_0001444 3300047472 Bacteria 25909
425 Ga0495686_0143076 3300047472 Bacteria 1410
426 Ga0495626_0145094 3300048091 Bacteria 1004
427 Ga0496100_0000023 3300048903 Bacteria 121977
428 Ga0496100_0000321 3300048903 Bacteria 23657
429 Ga0496100_0001647 3300048903 Bacteria 11061
430 Ga0496100_0002214 3300048903 Bacteria 9823
431 Ga0496100_0004279 3300048903 Bacteria 7556
432 Ga0496100_0010428 3300048903 Bacteria 5259
433 Ga0496100_0222626 3300048903 Bacteria 1385
434 Ga0496100_0379933 3300048903 Bacteria 1073
435 Ga0496101_0000046 3300048904 Bacteria 155997
436 Ga0496101_0000089 3300048904 Bacteria 98287
437 Ga0496101_0000941 3300048904 Bacteria 17189
438 Ga0496101_0030721 3300048904 Bacteria 3770
439 Ga0496101_0074392 3300048904 Bacteria 2498
440 Ga0496101_0145363 3300048904 Bacteria 1810
441 Ga0496101_0259760 3300048904 Bacteria 1354
442 Ga0496102_0000025 3300048905 Bacteria 227201
443 Ga0496102_0000060 3300048905 Bacteria 167774
444 Ga0496102_0000873 3300048905 Bacteria 28789
445 Ga0496102_0003346 3300048905 Bacteria 13589
446 Ga0496102_0010556 3300048905 Bacteria 7953
447 Ga0496102_0034449 3300048905 Bacteria 4554
448 Ga0496102_0167245 3300048905 Bacteria 2069
449 Ga0496103_0000022 3300048906 Bacteria 227208
450 Ga0496103_0000494 3300048906 Bacteria 32551
451 Ga0496103_0001263 3300048906 Bacteria 17262
452 Ga0496103_0001334 3300048906 Bacteria 16712
453 Ga0496103_0156400 3300048906 Bacteria 1461
454 Ga0496103_0166141 3300048906 Bacteria 1416
455 Ga0496103_0258352 3300048906 Bacteria 1121
456 Ga0496104_0033219 3300048907 Bacteria 4805
457 Ga0496104_0266328 3300048907 Bacteria 1626
458 Ga0496105_0025756 3300048908 Bacteria 4792
459 Ga0496105_0410400 3300048908 Bacteria 1074
460 Ga0496105_0645163 3300048908 Bacteria 817
461 Ga0496106_0001191 3300048909 Bacteria 19408
462 Ga0496106_0002689 3300048909 Bacteria 13201
463 Ga0496106_0008922 3300048909 Bacteria 7414
464 Ga0496106_0032954 3300048909 Bacteria 3863
465 Ga0496106_0111312 3300048909 Bacteria 2132
466 Ga0496107_0000580 3300048910 Bacteria 20406
467 Ga0496107_0004677 3300048910 Bacteria 9290
468 Ga0496107_0053168 3300048910 Bacteria 2922
469 Ga0496108_0000453 3300048911 Bacteria 32720
470 Ga0496108_0002763 3300048911 Bacteria 14052
471 Ga0496108_0061619 3300048911 Bacteria 3157
472 Ga0496108_0076130 3300048911 Bacteria 2836
473 Ga0496109_0000037 3300048912 Bacteria 151906
474 Ga0496109_0015309 3300048912 Bacteria 6680
475 Ga0496109_0019637 3300048912 Bacteria 5961
476 Ga0496109_0021341 3300048912 Bacteria 5726
477 Ga0496109_0217850 3300048912 Bacteria 1795
478 Ga0496109_0243204 3300048912 Bacteria 1694
479 Ga0496109_0581324 3300048912 Bacteria 1056
480 Ga0496110_0000823 3300048913 Bacteria 21775
481 Ga0496110_0097530 3300048913 Bacteria 2634
482 Ga0496110_0128739 3300048913 Bacteria 2285
483 Ga0496110_0230507 3300048913 Bacteria 1684
484 Ga0496111_0008588 3300048914 Bacteria 6770
485 Ga0496111_0264904 3300048914 Bacteria 1275
486 Ga0496112_0003504 3300048915 Bacteria 13009
487 Ga0496112_0017157 3300048915 Bacteria 6799
488 Ga0496112_0167614 3300048915 Bacteria 2162
489 Ga0496112_0202525 3300048915 Bacteria 1944
490 Ga0496113_0003388 3300048916 Bacteria 9534
491 Ga0496113_0009242 3300048916 Bacteria 6467
492 Ga0496113_0035764 3300048916 Bacteria 3634
493 Ga0496113_0079626 3300048916 Bacteria 2509
494 Ga0496113_0221680 3300048916 Bacteria 1507
495 Ga0496114_0000207 3300048917 Bacteria 42841
496 Ga0496114_0000360 3300048917 Bacteria 33359
497 Ga0496114_0003506 3300048917 Bacteria 12041
498 Ga0496115_0007831 3300048918 Bacteria 7877
499 Ga0496115_0009317 3300048918 Bacteria 7296
500 Ga0496115_0041143 3300048918 Bacteria 3676
501 Ga0496115_0401482 3300048918 Bacteria 1112
502 Ga0496116_0000059 3300048919 Bacteria 274491
503 Ga0496116_0016405 3300048919 Bacteria 5796
504 Ga0496116_0018445 3300048919 Bacteria 5379
505 Ga0496117_0000055 3300048920 Bacteria 274518
506 Ga0496117_0000595 3300048920 Bacteria 59503
507 Ga0496117_0080614 3300048920 Bacteria 2139
508 Ga0496118_0000058 3300048921 Bacteria 227245
509 Ga0496118_0000786 3300048921 Bacteria 50796
510 Ga0496118_0022748 3300048921 Bacteria 5465
511 Ga0496119_0000278 3300048922 Bacteria 71878
512 Ga0496119_0010357 3300048922 Bacteria 7852
513 Ga0496119_0010955 3300048922 Bacteria 7571
514 Ga0496119_0169691 3300048922 Bacteria 1153
515 Ga0496120_0000384 3300048923 Bacteria 71475
516 Ga0496120_0007979 3300048923 Bacteria 7794
517 Ga0496120_0027029 3300048923 Bacteria 3536
518 Ga0496121_0000068 3300048924 Bacteria 259210
519 Ga0496121_0000113 3300048924 Bacteria 181807
520 Ga0496121_0014051 3300048924 Bacteria 8545
521 Ga0496122_0000687 3300048925 Bacteria 67409
522 Ga0496122_0039559 3300048925 Bacteria 3759
523 Ga0496123_0010123 3300048926 Bacteria 8382
524 Ga0496124_0000065 3300048927 Bacteria 223594
525 Ga0496124_0149803 3300048927 Bacteria 1832
526 Ga0496124_0177292 3300048927 Bacteria 1644
527 Ga0496124_0273841 3300048927 Bacteria 1234
528 Ga0496125_0000008 3300048928 Bacteria 704677
529 Ga0496125_0058629 3300048928 Bacteria 3109
530 Ga0496125_0076529 3300048928 Bacteria 2583
531 Ga0496125_0253074 3300048928 Bacteria 1110
532 Ga0496126_0000062 3300048929 Bacteria 259210
533 Ga0496126_0002477 3300048929 Bacteria 24860
534 Ga0496126_0005460 3300048929 Bacteria 14506
535 Ga0496126_0035619 3300048929 Bacteria 4662
536 Ga0501032_0001215 3300049569 Bacteria 20609
537 Ga0501032_0072340 3300049569 Bacteria 2298
538 Ga0501033_0062513 3300049570 Bacteria 2742
539 Ga0501033_0073398 3300049570 Bacteria 2512
540 Ga0501034_0005626 3300049571 Bacteria 13648
541 Ga0501037_0000222 3300049573 Bacteria 49681
542 Ga0501038_0005120 3300049574 Bacteria 12175
543 Ga0501039_0006680 3300049575 Bacteria 8769
544 Ga0501043_0000225 3300049579 Bacteria 51378
545 Ga0501043_0191932 3300049579 Bacteria 1588
546 Ga0501043_0314654 3300049579 Bacteria 1194
547 Ga0501046_0164711 3300049580 Bacteria 1666
548 Ga0501047_0068328 3300049581 Bacteria 3422
549 Ga0501048_0092463 3300049582 Bacteria 2133
550 Ga0501067_0063962 3300049583 Bacteria 2037
551 Ga0501068_0062085 3300049584 Bacteria 2271
552 Ga0501070_0002172 3300049586 Bacteria 17248
553 Ga0501070_0028310 3300049586 Bacteria 4699
554 Ga0501070_0357468 3300049586 Bacteria 1185
555 Ga0501073_0067031 3300049589 Bacteria 2502
556 Ga0501077_0113876 3300049593 Bacteria 1715
557 Ga0501080_0722631 3300049742 Bacteria 877
558 Ga0501035_0000481 3300049822 Bacteria 44803
559 Ga0501044_0002856 3300049823 Bacteria 19659
560 Ga0501044_0020469 3300049823 Bacteria 7065
561 Ga0501044_0034660 3300049823 Bacteria 5292
562 nmdc:mga03683_77480_c1 3300050489 Bacteria 1430
563 nmdc:mga03n38_21120_c1 3300050490 Bacteria 2615
564 nmdc:mga03n38_29285_c1 3300050490 Bacteria 2303
565 nmdc:mga03n38_30320_c1 3300050490 Bacteria 2273
566 nmdc:mga03n38_32155_c1 3300050490 Bacteria 2220
567 nmdc:mga03n38_33302_c1 3300050490 Bacteria 2191
568 nmdc:mga03n38_39120_c1 3300050490 Bacteria 2055
569 nmdc:mga03n38_41360_c1 3300050490 Bacteria 2008
570 nmdc:mga03n38_76143_c1 3300050490 Bacteria 1565
571 nmdc:mga00v17_157562_c1 3300050491 Bacteria 1460
572 nmdc:mga00v17_202653_c1 3300050491 Bacteria 1283
573 nmdc:mga00v17_21358_c1 3300050491 Bacteria 3721
574 nmdc:mga00v17_315556_c1 3300050491 Bacteria 1016
575 nmdc:mga00v17_33592_c1 3300050491 Bacteria 3041
576 nmdc:mga00v17_359170_c1 3300050491 Bacteria 947
577 nmdc:mga00v17_369705_c1 3300050491 Bacteria 932
578 nmdc:mga00v17_43759_c1 3300050491 Bacteria 2698
579 nmdc:mga00v17_71431_c1 3300050491 Bacteria 2151
580 nmdc:mga0yw44_223390_c1 3300050492 Bacteria 1249
581 nmdc:mga0yw44_401621_c1 3300050492 Bacteria 927
582 nmdc:mga0yw44_43707_c1 3300050492 Bacteria 2676
583 nmdc:mga0yw44_49605_c1 3300050492 Bacteria 2534
584 nmdc:mga06z11_126914_c1 3300050494 Bacteria 1428
585 nmdc:mga06z11_190145_c1 3300050494 Bacteria 1188
586 nmdc:mga04h51_25363_c1 3300050495 Bacteria 1824
587 nmdc:mga07m45_13863_c1 3300050496 Bacteria 4283
588 nmdc:mga07m45_2227_c1 3300050496 Bacteria 9061
589 nmdc:mga07m45_9068_c1 3300050496 Bacteria 5140
590 nmdc:mga05p37_12562_c1 3300050507 Bacteria 10111
591 nmdc:mga0qj67_63808_c1 3300050509 Bacteria 2929
592 nmdc:mga06r32_95413_c1 3300050510 Bacteria 2911
593 nmdc:mga0n895_1051848_c1 3300050512 Bacteria 793
594 nmdc:mga0sz30_100449_c2 3300050516 Bacteria 947
595 nmdc:mga0sz30_16615_c1 3300050516 Bacteria 2925
596 nmdc:mga0sz30_187649_c1 3300050516 Bacteria 918
597 nmdc:mga0sz30_30998_c1 3300050516 Bacteria 2211
598 nmdc:mga0sz30_46633_c1 3300050516 Bacteria 1830
599 nmdc:mga0sz30_52021_c1 3300050516 Bacteria 1739
600 nmdc:mga0sz30_7873_c1 3300050516 Bacteria 1875
601 nmdc:mga0sz30_81096_c1 3300050516 Bacteria 1404
602 Ga0495655_0004396 3300053083 Bacteria 2405
603 Ga0500643_004017 3300053087 Bacteria 6796
604 Ga0500644_0092490 3300053088 Bacteria 1135
605 Ga0500646_0111177 3300053090 Bacteria 871
606 Ga0500641_0109115 3300053096 Bacteria 1191
607 Ga0500553_068869 3300053101 Bacteria 1633
608 Ga0500556_0006262 3300053104 Bacteria 3372
609 Ga0500556_0066645 3300053104 Bacteria 1337
610 Ga0500560_024754 3300053107 Bacteria 1756
611 Ga0500614_013552 3300053123 Bacteria 1793
612 Ga0500642_0157859 3300053130 Bacteria 1064
613 Ga0500652_009736 3300053131 Bacteria 3264
614 Ga0500652_093424 3300053131 Bacteria 1256
615 Ga0500559_0100350 3300053136 Bacteria 1333
616 Ga0500568_0107999 3300053139 Bacteria 1041
617 Ga0500588_0064468 3300053146 Bacteria 1184
618 Ga0500588_0136913 3300053146 Bacteria 877
619 Ga0500603_034815 3300053150 Bacteria 1318
620 Ga0500616_0002400 3300053153 Bacteria 15631
621 Ga0500616_0057948 3300053153 Bacteria 2017
622 Ga0500645_001463 3300053730 Bacteria 11884
623 Ga0500645_014073 3300053730 Bacteria 2556
624 Ga0466962_0085888 3300061719 Bacteria 1506
625 Ga0466962_0157904 3300061719 Bacteria 1102

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044658 Ga0466972_0214054 Ga0466972_0214054_257_880 195
2 3300048091 Ga0495626_0145094 Ga0495626_0145094_355_975 206
3 3300035242 Ga0373962_0193217 Ga0373962_0193217_28_651 207
4 3300050490 nmdc:mga03n38_32155_c1 nmdc:mga03n38_32155_c1_1565_2188 207
5 3300050491 nmdc:mga00v17_21358_c1 nmdc:mga00v17_21358_c1_3081_3704 207
6 3300050512 nmdc:mga0n895_1051848_c1 nmdc:mga0n895_1051848_c1_138_761 207
7 3300035088 Ga0373940_0110420 Ga0373940_0110420_47_679 210
8 3300048905 Ga0496102_0167245 Ga0496102_0167245_47_679 210
9 3300048906 Ga0496103_0156400 Ga0496103_0156400_50_682 210
10 3300046683 Ga0495658_0041410 Ga0495658_0041410_128_862 213
11 3300053101 Ga0500553_068869 Ga0500553_068869_622_1362 213
12 3300053123 Ga0500614_013552 Ga0500614_013552_113_859 213
13 3300053150 Ga0500603_034815 Ga0500603_034815_369_1115 213
14 3300053107 Ga0500560_024754 Ga0500560_024754_373_1107 215
15 3300035725 Ga0373947_0000002 Ga0373947_0000002_316467_317606 220
16 3300035083 Ga0373926_0000954 Ga0373926_0000954_970_2046 221
17 3300048927 Ga0496124_0177292 Ga0496124_0177292_960_1631 221
18 3300035692 Ga0373935_0013456 Ga0373935_0013456_3324_4400 223
19 3300003320 rootH2_10083697 rootH2_100836975 226
20 3300003323 rootH1_10101351 rootH1_101013512 226
21 3300021384 Ga0213876_10003702 Ga0213876_100037025 226
22 3300039437 Ga0436365_1472485 Ga0436365_1472485_14537_15298 226
23 3300044684 Ga0466966_0039461 Ga0466966_0039461_873_1640 226
24 3300045049 Ga0466959_0153334 Ga0466959_0153334_674_1441 226
25 iso_pu_bacteria 2738541264 2738668045 227
26 iso_pu_bacteria 2738541356 2739147115 227
27 3300047315 Ga0495581_0009648 Ga0495581_0009648_3331_4089 228
28 3300050491 nmdc:mga00v17_369705_c1 nmdc:mga00v17_369705_c1_29_730 229
29 3300050516 nmdc:mga0sz30_100449_c2 nmdc:mga0sz30_100449_c2_218_919 229
30 iso_pu_bacteria 2643221715 2644635273 229
31 iso_pu_bacteria 2902810491 2902812850 229
32 3300003792 Ga0055540_1000134 Ga0055540_100013452 231
33 3300005335 Ga0070666_10133633 Ga0070666_101336332 231
34 3300005367 Ga0070667_100000249 Ga0070667_10000024928 231
35 3300005445 Ga0070708_100189708 Ga0070708_1001897081 231
36 3300009148 Ga0105243_10422833 Ga0105243_104228332 231
37 3300009545 Ga0105237_10140080 Ga0105237_101400802 231
38 3300010375 Ga0105239_10015485 Ga0105239_1001548510 231
39 3300025303 Ga0209051_1000076 Ga0209051_100007652 231
40 3300025903 Ga0207680_10091542 Ga0207680_100915423 231
41 3300025914 Ga0207671_10026196 Ga0207671_100261965 231
42 3300025986 Ga0207658_10003482 Ga0207658_1000348211 231
43 3300031251 Ga0265327_10022776 Ga0265327_100227763 231
44 3300044658 Ga0466972_0006094 Ga0466972_0006094_2412_3113 231
45 3300044683 Ga0466965_0001293 Ga0466965_0001293_5778_6479 231
46 3300044683 Ga0466965_0089381 Ga0466965_0089381_181_882 231
47 3300044706 Ga0466964_0165316 Ga0466964_0165316_182_883 231
48 3300044735 Ga0466968_0001059 Ga0466968_0001059_4979_5680 231
49 3300044765 Ga0466970_0064479 Ga0466970_0064479_357_1058 231
50 3300044842 Ga0466957_0016543 Ga0466957_0016543_2839_3540 231
51 3300044901 Ga0466960_0000250 Ga0466960_0000250_15187_15888 231
52 3300045049 Ga0466959_0010871 Ga0466959_0010871_2513_3214 231
53 3300045976 Ga0466967_0025879 Ga0466967_0025879_2666_3367 231
54 3300045976 Ga0466967_0092389 Ga0466967_0092389_183_884 231
55 3300048903 Ga0496100_0000023 Ga0496100_0000023_57338_58039 231
56 3300048903 Ga0496100_0010428 Ga0496100_0010428_556_1257 231
57 3300048904 Ga0496101_0000089 Ga0496101_0000089_90205_90906 231
58 3300048904 Ga0496101_0259760 Ga0496101_0259760_602_1303 231
59 3300048905 Ga0496102_0010556 Ga0496102_0010556_4241_4942 231
60 3300048906 Ga0496103_0001263 Ga0496103_0001263_15003_15704 231
61 3300048908 Ga0496105_0645163 Ga0496105_0645163_28_729 231
62 3300048909 Ga0496106_0008922 Ga0496106_0008922_5586_6287 231
63 3300048910 Ga0496107_0004677 Ga0496107_0004677_3228_3929 231
64 3300048911 Ga0496108_0002763 Ga0496108_0002763_3840_4541 231
65 3300048912 Ga0496109_0000037 Ga0496109_0000037_61002_61703 231
66 3300048913 Ga0496110_0000823 Ga0496110_0000823_6541_7242 231
67 3300048914 Ga0496111_0008588 Ga0496111_0008588_4227_4928 231
68 3300048915 Ga0496112_0017157 Ga0496112_0017157_71_772 231
69 3300048915 Ga0496112_0202525 Ga0496112_0202525_667_1362 231
70 3300048916 Ga0496113_0035764 Ga0496113_0035764_758_1459 231
71 3300048916 Ga0496113_0221680 Ga0496113_0221680_765_1466 231
72 3300048917 Ga0496114_0000207 Ga0496114_0000207_1317_2018 231
73 3300048918 Ga0496115_0041143 Ga0496115_0041143_1335_2036 231
74 3300048919 Ga0496116_0018445 Ga0496116_0018445_3106_3807 231
75 3300048920 Ga0496117_0080614 Ga0496117_0080614_421_1122 231
76 3300048921 Ga0496118_0022748 Ga0496118_0022748_421_1122 231
77 3300048922 Ga0496119_0010357 Ga0496119_0010357_5593_6294 231
78 3300048923 Ga0496120_0027029 Ga0496120_0027029_926_1627 231
79 3300048924 Ga0496121_0000068 Ga0496121_0000068_90204_90905 231
80 3300048925 Ga0496122_0000687 Ga0496122_0000687_15539_16240 231
81 3300048925 Ga0496122_0039559 Ga0496122_0039559_410_1111 231
82 3300048926 Ga0496123_0010123 Ga0496123_0010123_3706_4407 231
83 3300048927 Ga0496124_0000065 Ga0496124_0000065_132690_133391 231
84 3300048928 Ga0496125_0000008 Ga0496125_0000008_613773_614474 231
85 3300048929 Ga0496126_0000062 Ga0496126_0000062_90204_90905 231
86 3300048929 Ga0496126_0005460 Ga0496126_0005460_5558_6259 231
87 3300050491 nmdc:mga00v17_202653_c1 nmdc:mga00v17_202653_c1_14_709 231
88 3300005441 Ga0070700_100350648 Ga0070700_1003506482 232
89 3300006048 Ga0075363_100018402 Ga0075363_1000184023 232
90 3300009098 Ga0105245_10056831 Ga0105245_100568313 232
91 3300009553 Ga0105249_10352031 Ga0105249_103520312 232
92 3300010375 Ga0105239_11229807 Ga0105239_112298071 232
93 3300013308 Ga0157375_10590150 Ga0157375_105901502 232
94 3300025937 Ga0207669_10322057 Ga0207669_103220572 232
95 3300026067 Ga0207678_10057966 Ga0207678_100579664 232
96 3300026075 Ga0207708_10316656 Ga0207708_103166562 232
97 3300035725 Ga0373947_0273523 Ga0373947_0273523_276_974 232
98 3300046459 Ga0495629_0021149 Ga0495629_0021149_1991_2689 232
99 3300046461 Ga0495641_0062335 Ga0495641_0062335_936_1634 232
100 3300046472 Ga0495580_0235945 Ga0495580_0235945_532_1230 232
101 3300046473 Ga0495582_0023073 Ga0495582_0023073_2091_2789 232
102 3300046526 Ga0495666_0160849 Ga0495666_0160849_12_710 232
103 3300046533 Ga0495640_0201960 Ga0495640_0201960_239_937 232
104 3300046689 Ga0495613_0450727 Ga0495613_0450727_21_719 232
105 3300047319 Ga0495674_0141610 Ga0495674_0141610_1169_1867 232
106 3300047321 Ga0495676_0057255 Ga0495676_0057255_1009_1707 232
107 3300048905 Ga0496102_0034449 Ga0496102_0034449_3182_3889 232
108 3300048911 Ga0496108_0076130 Ga0496108_0076130_1181_1879 232
109 3300048912 Ga0496109_0015309 Ga0496109_0015309_4842_5540 232
110 3300048912 Ga0496109_0243204 Ga0496109_0243204_459_1157 232
111 3300048913 Ga0496110_0128739 Ga0496110_0128739_997_1695 232
112 3300048916 Ga0496113_0009242 Ga0496113_0009242_256_954 232
113 3300050490 nmdc:mga03n38_29285_c1 nmdc:mga03n38_29285_c1_927_1625 232
114 3300053083 Ga0495655_0004396 Ga0495655_0004396_1682_2380 232
115 3300005329 Ga0070683_100433906 Ga0070683_1004339061 233
116 3300005547 Ga0070693_100423955 Ga0070693_1004239551 233
117 3300014745 Ga0157377_10449361 Ga0157377_104493611 233
118 3300025909 Ga0207705_10458973 Ga0207705_104589731 233
119 3300026067 Ga0207678_10234877 Ga0207678_102348772 233
120 3300031901 Ga0307406_10114405 Ga0307406_101144052 233
121 3300041410 Ga0439461_0004455 Ga0439461_0004455_1250_1966 233
122 3300041411 Ga0439466_0024420 Ga0439466_0024420_538_1254 233
123 3300041997 Ga0439431_0000791 Ga0439431_0000791_5679_6395 233
124 3300042002 Ga0439442_031856 Ga0439442_031856_183_899 233
125 3300042004 Ga0439445_0001479 Ga0439445_0001479_3594_4310 233
126 3300042435 Ga0439434_0014255 Ga0439434_0014255_526_1242 233
127 3300050491 nmdc:mga00v17_71431_c1 nmdc:mga00v17_71431_c1_1028_1744 233
128 iso_pu_bacteria 2738541274 2738703922 234
129 iso_pu_bacteria 2738543028 2739330796 234
130 iso_pu_bacteria 2902799365 2902803978 234
131 3300006038 Ga0075365_10454083 Ga0075365_104540831 235
132 3300006051 Ga0075364_10406719 Ga0075364_104067192 235
133 3300006186 Ga0075369_10051736 Ga0075369_100517363 235
134 3300041411 Ga0439466_0048526 Ga0439466_0048526_108_818 235
135 3300041413 Ga0439465_0001917 Ga0439465_0001917_1024_1734 235
136 3300050491 nmdc:mga00v17_359170_c1 nmdc:mga00v17_359170_c1_106_813 235
137 3300050492 nmdc:mga0yw44_401621_c1 nmdc:mga0yw44_401621_c1_136_843 235
138 3300050516 nmdc:mga0sz30_46633_c1 nmdc:mga0sz30_46633_c1_791_1501 235
139 iso_pu_bacteria 2643221687 2644488838 235
140 iso_pu_bacteria 2842134933 2842137497 235
141 iso_pu_bacteria 2902837492 2902838712 235
142 3300005616 Ga0068852_100168834 Ga0068852_1001688342 236
143 3300009545 Ga0105237_10000175 Ga0105237_1000017574 236
144 3300010375 Ga0105239_10058072 Ga0105239_100580722 236
145 3300025914 Ga0207671_10008374 Ga0207671_100083748 236
146 3300026142 Ga0207698_10241430 Ga0207698_102414301 236
147 3300039437 Ga0436365_0768449 Ga0436365_0768449_298_1014 236
148 3300048903 Ga0496100_0001647 Ga0496100_0001647_3610_4344 236
149 3300048904 Ga0496101_0000046 Ga0496101_0000046_15705_16439 236
150 3300048905 Ga0496102_0000025 Ga0496102_0000025_62418_63152 236
151 3300048906 Ga0496103_0000022 Ga0496103_0000022_62418_63152 236
152 3300048909 Ga0496106_0032954 Ga0496106_0032954_2980_3714 236
153 3300048919 Ga0496116_0000059 Ga0496116_0000059_211340_212074 236
154 3300048920 Ga0496117_0000055 Ga0496117_0000055_62418_63152 236
155 3300048921 Ga0496118_0000058 Ga0496118_0000058_62418_63152 236
156 3300048922 Ga0496119_0000278 Ga0496119_0000278_55333_56067 236
157 3300048923 Ga0496120_0000384 Ga0496120_0000384_15409_16143 236
158 3300048924 Ga0496121_0000113 Ga0496121_0000113_165363_166097 236
159 3300048929 Ga0496126_0002477 Ga0496126_0002477_21324_22058 236
160 iso_pu_bacteria 2929212328 2929216285 236
161 3300006051 Ga0075364_10005383 Ga0075364_100053834 237
162 3300006186 Ga0075369_10252892 Ga0075369_102528921 237
163 3300006353 Ga0075370_10015322 Ga0075370_100153221 237
164 3300048912 Ga0496109_0581324 Ga0496109_0581324_145_861 237
165 3300048922 Ga0496119_0169691 Ga0496119_0169691_333_1097 237
166 3300050490 nmdc:mga03n38_30320_c1 nmdc:mga03n38_30320_c1_330_1067 237
167 3300050491 nmdc:mga00v17_43759_c1 nmdc:mga00v17_43759_c1_1632_2369 237
168 3300050516 nmdc:mga0sz30_30998_c1 nmdc:mga0sz30_30998_c1_1424_2161 237
169 iso_pu_bacteria 2902792274 2902797052 237
170 iso_pu_bacteria 2939582691 2939588372 237
171 3300005353 Ga0070669_100009947 Ga0070669_1000099476 238
172 3300005367 Ga0070667_100000191 Ga0070667_10000019116 238
173 3300005548 Ga0070665_100003487 Ga0070665_10000348710 238
174 3300005841 Ga0068863_100012939 Ga0068863_1000129396 238
175 3300005842 Ga0068858_100006097 Ga0068858_10000609711 238
176 3300005843 Ga0068860_100000166 Ga0068860_1000001665 238
177 3300005844 Ga0068862_100000003 Ga0068862_10000000321 238
178 3300006038 Ga0075365_10255448 Ga0075365_102554482 238
179 3300006186 Ga0075369_10026915 Ga0075369_100269152 238
180 3300009101 Ga0105247_10000006 Ga0105247_10000006305 238
181 3300009177 Ga0105248_10000042 Ga0105248_1000004265 238
182 3300009553 Ga0105249_10000008 Ga0105249_10000008112 238
183 3300013306 Ga0163162_10454178 Ga0163162_104541781 238
184 3300014325 Ga0163163_10134954 Ga0163163_101349542 238
185 3300014968 Ga0157379_10048384 Ga0157379_100483843 238
186 3300025900 Ga0207710_10000114 Ga0207710_1000011482 238
187 3300025923 Ga0207681_10007054 Ga0207681_100070546 238
188 3300025941 Ga0207711_10004319 Ga0207711_1000431912 238
189 3300025961 Ga0207712_10000011 Ga0207712_10000011208 238
190 3300025986 Ga0207658_10000071 Ga0207658_1000007136 238
191 3300026035 Ga0207703_10013161 Ga0207703_100131616 238
192 3300026088 Ga0207641_10001975 Ga0207641_1000197514 238
193 3300028379 Ga0268266_10040687 Ga0268266_100406873 238
194 3300028380 Ga0268265_10000010 Ga0268265_1000001022 238
195 3300028381 Ga0268264_10000007 Ga0268264_10000007556 238
196 3300036712 Ga0316584_0026131 Ga0316584_0026131_893_1627 238
197 3300042008 Ga0439450_047649 Ga0439450_047649_95_817 238
198 3300046460 Ga0495638_0120841 Ga0495638_0120841_392_1123 238
199 3300048903 Ga0496100_0004279 Ga0496100_0004279_5057_5776 238
200 3300048904 Ga0496101_0030721 Ga0496101_0030721_2777_3496 238
201 3300048905 Ga0496102_0000060 Ga0496102_0000060_162990_163709 238
202 3300048906 Ga0496103_0001334 Ga0496103_0001334_229_948 238
203 3300048910 Ga0496107_0053168 Ga0496107_0053168_391_1110 238
204 3300048918 Ga0496115_0401482 Ga0496115_0401482_186_917 238
205 3300048919 Ga0496116_0016405 Ga0496116_0016405_4949_5668 238
206 3300048920 Ga0496117_0000595 Ga0496117_0000595_53651_54370 238
207 3300048921 Ga0496118_0000786 Ga0496118_0000786_12150_12869 238
208 3300048922 Ga0496119_0010955 Ga0496119_0010955_3795_4514 238
209 3300048923 Ga0496120_0007979 Ga0496120_0007979_6727_7446 238
210 3300048924 Ga0496121_0014051 Ga0496121_0014051_6589_7308 238
211 3300048927 Ga0496124_0273841 Ga0496124_0273841_178_897 238
212 3300048928 Ga0496125_0058629 Ga0496125_0058629_1380_2111 238
213 3300048928 Ga0496125_0076529 Ga0496125_0076529_546_1265 238
214 3300048929 Ga0496126_0035619 Ga0496126_0035619_3026_3745 238
215 3300050492 nmdc:mga0yw44_223390_c1 nmdc:mga0yw44_223390_c1_239_970 238
216 3300050492 nmdc:mga0yw44_43707_c1 nmdc:mga0yw44_43707_c1_25_768 238
217 3300050516 nmdc:mga0sz30_7873_c1 nmdc:mga0sz30_7873_c1_731_1474 238
218 3300053090 Ga0500646_0111177 Ga0500646_0111177_90_809 238
219 3300053096 Ga0500641_0109115 Ga0500641_0109115_161_892 238
220 3300053130 Ga0500642_0157859 Ga0500642_0157859_43_774 238
221 3300053131 Ga0500652_093424 Ga0500652_093424_144_875 238
222 3300053136 Ga0500559_0100350 Ga0500559_0100350_559_1290 238
223 3300053139 Ga0500568_0107999 Ga0500568_0107999_109_840 238
224 3300053146 Ga0500588_0136913 Ga0500588_0136913_104_835 238
225 3300053730 Ga0500645_001463 Ga0500645_001463_2303_3034 238
226 3300053730 Ga0500645_014073 Ga0500645_014073_85_816 238
227 3300003792 Ga0055540_1002706 Ga0055540_10027069 239
228 3300003792 Ga0055540_1003818 Ga0055540_10038184 239
229 3300003792 Ga0055540_1007916 Ga0055540_10079164 239
230 3300005347 Ga0070668_100006643 Ga0070668_1000066436 239
231 3300005455 Ga0070663_100196850 Ga0070663_1001968503 239
232 3300006177 Ga0075362_10044195 Ga0075362_100441952 239
233 3300009092 Ga0105250_10209034 Ga0105250_102090341 239
234 3300025273 Ga0209673_1002617 Ga0209673_10026178 239
235 3300025303 Ga0209051_1003302 Ga0209051_10033027 239
236 3300025303 Ga0209051_1004832 Ga0209051_10048326 239
237 3300025303 Ga0209051_1008643 Ga0209051_10086434 239
238 3300025935 Ga0207709_10298266 Ga0207709_102982662 239
239 3300025972 Ga0207668_10006197 Ga0207668_100061976 239
240 3300026067 Ga0207678_10130336 Ga0207678_101303363 239
241 3300026067 Ga0207678_10220019 Ga0207678_102200193 239
242 3300026075 Ga0207708_10505728 Ga0207708_105057281 239
243 3300041443 Ga0451789_0481125 Ga0451789_0481125_76_813 239
244 3300041451 Ga0451791_0336379 Ga0451791_0336379_505_1242 239
245 3300041456 Ga0451795_1118406 Ga0451795_1118406_1516_2253 239
246 3300046460 Ga0495638_0004056 Ga0495638_0004056_8393_9112 239
247 3300046507 Ga0495606_0007438 Ga0495606_0007438_5276_6004 239
248 3300046524 Ga0495648_0001449 Ga0495648_0001449_15747_16475 239
249 3300046648 Ga0495611_0009134 Ga0495611_0009134_1598_2326 239
250 3300047320 Ga0495672_0003532 Ga0495672_0003532_9797_10525 239
251 3300047469 Ga0495673_0000367 Ga0495673_0000367_25209_25937 239
252 3300047472 Ga0495686_0143076 Ga0495686_0143076_536_1264 239
253 3300048903 Ga0496100_0222626 Ga0496100_0222626_79_807 239
254 3300048904 Ga0496101_0074392 Ga0496101_0074392_471_1199 239
255 3300048907 Ga0496104_0266328 Ga0496104_0266328_770_1498 239
256 3300048908 Ga0496105_0410400 Ga0496105_0410400_190_918 239
257 3300048909 Ga0496106_0111312 Ga0496106_0111312_322_1050 239
258 3300048927 Ga0496124_0149803 Ga0496124_0149803_912_1649 239
259 3300049570 Ga0501033_0062513 Ga0501033_0062513_1263_1988 239
260 3300049586 Ga0501070_0357468 Ga0501070_0357468_127_852 239
261 3300050489 nmdc:mga03683_77480_c1 nmdc:mga03683_77480_c1_10_747 239
262 3300050516 nmdc:mga0sz30_81096_c1 nmdc:mga0sz30_81096_c1_241_978 239
263 3300053087 Ga0500643_004017 Ga0500643_004017_2214_2942 239
264 3300053104 Ga0500556_0006262 Ga0500556_0006262_129_848 239
265 3300053104 Ga0500556_0066645 Ga0500556_0066645_292_1011 239
266 3300053131 Ga0500652_009736 Ga0500652_009736_1310_2035 239
267 3300053146 Ga0500588_0064468 Ga0500588_0064468_383_1102 239
268 3300053153 Ga0500616_0002400 Ga0500616_0002400_1977_2705 239
269 3300005456 Ga0070678_100058911 Ga0070678_1000589113 240
270 3300005548 Ga0070665_100380893 Ga0070665_1003808932 240
271 3300005841 Ga0068863_100082108 Ga0068863_1000821082 240
272 3300005842 Ga0068858_100334928 Ga0068858_1003349282 240
273 3300006051 Ga0075364_10291537 Ga0075364_102915372 240
274 3300009101 Ga0105247_10118664 Ga0105247_101186642 240
275 3300009176 Ga0105242_10075637 Ga0105242_100756372 240
276 3300009177 Ga0105248_10021747 Ga0105248_100217473 240
277 3300013308 Ga0157375_10027547 Ga0157375_100275472 240
278 3300025898 Ga0207692_10235668 Ga0207692_102356682 240
279 3300025934 Ga0207686_10042042 Ga0207686_100420423 240
280 3300025941 Ga0207711_10080007 Ga0207711_100800073 240
281 3300026088 Ga0207641_10329810 Ga0207641_103298102 240
282 3300028379 Ga0268266_10335613 Ga0268266_103356132 240
283 3300028379 Ga0268266_10564552 Ga0268266_105645521 240
284 3300037466 Ga0395898_0186321 Ga0395898_0186321_743_1501 240
285 3300038443 Ga0395901_0041482 Ga0395901_0041482_2314_3072 240
286 3300039450 Ga0436363_1552280 Ga0436363_1552280_90_812 240
287 3300044684 Ga0466966_0007481 Ga0466966_0007481_3192_3929 240
288 3300044684 Ga0466966_0031021 Ga0466966_0031021_550_1278 240
289 3300044693 Ga0466961_0095027 Ga0466961_0095027_21_758 240
290 3300044694 Ga0466963_0031951 Ga0466963_0031951_465_1202 240
291 3300044735 Ga0466968_0005573 Ga0466968_0005573_234_971 240
292 3300044765 Ga0466970_0009717 Ga0466970_0009717_3263_4000 240
293 3300045049 Ga0466959_0086965 Ga0466959_0086965_206_943 240
294 3300045836 Ga0466958_0066351 Ga0466958_0066351_985_1722 240
295 3300046660 Ga0495625_0211300 Ga0495625_0211300_65_787 240
296 3300048903 Ga0496100_0000321 Ga0496100_0000321_21727_22452 240
297 3300048904 Ga0496101_0000941 Ga0496101_0000941_6588_7313 240
298 3300048908 Ga0496105_0025756 Ga0496105_0025756_1812_2537 240
299 3300048909 Ga0496106_0001191 Ga0496106_0001191_3330_4055 240
300 3300048912 Ga0496109_0021341 Ga0496109_0021341_1905_2630 240
301 3300048917 Ga0496114_0003506 Ga0496114_0003506_3228_3953 240
302 3300048918 Ga0496115_0009317 Ga0496115_0009317_4139_4864 240
303 3300049569 Ga0501032_0072340 Ga0501032_0072340_843_1589 240
304 3300049570 Ga0501033_0073398 Ga0501033_0073398_1657_2403 240
305 3300049579 Ga0501043_0314654 Ga0501043_0314654_253_999 240
306 3300049580 Ga0501046_0164711 Ga0501046_0164711_238_984 240
307 3300049581 Ga0501047_0068328 Ga0501047_0068328_1998_2744 240
308 3300049582 Ga0501048_0092463 Ga0501048_0092463_1301_2047 240
309 3300049822 Ga0501035_0000481 Ga0501035_0000481_39263_40009 240
310 3300049823 Ga0501044_0002856 Ga0501044_0002856_16915_17661 240
311 3300050491 nmdc:mga00v17_157562_c1 nmdc:mga00v17_157562_c1_313_1041 240
312 3300050492 nmdc:mga0yw44_49605_c1 nmdc:mga0yw44_49605_c1_795_1520 240
313 3300053088 Ga0500644_0092490 Ga0500644_0092490_357_1079 240
314 3300053153 Ga0500616_0057948 Ga0500616_0057948_1251_1973 240
315 3300061719 Ga0466962_0085888 Ga0466962_0085888_462_1199 240
316 3300002077 JGI24744J21845_10002625 JGI24744J21845_100026254 241
317 3300002244 JGI24742J22300_10013785 JGI24742J22300_100137852 241
318 3300005328 Ga0070676_10062815 Ga0070676_100628153 241
319 3300005330 Ga0070690_100068918 Ga0070690_1000689183 241
320 3300005331 Ga0070670_100114719 Ga0070670_1001147192 241
321 3300005334 Ga0068869_100616676 Ga0068869_1006166761 241
322 3300005337 Ga0070682_100021096 Ga0070682_1000210962 241
323 3300005339 Ga0070660_100076903 Ga0070660_1000769032 241
324 3300005340 Ga0070689_100014639 Ga0070689_1000146393 241
325 3300005347 Ga0070668_100004804 Ga0070668_1000048042 241
326 3300005347 Ga0070668_100005168 Ga0070668_10000516811 241
327 3300005353 Ga0070669_100376690 Ga0070669_1003766901 241
328 3300005355 Ga0070671_100004858 Ga0070671_1000048589 241
329 3300005356 Ga0070674_100000581 Ga0070674_10000058116 241
330 3300005365 Ga0070688_100015237 Ga0070688_1000152374 241
331 3300005367 Ga0070667_100014001 Ga0070667_1000140017 241
332 3300005367 Ga0070667_100022877 Ga0070667_1000228776 241
333 3300005367 Ga0070667_100167488 Ga0070667_1001674882 241
334 3300005434 Ga0070709_10112689 Ga0070709_101126892 241
335 3300005437 Ga0070710_10005428 Ga0070710_100054282 241
336 3300005438 Ga0070701_10050054 Ga0070701_100500542 241
337 3300005439 Ga0070711_100001467 Ga0070711_10000146713 241
338 3300005440 Ga0070705_100004751 Ga0070705_1000047518 241
339 3300005441 Ga0070700_100005401 Ga0070700_1000054012 241
340 3300005444 Ga0070694_100011967 Ga0070694_1000119671 241
341 3300005455 Ga0070663_100035642 Ga0070663_1000356423 241
342 3300005456 Ga0070678_100008146 Ga0070678_1000081467 241
343 3300005457 Ga0070662_100013537 Ga0070662_1000135376 241
344 3300005459 Ga0068867_100024024 Ga0068867_1000240245 241
345 3300005539 Ga0068853_100028693 Ga0068853_1000286932 241
346 3300005539 Ga0068853_100087656 Ga0068853_1000876563 241
347 3300005545 Ga0070695_100007477 Ga0070695_1000074772 241
348 3300005546 Ga0070696_100004718 Ga0070696_1000047189 241
349 3300005547 Ga0070693_100105057 Ga0070693_1001050571 241
350 3300005548 Ga0070665_100070529 Ga0070665_1000705295 241
351 3300005549 Ga0070704_100000677 Ga0070704_1000006772 241
352 3300005563 Ga0068855_100040762 Ga0068855_1000407626 241
353 3300005578 Ga0068854_100014805 Ga0068854_1000148056 241
354 3300005614 Ga0068856_100240195 Ga0068856_1002401953 241
355 3300005615 Ga0070702_100103424 Ga0070702_1001034243 241
356 3300005616 Ga0068852_100033994 Ga0068852_1000339943 241
357 3300005617 Ga0068859_100001601 Ga0068859_1000016016 241
358 3300005617 Ga0068859_100952406 Ga0068859_1009524061 241
359 3300005718 Ga0068866_10000520 Ga0068866_1000052011 241
360 3300005719 Ga0068861_100003598 Ga0068861_1000035982 241
361 3300005719 Ga0068861_100755752 Ga0068861_1007557521 241
362 3300005841 Ga0068863_100010519 Ga0068863_1000105199 241
363 3300005842 Ga0068858_100014971 Ga0068858_1000149717 241
364 3300005843 Ga0068860_100006908 Ga0068860_1000069081 241
365 3300005844 Ga0068862_100088655 Ga0068862_1000886552 241
366 3300005844 Ga0068862_100445674 Ga0068862_1004456741 241
367 3300005937 Ga0081455_10067557 Ga0081455_100675572 241
368 3300005981 Ga0081538_10101894 Ga0081538_101018942 241
369 3300006048 Ga0075363_100000454 Ga0075363_1000004542 241
370 3300006048 Ga0075363_100001144 Ga0075363_1000011445 241
371 3300006048 Ga0075363_100005022 Ga0075363_1000050227 241
372 3300006048 Ga0075363_100036166 Ga0075363_1000361663 241
373 3300006048 Ga0075363_100039226 Ga0075363_1000392263 241
374 3300006048 Ga0075363_100078622 Ga0075363_1000786222 241
375 3300006048 Ga0075363_100249329 Ga0075363_1002493292 241
376 3300006051 Ga0075364_10002046 Ga0075364_100020465 241
377 3300006051 Ga0075364_10019149 Ga0075364_100191491 241
378 3300006051 Ga0075364_10032430 Ga0075364_100324303 241
379 3300006163 Ga0070715_10021834 Ga0070715_100218343 241
380 3300006173 Ga0070716_100010114 Ga0070716_1000101146 241
381 3300006175 Ga0070712_100001110 Ga0070712_10000111016 241
382 3300006177 Ga0075362_10114645 Ga0075362_101146452 241
383 3300006178 Ga0075367_10008558 Ga0075367_100085585 241
384 3300006178 Ga0075367_10225349 Ga0075367_102253492 241
385 3300006186 Ga0075369_10000607 Ga0075369_100006077 241
386 3300006186 Ga0075369_10011042 Ga0075369_100110422 241
387 3300006186 Ga0075369_10025324 Ga0075369_100253242 241
388 3300006186 Ga0075369_10154357 Ga0075369_101543572 241
389 3300006195 Ga0075366_10062099 Ga0075366_100620993 241
390 3300006237 Ga0097621_100112401 Ga0097621_1001124012 241
391 3300006353 Ga0075370_10014652 Ga0075370_100146525 241
392 3300006353 Ga0075370_10104268 Ga0075370_101042682 241
393 3300006844 Ga0075428_100001482 Ga0075428_10000148220 241
394 3300006846 Ga0075430_100086951 Ga0075430_1000869513 241
395 3300006847 Ga0075431_100099832 Ga0075431_1000998324 241
396 3300006881 Ga0068865_100004263 Ga0068865_1000042639 241
397 3300006931 Ga0097620_100001601 Ga0097620_10000160119 241
398 3300006931 Ga0097620_100952382 Ga0097620_1009523821 241
399 3300009098 Ga0105245_10000546 Ga0105245_1000054616 241
400 3300009101 Ga0105247_10000268 Ga0105247_1000026816 241
401 3300009147 Ga0114129_10006853 Ga0114129_1000685312 241
402 3300009148 Ga0105243_10001875 Ga0105243_1000187515 241
403 3300009174 Ga0105241_10038459 Ga0105241_100384593 241
404 3300009176 Ga0105242_10001078 Ga0105242_100010789 241
405 3300009177 Ga0105248_10005867 Ga0105248_100058679 241
406 3300009545 Ga0105237_10008949 Ga0105237_100089496 241
407 3300009553 Ga0105249_10001494 Ga0105249_100014947 241
408 3300009553 Ga0105249_10037507 Ga0105249_100375076 241
409 3300010375 Ga0105239_10057646 Ga0105239_100576465 241
410 3300011119 Ga0105246_10773996 Ga0105246_107739961 241
411 3300013297 Ga0157378_10000438 Ga0157378_1000043813 241
412 3300013306 Ga0163162_10008681 Ga0163162_100086818 241
413 3300013306 Ga0163162_10081003 Ga0163162_100810035 241
414 3300013308 Ga0157375_10002558 Ga0157375_100025582 241
415 3300014325 Ga0163163_10045891 Ga0163163_100458913 241
416 3300014326 Ga0157380_10001136 Ga0157380_100011368 241
417 3300017792 Ga0163161_10001864 Ga0163161_1000186415 241
418 3300017792 Ga0163161_10454452 Ga0163161_104544522 241
419 3300025885 Ga0207653_10062752 Ga0207653_100627522 241
420 3300025898 Ga0207692_10001998 Ga0207692_100019987 241
421 3300025899 Ga0207642_10000093 Ga0207642_100000936 241
422 3300025900 Ga0207710_10004621 Ga0207710_100046216 241
423 3300025901 Ga0207688_10001107 Ga0207688_100011075 241
424 3300025904 Ga0207647_10200202 Ga0207647_102002022 241
425 3300025905 Ga0207685_10016984 Ga0207685_100169843 241
426 3300025906 Ga0207699_10349614 Ga0207699_103496141 241
427 3300025907 Ga0207645_10015974 Ga0207645_100159746 241
428 3300025911 Ga0207654_10140491 Ga0207654_101404913 241
429 3300025914 Ga0207671_10015547 Ga0207671_100155477 241
430 3300025915 Ga0207693_10002045 Ga0207693_1000204516 241
431 3300025916 Ga0207663_10011346 Ga0207663_100113461 241
432 3300025919 Ga0207657_10116159 Ga0207657_101161593 241
433 3300025925 Ga0207650_10168498 Ga0207650_101684983 241
434 3300025927 Ga0207687_10000192 Ga0207687_1000019233 241
435 3300025929 Ga0207664_10113234 Ga0207664_101132343 241
436 3300025929 Ga0207664_10485016 Ga0207664_104850162 241
437 3300025931 Ga0207644_10035309 Ga0207644_100353094 241
438 3300025931 Ga0207644_10209552 Ga0207644_102095521 241
439 3300025932 Ga0207690_10006095 Ga0207690_100060954 241
440 3300025933 Ga0207706_10050314 Ga0207706_100503141 241
441 3300025934 Ga0207686_10000761 Ga0207686_1000076117 241
442 3300025935 Ga0207709_10003124 Ga0207709_1000312411 241
443 3300025937 Ga0207669_10000794 Ga0207669_100007948 241
444 3300025938 Ga0207704_10001730 Ga0207704_100017305 241
445 3300025939 Ga0207665_10002960 Ga0207665_100029604 241
446 3300025941 Ga0207711_10005647 Ga0207711_100056476 241
447 3300025942 Ga0207689_10106862 Ga0207689_101068622 241
448 3300025949 Ga0207667_10215304 Ga0207667_102153043 241
449 3300025961 Ga0207712_10007913 Ga0207712_100079133 241
450 3300025961 Ga0207712_10409967 Ga0207712_104099672 241
451 3300025972 Ga0207668_10001297 Ga0207668_100012978 241
452 3300025972 Ga0207668_10441699 Ga0207668_104416991 241
453 3300025981 Ga0207640_10001367 Ga0207640_100013678 241
454 3300025986 Ga0207658_10001438 Ga0207658_1000143810 241
455 3300025986 Ga0207658_10028827 Ga0207658_100288275 241
456 3300026023 Ga0207677_10002641 Ga0207677_100026416 241
457 3300026035 Ga0207703_10002411 Ga0207703_1000241111 241
458 3300026041 Ga0207639_10001924 Ga0207639_1000192414 241
459 3300026041 Ga0207639_10333285 Ga0207639_103332852 241
460 3300026067 Ga0207678_10046342 Ga0207678_100463423 241
461 3300026075 Ga0207708_10000587 Ga0207708_1000058721 241
462 3300026078 Ga0207702_10192627 Ga0207702_101926272 241
463 3300026088 Ga0207641_10012640 Ga0207641_100126403 241
464 3300026089 Ga0207648_10001309 Ga0207648_1000130912 241
465 3300026118 Ga0207675_100001516 Ga0207675_1000015169 241
466 3300026121 Ga0207683_10000275 Ga0207683_1000027516 241
467 3300028379 Ga0268266_10021095 Ga0268266_100210955 241
468 3300028379 Ga0268266_10091359 Ga0268266_100913592 241
469 3300028380 Ga0268265_10002946 Ga0268265_100029468 241
470 3300028381 Ga0268264_10004702 Ga0268264_100047026 241
471 3300031731 Ga0307405_10516291 Ga0307405_105162911 241
472 3300031824 Ga0307413_10010210 Ga0307413_100102104 241
473 3300031852 Ga0307410_10067917 Ga0307410_100679172 241
474 3300031903 Ga0307407_10243881 Ga0307407_102438811 241
475 3300031995 Ga0307409_100144777 Ga0307409_1001447772 241
476 3300031995 Ga0307409_100226586 Ga0307409_1002265862 241
477 3300032005 Ga0307411_10057291 Ga0307411_100572913 241
478 3300032126 Ga0307415_100038996 Ga0307415_1000389961 241
479 3300035114 Ga0373939_0139759 Ga0373939_0139759_97_822 241
480 3300035207 Ga0373942_0039190 Ga0373942_0039190_431_1156 241
481 3300041411 Ga0439466_0027114 Ga0439466_0027114_852_1577 241
482 3300041413 Ga0439465_0002533 Ga0439465_0002533_4223_4957 241
483 3300041413 Ga0439465_0003858 Ga0439465_0003858_2188_2913 241
484 3300042002 Ga0439442_041894 Ga0439442_041894_153_878 241
485 3300044658 Ga0466972_0004630 Ga0466972_0004630_59_784 241
486 3300044658 Ga0466972_0005419 Ga0466972_0005419_1704_2429 241
487 3300044658 Ga0466972_0018036 Ga0466972_0018036_1820_2545 241
488 3300044658 Ga0466972_0052643 Ga0466972_0052643_549_1274 241
489 3300044683 Ga0466965_0007161 Ga0466965_0007161_1141_1866 241
490 3300044706 Ga0466964_0044042 Ga0466964_0044042_31_756 241
491 3300044735 Ga0466968_0011608 Ga0466968_0011608_316_1041 241
492 3300044765 Ga0466970_0267114 Ga0466970_0267114_184_909 241
493 3300044842 Ga0466957_0070327 Ga0466957_0070327_832_1557 241
494 3300044842 Ga0466957_0071835 Ga0466957_0071835_1279_2004 241
495 3300044901 Ga0466960_0002318 Ga0466960_0002318_1465_2190 241
496 3300044901 Ga0466960_0067075 Ga0466960_0067075_249_974 241
497 3300044901 Ga0466960_0215671 Ga0466960_0215671_215_940 241
498 3300045049 Ga0466959_0091046 Ga0466959_0091046_1178_1903 241
499 3300045976 Ga0466967_0009722 Ga0466967_0009722_3471_4196 241
500 3300045976 Ga0466967_0132359 Ga0466967_0132359_148_873 241
501 3300045976 Ga0466967_0161616 Ga0466967_0161616_1035_1760 241
502 3300047320 Ga0495672_0036289 Ga0495672_0036289_1215_1940 241
503 3300047472 Ga0495686_0001444 Ga0495686_0001444_1401_2138 241
504 3300048903 Ga0496100_0002214 Ga0496100_0002214_4173_4898 241
505 3300048903 Ga0496100_0379933 Ga0496100_0379933_173_898 241
506 3300048904 Ga0496101_0145363 Ga0496101_0145363_892_1617 241
507 3300048905 Ga0496102_0000873 Ga0496102_0000873_14583_15308 241
508 3300048905 Ga0496102_0003346 Ga0496102_0003346_9979_10704 241
509 3300048906 Ga0496103_0000494 Ga0496103_0000494_21848_22573 241
510 3300048906 Ga0496103_0166141 Ga0496103_0166141_271_996 241
511 3300048906 Ga0496103_0258352 Ga0496103_0258352_330_1055 241
512 3300048907 Ga0496104_0033219 Ga0496104_0033219_12_737 241
513 3300048909 Ga0496106_0002689 Ga0496106_0002689_6339_7064 241
514 3300048910 Ga0496107_0000580 Ga0496107_0000580_10776_11501 241
515 3300048911 Ga0496108_0061619 Ga0496108_0061619_768_1493 241
516 3300048912 Ga0496109_0217850 Ga0496109_0217850_351_1076 241
517 3300048913 Ga0496110_0097530 Ga0496110_0097530_1899_2624 241
518 3300048913 Ga0496110_0230507 Ga0496110_0230507_290_1015 241
519 3300048914 Ga0496111_0264904 Ga0496111_0264904_518_1243 241
520 3300048915 Ga0496112_0003504 Ga0496112_0003504_11692_12417 241
521 3300048916 Ga0496113_0003388 Ga0496113_0003388_7883_8608 241
522 3300048917 Ga0496114_0000360 Ga0496114_0000360_21470_22195 241
523 3300048918 Ga0496115_0007831 Ga0496115_0007831_3905_4630 241
524 3300048928 Ga0496125_0253074 Ga0496125_0253074_29_754 241
525 3300049579 Ga0501043_0191932 Ga0501043_0191932_800_1552 241
526 3300049586 Ga0501070_0028310 Ga0501070_0028310_2078_2803 241
527 3300049742 Ga0501080_0722631 Ga0501080_0722631_112_837 241
528 3300049823 Ga0501044_0020469 Ga0501044_0020469_1243_2010 241
529 3300050490 nmdc:mga03n38_21120_c1 nmdc:mga03n38_21120_c1_1833_2558 241
530 3300050490 nmdc:mga03n38_33302_c1 nmdc:mga03n38_33302_c1_700_1425 241
531 3300050490 nmdc:mga03n38_39120_c1 nmdc:mga03n38_39120_c1_853_1578 241
532 3300050490 nmdc:mga03n38_41360_c1 nmdc:mga03n38_41360_c1_1089_1814 241
533 3300050490 nmdc:mga03n38_76143_c1 nmdc:mga03n38_76143_c1_695_1420 241
534 3300050491 nmdc:mga00v17_315556_c1 nmdc:mga00v17_315556_c1_147_872 241
535 3300050491 nmdc:mga00v17_33592_c1 nmdc:mga00v17_33592_c1_1872_2597 241
536 3300050494 nmdc:mga06z11_126914_c1 nmdc:mga06z11_126914_c1_110_835 241
537 3300050494 nmdc:mga06z11_190145_c1 nmdc:mga06z11_190145_c1_208_933 241
538 3300050495 nmdc:mga04h51_25363_c1 nmdc:mga04h51_25363_c1_29_754 241
539 3300050496 nmdc:mga07m45_13863_c1 nmdc:mga07m45_13863_c1_3469_4194 241
540 3300050496 nmdc:mga07m45_2227_c1 nmdc:mga07m45_2227_c1_6046_6771 241
541 3300050496 nmdc:mga07m45_9068_c1 nmdc:mga07m45_9068_c1_141_866 241
542 3300050507 nmdc:mga05p37_12562_c1 nmdc:mga05p37_12562_c1_6697_7422 241
543 3300050509 nmdc:mga0qj67_63808_c1 nmdc:mga0qj67_63808_c1_1368_2093 241
544 3300050510 nmdc:mga06r32_95413_c1 nmdc:mga06r32_95413_c1_1997_2722 241
545 3300050516 nmdc:mga0sz30_16615_c1 nmdc:mga0sz30_16615_c1_1633_2358 241
546 3300050516 nmdc:mga0sz30_187649_c1 nmdc:mga0sz30_187649_c1_128_853 241
547 3300050516 nmdc:mga0sz30_52021_c1 nmdc:mga0sz30_52021_c1_261_986 241
548 3300044684 Ga0466966_0051115 Ga0466966_0051115_1818_2582 242
549 3300044693 Ga0466961_0118247 Ga0466961_0118247_661_1425 242
550 3300044693 Ga0466961_0207690 Ga0466961_0207690_195_959 242
551 3300044842 Ga0466957_0037442 Ga0466957_0037442_1553_2317 242
552 3300044901 Ga0466960_0235860 Ga0466960_0235860_56_820 242
553 3300045049 Ga0466959_0155306 Ga0466959_0155306_662_1426 242
554 3300045836 Ga0466958_0174056 Ga0466958_0174056_534_1298 242
555 3300049569 Ga0501032_0001215 Ga0501032_0001215_15453_16181 242
556 3300049571 Ga0501034_0005626 Ga0501034_0005626_12473_13201 242
557 3300049573 Ga0501037_0000222 Ga0501037_0000222_31559_32287 242
558 3300049574 Ga0501038_0005120 Ga0501038_0005120_3054_3782 242
559 3300049575 Ga0501039_0006680 Ga0501039_0006680_3397_4125 242
560 3300049579 Ga0501043_0000225 Ga0501043_0000225_35431_36159 242
561 3300049583 Ga0501067_0063962 Ga0501067_0063962_415_1143 242
562 3300049584 Ga0501068_0062085 Ga0501068_0062085_1353_2081 242
563 3300049586 Ga0501070_0002172 Ga0501070_0002172_6863_7591 242
564 3300049589 Ga0501073_0067031 Ga0501073_0067031_900_1628 242
565 3300049593 Ga0501077_0113876 Ga0501077_0113876_84_812 242
566 3300049823 Ga0501044_0034660 Ga0501044_0034660_3226_3954 242
567 3300061719 Ga0466962_0157904 Ga0466962_0157904_16_780 242
568 3300044693 Ga0466961_0133963 Ga0466961_0133963_381_1157 243
569 3300045049 Ga0466959_0116419 Ga0466959_0116419_939_1715 243
570 3300001991 JGI24743J22301_10014965 JGI24743J22301_100149652 244
571 3300002073 JGI24745J21846_1003720 JGI24745J21846_10037202 244
572 3300002077 JGI24744J21845_10000009 JGI24744J21845_100000091 244
573 3300005334 Ga0068869_100016210 Ga0068869_1000162104 244
574 3300005337 Ga0070682_100055105 Ga0070682_1000551052 244
575 3300005434 Ga0070709_10077038 Ga0070709_100770383 244
576 3300005437 Ga0070710_10003776 Ga0070710_100037762 244
577 3300005439 Ga0070711_100045002 Ga0070711_1000450022 244
578 3300005440 Ga0070705_100098840 Ga0070705_1000988402 244
579 3300005456 Ga0070678_100163806 Ga0070678_1001638061 244
580 3300005457 Ga0070662_100161959 Ga0070662_1001619593 244
581 3300005539 Ga0068853_100173947 Ga0068853_1001739472 244
582 3300005547 Ga0070693_100075378 Ga0070693_1000753782 244
583 3300005548 Ga0070665_100045561 Ga0070665_1000455615 244
584 3300005549 Ga0070704_100699863 Ga0070704_1006998632 244
585 3300005578 Ga0068854_100072482 Ga0068854_1000724821 244
586 3300005616 Ga0068852_100045495 Ga0068852_1000454954 244
587 3300005618 Ga0068864_100161505 Ga0068864_1001615052 244
588 3300005718 Ga0068866_10047924 Ga0068866_100479242 244
589 3300005719 Ga0068861_100159822 Ga0068861_1001598222 244
590 3300005843 Ga0068860_100234542 Ga0068860_1002345422 244
591 3300006163 Ga0070715_10016250 Ga0070715_100162502 244
592 3300006175 Ga0070712_100064996 Ga0070712_1000649963 244
593 3300006358 Ga0068871_100027734 Ga0068871_1000277346 244
594 3300009101 Ga0105247_10013812 Ga0105247_100138125 244
595 3300010159 Ga0099796_10020316 Ga0099796_100203163 244
596 3300013105 Ga0157369_10527693 Ga0157369_105276931 244
597 3300013296 Ga0157374_10003900 Ga0157374_1000390015 244
598 3300014745 Ga0157377_10041674 Ga0157377_100416742 244
599 3300014968 Ga0157379_10012283 Ga0157379_100122832 244
600 3300014969 Ga0157376_10739286 Ga0157376_107392861 244
601 3300025901 Ga0207688_10056743 Ga0207688_100567433 244
602 3300025903 Ga0207680_10356756 Ga0207680_103567561 244
603 3300025904 Ga0207647_10014725 Ga0207647_100147252 244
604 3300025905 Ga0207685_10070113 Ga0207685_100701132 244
605 3300025915 Ga0207693_10000694 Ga0207693_1000069421 244
606 3300025916 Ga0207663_10032882 Ga0207663_100328821 244
607 3300025923 Ga0207681_10361613 Ga0207681_103616132 244
608 3300025932 Ga0207690_10324383 Ga0207690_103243831 244
609 3300025933 Ga0207706_10207358 Ga0207706_102073583 244
610 3300025935 Ga0207709_10352201 Ga0207709_103522012 244
611 3300025936 Ga0207670_10207166 Ga0207670_102071662 244
612 3300025937 Ga0207669_10034952 Ga0207669_100349522 244
613 3300025938 Ga0207704_10211349 Ga0207704_102113492 244
614 3300025941 Ga0207711_10490822 Ga0207711_104908221 244
615 3300025942 Ga0207689_10013622 Ga0207689_100136226 244
616 3300025981 Ga0207640_10086459 Ga0207640_100864593 244
617 3300026023 Ga0207677_10082201 Ga0207677_100822012 244
618 3300026067 Ga0207678_10006766 Ga0207678_100067665 244
619 3300026088 Ga0207641_10275978 Ga0207641_102759782 244
620 3300026095 Ga0207676_10038375 Ga0207676_100383754 244
621 3300026118 Ga0207675_100015385 Ga0207675_1000153857 244
622 3300026118 Ga0207675_100089981 Ga0207675_1000899812 244
623 3300026121 Ga0207683_10010271 Ga0207683_100102712 244
624 3300032126 Ga0307415_100457750 Ga0307415_1004577502 244
625 3300035092 Ga0373952_0014883 Ga0373952_0014883_446_1180 244
626 3300035691 Ga0373931_0010828 Ga0373931_0010828_2988_3722 244
627 3300044656 Ga0466969_0044608 Ga0466969_0044608_1075_1812 244
628 3300044684 Ga0466966_0002708 Ga0466966_0002708_1060_1797 244
629 3300044693 Ga0466961_0002435 Ga0466961_0002435_1054_1791 244
630 3300044694 Ga0466963_0021557 Ga0466963_0021557_3259_3996 244
631 3300044842 Ga0466957_0003131 Ga0466957_0003131_4597_5334 244
632 3300044901 Ga0466960_0052586 Ga0466960_0052586_756_1529 244
633 3300045049 Ga0466959_0038977 Ga0466959_0038977_2343_3080 244
634 3300045836 Ga0466958_0028446 Ga0466958_0028446_2343_3080 244
635 3300048911 Ga0496108_0000453 Ga0496108_0000453_25423_26157 244
636 3300048912 Ga0496109_0019637 Ga0496109_0019637_4685_5419 244
637 3300048915 Ga0496112_0167614 Ga0496112_0167614_921_1655 244
638 3300048916 Ga0496113_0079626 Ga0496113_0079626_1010_1744 244

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01553

Acyltransferase

Acyltransferase

20

152

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kym-assembly2.cif.gz_B crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.7404 10 210
5kym-assembly1.cif.gz_A crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.6895 10 203
1k30-assembly1.cif.gz_A crystal structure analysis of squash (cucurbita moschata) glycerol-3-phosphate (1)-acyltransferase 0.6726 3 204
1iuq-assembly1.cif.gz_A the 1.55 a crystal structure of glycerol-3-phosphate acyltransferase 0.6295 3 207
5kym-assembly2.cif.gz_B crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.5962 10 210
ID Description Score Start End Superfamily
af_O53516_20_152_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9286 20 150 3.40.50.2000
af_O53516_20_152_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9085 20 150 3.40.50.2000
af_Q2FXJ7_19_144_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.819 21 150 3.40.50.2000
af_Q2FXJ7_19_144_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7958 21 150 3.40.50.2000
af_Q8GXU8_180_307_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7915 24 150 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A5C7N015-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9525 1 211 GO:0003841
GO:0005886
GO:0006654
AF-A0A5C7N015-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9481 1 211 GO:0003841
GO:0005886
GO:0006654
AF-A0A354XNP0-F1-model_v4 deleted 0.9391 1 205
AF-A0A354XNP0-F1-model_v4 deleted 0.9347 1 205
AF-A0A1C3P815-F1-model_v4 Phospholipid/glycerol acyltransferase 0.9333 1 214 GO:0003841
GO:0005886
GO:0006654

Feature Viewer

pLDDT pTM Quality
76.79 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map