F471537
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 638 | 307 | 625 | 240 |
Family's Representative Sequence
| Representative Sequence | 3300044693|Ga0466961_0133963|Ga0466961_0133963_381_1157 |
| Length | 258 |
| Sequence | LFYWFLKFVAIGPIAHLVYRPRAQGADNIPRTGAAILASNHLSAADWIFMPLSISRRVTFLAKAEYFTGTGVKGFLQRVFFAGSGQVPIDRTNASAAEDAIRTGVRMLGEGRLLGIYPEGTRSPDGRLYRGKTGVARMALDTGVPVIPVAMVYRRRTLPFGLKVPFAGKLVRVEVVFGKPLDFSRYAGLSGDRFVERSITDEIMYEIMTLSGQEYVDVYGAQVKKTMDDTGASAVEVVRKLTPPMAEVGDRVPESLAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 2 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 3 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 4 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 5 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 6 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 7 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 8 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 9 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 10 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 11 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 12 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 13 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 14 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 15 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 16 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 17 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 18 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 19 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 20 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 26 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 69 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 70 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 71 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 72 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 76 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 77 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 78 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 84 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 112 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 166 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 167 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 168 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 169 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 170 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 171 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 172 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 173 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 174 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 175 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 176 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 177 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 178 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 179 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 180 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 181 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 182 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 183 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 184 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 185 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 186 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 187 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 188 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 189 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 190 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 191 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 192 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 193 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 194 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 195 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 196 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 197 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 198 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 199 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 200 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 201 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 202 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 203 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 204 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 205 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 206 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 207 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 208 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 209 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 210 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 211 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 212 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 213 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 236 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 237 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 238 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 239 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 240 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 241 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 244 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 245 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 246 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 247 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 248 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 249 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 250 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 251 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 252 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 253 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 254 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 255 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 256 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 257 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 258 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 259 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 260 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 279 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 280 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 281 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 282 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 283 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 284 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 285 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 290 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 292 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 293 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 294 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 295 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 296 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 297 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 298 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 299 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 300 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 301 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 302 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 303 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 304 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 305 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 306 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 307 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.96 |
| Metatranscriptomes | 0 |
| Isolates | 2.04 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.2 |
| Nodule | 0.16 |
| Rhizoplane | 12.23 |
| Rhizosphere | 64.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.99 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10014965 | 3300001991 | Bacteria | 1434 |
| 2 | JGI24745J21846_1003720 | 3300002073 | Bacteria | 1607 |
| 3 | JGI24744J21845_10000009 | 3300002077 | Bacteria | 22522 |
| 4 | JGI24744J21845_10002625 | 3300002077 | Bacteria | 3671 |
| 5 | JGI24742J22300_10013785 | 3300002244 | Bacteria | 1354 |
| 6 | rootH2_10083697 | 3300003320 | Bacteria | 3900 |
| 7 | rootH1_10101351 | 3300003323 | Bacteria | 3705 |
| 8 | Ga0055540_1000134 | 3300003792 | Bacteria | 73612 |
| 9 | Ga0055540_1002706 | 3300003792 | Bacteria | 9128 |
| 10 | Ga0055540_1003818 | 3300003792 | Bacteria | 7093 |
| 11 | Ga0055540_1007916 | 3300003792 | Bacteria | 3914 |
| 12 | Ga0070676_10062815 | 3300005328 | Bacteria | 2211 |
| 13 | Ga0070683_100433906 | 3300005329 | Bacteria | 1253 |
| 14 | Ga0070690_100068918 | 3300005330 | Bacteria | 2295 |
| 15 | Ga0070670_100114719 | 3300005331 | Bacteria | 2322 |
| 16 | Ga0068869_100016210 | 3300005334 | Bacteria | 5018 |
| 17 | Ga0068869_100616676 | 3300005334 | Bacteria | 918 |
| 18 | Ga0070666_10133633 | 3300005335 | Bacteria | 1725 |
| 19 | Ga0070682_100021096 | 3300005337 | Bacteria | 3840 |
| 20 | Ga0070682_100055105 | 3300005337 | Bacteria | 2497 |
| 21 | Ga0070660_100076903 | 3300005339 | Bacteria | 2615 |
| 22 | Ga0070689_100014639 | 3300005340 | Bacteria | 5703 |
| 23 | Ga0070668_100004804 | 3300005347 | Bacteria | 10017 |
| 24 | Ga0070668_100005168 | 3300005347 | Bacteria | 9678 |
| 25 | Ga0070668_100006643 | 3300005347 | Bacteria | 8573 |
| 26 | Ga0070669_100009947 | 3300005353 | Bacteria | 6767 |
| 27 | Ga0070669_100376690 | 3300005353 | Bacteria | 1157 |
| 28 | Ga0070671_100004858 | 3300005355 | Bacteria | 10689 |
| 29 | Ga0070674_100000581 | 3300005356 | Bacteria | 18458 |
| 30 | Ga0070688_100015237 | 3300005365 | Bacteria | 4368 |
| 31 | Ga0070667_100000191 | 3300005367 | Bacteria | 73538 |
| 32 | Ga0070667_100000249 | 3300005367 | Bacteria | 61169 |
| 33 | Ga0070667_100014001 | 3300005367 | Bacteria | 6629 |
| 34 | Ga0070667_100022877 | 3300005367 | Bacteria | 5183 |
| 35 | Ga0070667_100167488 | 3300005367 | Bacteria | 1938 |
| 36 | Ga0070709_10077038 | 3300005434 | Bacteria | 2167 |
| 37 | Ga0070709_10112689 | 3300005434 | Bacteria | 1831 |
| 38 | Ga0070710_10003776 | 3300005437 | Bacteria | 7164 |
| 39 | Ga0070710_10005428 | 3300005437 | Bacteria | 6053 |
| 40 | Ga0070701_10050054 | 3300005438 | Bacteria | 2162 |
| 41 | Ga0070711_100001467 | 3300005439 | Bacteria | 12960 |
| 42 | Ga0070711_100045002 | 3300005439 | Bacteria | 2999 |
| 43 | Ga0070705_100004751 | 3300005440 | Bacteria | 6615 |
| 44 | Ga0070705_100098840 | 3300005440 | Bacteria | 1838 |
| 45 | Ga0070700_100005401 | 3300005441 | Bacteria | 6766 |
| 46 | Ga0070700_100350648 | 3300005441 | Bacteria | 1094 |
| 47 | Ga0070694_100011967 | 3300005444 | Bacteria | 5384 |
| 48 | Ga0070708_100189708 | 3300005445 | Bacteria | 1922 |
| 49 | Ga0070663_100035642 | 3300005455 | Bacteria | 3453 |
| 50 | Ga0070663_100196850 | 3300005455 | Bacteria | 1571 |
| 51 | Ga0070678_100008146 | 3300005456 | Bacteria | 6262 |
| 52 | Ga0070678_100058911 | 3300005456 | Bacteria | 2821 |
| 53 | Ga0070678_100163806 | 3300005456 | Bacteria | 1804 |
| 54 | Ga0070662_100013537 | 3300005457 | Bacteria | 5430 |
| 55 | Ga0070662_100161959 | 3300005457 | Bacteria | 1750 |
| 56 | Ga0068867_100024024 | 3300005459 | Bacteria | 4367 |
| 57 | Ga0068853_100028693 | 3300005539 | Bacteria | 4683 |
| 58 | Ga0068853_100087656 | 3300005539 | Bacteria | 2732 |
| 59 | Ga0068853_100173947 | 3300005539 | Bacteria | 1949 |
| 60 | Ga0070695_100007477 | 3300005545 | Bacteria | 6471 |
| 61 | Ga0070696_100004718 | 3300005546 | Bacteria | 9115 |
| 62 | Ga0070693_100075378 | 3300005547 | Bacteria | 1997 |
| 63 | Ga0070693_100105057 | 3300005547 | Bacteria | 1727 |
| 64 | Ga0070693_100423955 | 3300005547 | Bacteria | 928 |
| 65 | Ga0070665_100003487 | 3300005548 | Bacteria | 16749 |
| 66 | Ga0070665_100045561 | 3300005548 | Bacteria | 4404 |
| 67 | Ga0070665_100070529 | 3300005548 | Bacteria | 3501 |
| 68 | Ga0070665_100380893 | 3300005548 | Bacteria | 1418 |
| 69 | Ga0070704_100000677 | 3300005549 | Bacteria | 16532 |
| 70 | Ga0070704_100699863 | 3300005549 | Bacteria | 898 |
| 71 | Ga0068855_100040762 | 3300005563 | Bacteria | 5509 |
| 72 | Ga0068854_100014805 | 3300005578 | Bacteria | 5149 |
| 73 | Ga0068854_100072482 | 3300005578 | Bacteria | 2522 |
| 74 | Ga0068856_100240195 | 3300005614 | Bacteria | 1827 |
| 75 | Ga0070702_100103424 | 3300005615 | Bacteria | 1751 |
| 76 | Ga0068852_100033994 | 3300005616 | Bacteria | 4240 |
| 77 | Ga0068852_100045495 | 3300005616 | Bacteria | 3734 |
| 78 | Ga0068852_100168834 | 3300005616 | Bacteria | 2049 |
| 79 | Ga0068859_100001601 | 3300005617 | Bacteria | 23121 |
| 80 | Ga0068859_100952406 | 3300005617 | Bacteria | 942 |
| 81 | Ga0068864_100161505 | 3300005618 | Bacteria | 2037 |
| 82 | Ga0068866_10000520 | 3300005718 | Bacteria | 17787 |
| 83 | Ga0068866_10047924 | 3300005718 | Bacteria | 2157 |
| 84 | Ga0068861_100003598 | 3300005719 | Bacteria | 10321 |
| 85 | Ga0068861_100159822 | 3300005719 | Bacteria | 1857 |
| 86 | Ga0068861_100755752 | 3300005719 | Bacteria | 908 |
| 87 | Ga0068863_100010519 | 3300005841 | Bacteria | 8986 |
| 88 | Ga0068863_100012939 | 3300005841 | Bacteria | 8048 |
| 89 | Ga0068863_100082108 | 3300005841 | Bacteria | 3054 |
| 90 | Ga0068858_100006097 | 3300005842 | Bacteria | 11762 |
| 91 | Ga0068858_100014971 | 3300005842 | Bacteria | 7298 |
| 92 | Ga0068858_100334928 | 3300005842 | Bacteria | 1448 |
| 93 | Ga0068860_100000166 | 3300005843 | Bacteria | 108310 |
| 94 | Ga0068860_100006908 | 3300005843 | Bacteria | 11380 |
| 95 | Ga0068860_100234542 | 3300005843 | Bacteria | 1783 |
| 96 | Ga0068862_100000003 | 3300005844 | Bacteria | 369793 |
| 97 | Ga0068862_100088655 | 3300005844 | Bacteria | 2692 |
| 98 | Ga0068862_100445674 | 3300005844 | Bacteria | 1219 |
| 99 | Ga0081455_10067557 | 3300005937 | Bacteria | 2978 |
| 100 | Ga0081538_10101894 | 3300005981 | Bacteria | 1443 |
| 101 | Ga0075365_10255448 | 3300006038 | Bacteria | 1232 |
| 102 | Ga0075365_10454083 | 3300006038 | Bacteria | 905 |
| 103 | Ga0075363_100000454 | 3300006048 | Bacteria | 12853 |
| 104 | Ga0075363_100001144 | 3300006048 | Bacteria | 9695 |
| 105 | Ga0075363_100005022 | 3300006048 | Bacteria | 5854 |
| 106 | Ga0075363_100018402 | 3300006048 | Bacteria | 3481 |
| 107 | Ga0075363_100036166 | 3300006048 | Bacteria | 2589 |
| 108 | Ga0075363_100039226 | 3300006048 | Bacteria | 2492 |
| 109 | Ga0075363_100078622 | 3300006048 | Bacteria | 1801 |
| 110 | Ga0075363_100249329 | 3300006048 | Bacteria | 1022 |
| 111 | Ga0075364_10002046 | 3300006051 | Bacteria | 11255 |
| 112 | Ga0075364_10005383 | 3300006051 | Bacteria | 7430 |
| 113 | Ga0075364_10019149 | 3300006051 | Bacteria | 4293 |
| 114 | Ga0075364_10032430 | 3300006051 | Bacteria | 3358 |
| 115 | Ga0075364_10291537 | 3300006051 | Bacteria | 1110 |
| 116 | Ga0075364_10406719 | 3300006051 | Bacteria | 929 |
| 117 | Ga0070715_10016250 | 3300006163 | Bacteria | 2792 |
| 118 | Ga0070715_10021834 | 3300006163 | Bacteria | 2488 |
| 119 | Ga0070716_100010114 | 3300006173 | Bacteria | 4722 |
| 120 | Ga0070712_100001110 | 3300006175 | Bacteria | 16202 |
| 121 | Ga0070712_100064996 | 3300006175 | Bacteria | 2588 |
| 122 | Ga0075362_10044195 | 3300006177 | Bacteria | 1975 |
| 123 | Ga0075362_10114645 | 3300006177 | Bacteria | 1271 |
| 124 | Ga0075367_10008558 | 3300006178 | Bacteria | 5307 |
| 125 | Ga0075367_10225349 | 3300006178 | Bacteria | 1174 |
| 126 | Ga0075369_10000607 | 3300006186 | Bacteria | 11369 |
| 127 | Ga0075369_10011042 | 3300006186 | Bacteria | 3543 |
| 128 | Ga0075369_10025324 | 3300006186 | Bacteria | 2465 |
| 129 | Ga0075369_10026915 | 3300006186 | Bacteria | 2400 |
| 130 | Ga0075369_10051736 | 3300006186 | Bacteria | 1779 |
| 131 | Ga0075369_10154357 | 3300006186 | Bacteria | 1050 |
| 132 | Ga0075369_10252892 | 3300006186 | Bacteria | 818 |
| 133 | Ga0075366_10062099 | 3300006195 | Bacteria | 2221 |
| 134 | Ga0097621_100112401 | 3300006237 | Bacteria | 2303 |
| 135 | Ga0075370_10014652 | 3300006353 | Bacteria | 4186 |
| 136 | Ga0075370_10015322 | 3300006353 | Bacteria | 4102 |
| 137 | Ga0075370_10104268 | 3300006353 | Bacteria | 1643 |
| 138 | Ga0068871_100027734 | 3300006358 | Bacteria | 4432 |
| 139 | Ga0075428_100001482 | 3300006844 | Bacteria | 25105 |
| 140 | Ga0075430_100086951 | 3300006846 | Bacteria | 2616 |
| 141 | Ga0075431_100099832 | 3300006847 | Bacteria | 2995 |
| 142 | Ga0068865_100004263 | 3300006881 | Bacteria | 8625 |
| 143 | Ga0097620_100001601 | 3300006931 | Bacteria | 23121 |
| 144 | Ga0097620_100952382 | 3300006931 | Bacteria | 942 |
| 145 | Ga0105250_10209034 | 3300009092 | Bacteria | 825 |
| 146 | Ga0105245_10000546 | 3300009098 | Bacteria | 34304 |
| 147 | Ga0105245_10056831 | 3300009098 | Bacteria | 3518 |
| 148 | Ga0105247_10000006 | 3300009101 | Bacteria | 416061 |
| 149 | Ga0105247_10000268 | 3300009101 | Bacteria | 48320 |
| 150 | Ga0105247_10013812 | 3300009101 | Bacteria | 4842 |
| 151 | Ga0105247_10118664 | 3300009101 | Bacteria | 1712 |
| 152 | Ga0114129_10006853 | 3300009147 | Bacteria | 16195 |
| 153 | Ga0105243_10001875 | 3300009148 | Bacteria | 17930 |
| 154 | Ga0105243_10422833 | 3300009148 | Bacteria | 1243 |
| 155 | Ga0105241_10038459 | 3300009174 | Bacteria | 3606 |
| 156 | Ga0105242_10001078 | 3300009176 | Bacteria | 21421 |
| 157 | Ga0105242_10075637 | 3300009176 | Bacteria | 2804 |
| 158 | Ga0105248_10000042 | 3300009177 | Bacteria | 167583 |
| 159 | Ga0105248_10005867 | 3300009177 | Bacteria | 13493 |
| 160 | Ga0105248_10021747 | 3300009177 | Bacteria | 7107 |
| 161 | Ga0105237_10000175 | 3300009545 | Bacteria | 90284 |
| 162 | Ga0105237_10008949 | 3300009545 | Bacteria | 10780 |
| 163 | Ga0105237_10140080 | 3300009545 | Bacteria | 2413 |
| 164 | Ga0105249_10000008 | 3300009553 | Bacteria | 341271 |
| 165 | Ga0105249_10001494 | 3300009553 | Bacteria | 20512 |
| 166 | Ga0105249_10037507 | 3300009553 | Bacteria | 4399 |
| 167 | Ga0105249_10352031 | 3300009553 | Bacteria | 1492 |
| 168 | Ga0099796_10020316 | 3300010159 | Bacteria | 2028 |
| 169 | Ga0105239_10015485 | 3300010375 | Bacteria | 8448 |
| 170 | Ga0105239_10057646 | 3300010375 | Bacteria | 4261 |
| 171 | Ga0105239_10058072 | 3300010375 | Bacteria | 4245 |
| 172 | Ga0105239_11229807 | 3300010375 | Bacteria | 863 |
| 173 | Ga0105246_10773996 | 3300011119 | Bacteria | 849 |
| 174 | Ga0157369_10527693 | 3300013105 | Bacteria | 1221 |
| 175 | Ga0157374_10003900 | 3300013296 | Bacteria | 12523 |
| 176 | Ga0157378_10000438 | 3300013297 | Bacteria | 40289 |
| 177 | Ga0163162_10008681 | 3300013306 | Bacteria | 9890 |
| 178 | Ga0163162_10081003 | 3300013306 | Bacteria | 3316 |
| 179 | Ga0163162_10454178 | 3300013306 | Bacteria | 1413 |
| 180 | Ga0157375_10002558 | 3300013308 | Bacteria | 15793 |
| 181 | Ga0157375_10027547 | 3300013308 | Bacteria | 5313 |
| 182 | Ga0157375_10590150 | 3300013308 | Bacteria | 1271 |
| 183 | Ga0163163_10045891 | 3300014325 | Bacteria | 4291 |
| 184 | Ga0163163_10134954 | 3300014325 | Bacteria | 2509 |
| 185 | Ga0157380_10001136 | 3300014326 | Bacteria | 17184 |
| 186 | Ga0157377_10041674 | 3300014745 | Bacteria | 2548 |
| 187 | Ga0157377_10449361 | 3300014745 | Bacteria | 889 |
| 188 | Ga0157379_10012283 | 3300014968 | Bacteria | 7480 |
| 189 | Ga0157379_10048384 | 3300014968 | Bacteria | 3795 |
| 190 | Ga0157376_10739286 | 3300014969 | Bacteria | 992 |
| 191 | Ga0163161_10001864 | 3300017792 | Bacteria | 15389 |
| 192 | Ga0163161_10454452 | 3300017792 | Bacteria | 1036 |
| 193 | Ga0213876_10003702 | 3300021384 | Bacteria | 8672 |
| 194 | Ga0209673_1002617 | 3300025273 | Bacteria | 12097 |
| 195 | Ga0209051_1000076 | 3300025303 | Bacteria | 204355 |
| 196 | Ga0209051_1003302 | 3300025303 | Bacteria | 10692 |
| 197 | Ga0209051_1004832 | 3300025303 | Bacteria | 8107 |
| 198 | Ga0209051_1008643 | 3300025303 | Bacteria | 5362 |
| 199 | Ga0207653_10062752 | 3300025885 | Bacteria | 1256 |
| 200 | Ga0207692_10001998 | 3300025898 | Bacteria | 7790 |
| 201 | Ga0207692_10235668 | 3300025898 | Bacteria | 1091 |
| 202 | Ga0207642_10000093 | 3300025899 | Bacteria | 23453 |
| 203 | Ga0207710_10000114 | 3300025900 | Bacteria | 101498 |
| 204 | Ga0207710_10004621 | 3300025900 | Bacteria | 5981 |
| 205 | Ga0207688_10001107 | 3300025901 | Bacteria | 13835 |
| 206 | Ga0207688_10056743 | 3300025901 | Bacteria | 2201 |
| 207 | Ga0207680_10091542 | 3300025903 | Bacteria | 1935 |
| 208 | Ga0207680_10356756 | 3300025903 | Bacteria | 1028 |
| 209 | Ga0207647_10014725 | 3300025904 | Bacteria | 5385 |
| 210 | Ga0207647_10200202 | 3300025904 | Bacteria | 1156 |
| 211 | Ga0207685_10016984 | 3300025905 | Bacteria | 2341 |
| 212 | Ga0207685_10070113 | 3300025905 | Bacteria | 1418 |
| 213 | Ga0207699_10349614 | 3300025906 | Bacteria | 1043 |
| 214 | Ga0207645_10015974 | 3300025907 | Bacteria | 4973 |
| 215 | Ga0207705_10458973 | 3300025909 | Bacteria | 988 |
| 216 | Ga0207654_10140491 | 3300025911 | Bacteria | 1539 |
| 217 | Ga0207671_10008374 | 3300025914 | Bacteria | 8777 |
| 218 | Ga0207671_10015547 | 3300025914 | Bacteria | 5952 |
| 219 | Ga0207671_10026196 | 3300025914 | Bacteria | 4371 |
| 220 | Ga0207693_10000694 | 3300025915 | Bacteria | 30256 |
| 221 | Ga0207693_10002045 | 3300025915 | Bacteria | 17662 |
| 222 | Ga0207663_10011346 | 3300025916 | Bacteria | 4782 |
| 223 | Ga0207663_10032882 | 3300025916 | Bacteria | 3083 |
| 224 | Ga0207657_10116159 | 3300025919 | Bacteria | 2205 |
| 225 | Ga0207681_10007054 | 3300025923 | Bacteria | 6894 |
| 226 | Ga0207681_10361613 | 3300025923 | Bacteria | 1164 |
| 227 | Ga0207650_10168498 | 3300025925 | Bacteria | 1739 |
| 228 | Ga0207687_10000192 | 3300025927 | Bacteria | 41036 |
| 229 | Ga0207664_10113234 | 3300025929 | Bacteria | 2259 |
| 230 | Ga0207664_10485016 | 3300025929 | Bacteria | 1106 |
| 231 | Ga0207644_10035309 | 3300025931 | Bacteria | 3502 |
| 232 | Ga0207644_10209552 | 3300025931 | Bacteria | 1540 |
| 233 | Ga0207690_10006095 | 3300025932 | Bacteria | 7144 |
| 234 | Ga0207690_10324383 | 3300025932 | Bacteria | 1211 |
| 235 | Ga0207706_10050314 | 3300025933 | Bacteria | 3682 |
| 236 | Ga0207706_10207358 | 3300025933 | Bacteria | 1718 |
| 237 | Ga0207686_10000761 | 3300025934 | Bacteria | 19817 |
| 238 | Ga0207686_10042042 | 3300025934 | Bacteria | 2791 |
| 239 | Ga0207709_10003124 | 3300025935 | Bacteria | 9962 |
| 240 | Ga0207709_10298266 | 3300025935 | Bacteria | 1197 |
| 241 | Ga0207709_10352201 | 3300025935 | Bacteria | 1112 |
| 242 | Ga0207670_10207166 | 3300025936 | Bacteria | 1493 |
| 243 | Ga0207669_10000794 | 3300025937 | Bacteria | 13541 |
| 244 | Ga0207669_10034952 | 3300025937 | Bacteria | 2854 |
| 245 | Ga0207669_10322057 | 3300025937 | Bacteria | 1184 |
| 246 | Ga0207704_10001730 | 3300025938 | Bacteria | 9776 |
| 247 | Ga0207704_10211349 | 3300025938 | Bacteria | 1428 |
| 248 | Ga0207665_10002960 | 3300025939 | Bacteria | 11381 |
| 249 | Ga0207711_10004319 | 3300025941 | Bacteria | 12143 |
| 250 | Ga0207711_10005647 | 3300025941 | Bacteria | 10569 |
| 251 | Ga0207711_10080007 | 3300025941 | Bacteria | 2854 |
| 252 | Ga0207711_10490822 | 3300025941 | Bacteria | 1144 |
| 253 | Ga0207689_10013622 | 3300025942 | Bacteria | 6934 |
| 254 | Ga0207689_10106862 | 3300025942 | Bacteria | 2300 |
| 255 | Ga0207667_10215304 | 3300025949 | Bacteria | 1968 |
| 256 | Ga0207712_10000011 | 3300025961 | Bacteria | 412321 |
| 257 | Ga0207712_10007913 | 3300025961 | Bacteria | 6714 |
| 258 | Ga0207712_10409967 | 3300025961 | Bacteria | 1141 |
| 259 | Ga0207668_10001297 | 3300025972 | Bacteria | 14853 |
| 260 | Ga0207668_10006197 | 3300025972 | Bacteria | 7061 |
| 261 | Ga0207668_10441699 | 3300025972 | Bacteria | 1108 |
| 262 | Ga0207640_10001367 | 3300025981 | Bacteria | 13196 |
| 263 | Ga0207640_10086459 | 3300025981 | Bacteria | 2159 |
| 264 | Ga0207658_10000071 | 3300025986 | Bacteria | 112481 |
| 265 | Ga0207658_10001438 | 3300025986 | Bacteria | 18563 |
| 266 | Ga0207658_10003482 | 3300025986 | Bacteria | 11118 |
| 267 | Ga0207658_10028827 | 3300025986 | Bacteria | 3913 |
| 268 | Ga0207677_10002641 | 3300026023 | Bacteria | 9433 |
| 269 | Ga0207677_10082201 | 3300026023 | Bacteria | 2314 |
| 270 | Ga0207703_10002411 | 3300026035 | Bacteria | 16246 |
| 271 | Ga0207703_10013161 | 3300026035 | Bacteria | 6446 |
| 272 | Ga0207639_10001924 | 3300026041 | Bacteria | 13948 |
| 273 | Ga0207639_10333285 | 3300026041 | Bacteria | 1351 |
| 274 | Ga0207678_10006766 | 3300026067 | Bacteria | 10165 |
| 275 | Ga0207678_10046342 | 3300026067 | Bacteria | 3759 |
| 276 | Ga0207678_10057966 | 3300026067 | Bacteria | 3333 |
| 277 | Ga0207678_10130336 | 3300026067 | Bacteria | 2145 |
| 278 | Ga0207678_10220019 | 3300026067 | Bacteria | 1625 |
| 279 | Ga0207678_10234877 | 3300026067 | Bacteria | 1570 |
| 280 | Ga0207708_10000587 | 3300026075 | Bacteria | 28161 |
| 281 | Ga0207708_10316656 | 3300026075 | Bacteria | 1272 |
| 282 | Ga0207708_10505728 | 3300026075 | Bacteria | 1013 |
| 283 | Ga0207702_10192627 | 3300026078 | Bacteria | 1885 |
| 284 | Ga0207641_10001975 | 3300026088 | Bacteria | 19593 |
| 285 | Ga0207641_10012640 | 3300026088 | Bacteria | 6924 |
| 286 | Ga0207641_10275978 | 3300026088 | Bacteria | 1579 |
| 287 | Ga0207641_10329810 | 3300026088 | Bacteria | 1449 |
| 288 | Ga0207648_10001309 | 3300026089 | Bacteria | 27704 |
| 289 | Ga0207676_10038375 | 3300026095 | Bacteria | 3655 |
| 290 | Ga0207675_100001516 | 3300026118 | Bacteria | 23283 |
| 291 | Ga0207675_100015385 | 3300026118 | Bacteria | 7135 |
| 292 | Ga0207675_100089981 | 3300026118 | Bacteria | 2885 |
| 293 | Ga0207683_10000275 | 3300026121 | Bacteria | 46018 |
| 294 | Ga0207683_10010271 | 3300026121 | Bacteria | 7983 |
| 295 | Ga0207698_10241430 | 3300026142 | Bacteria | 1647 |
| 296 | Ga0268266_10021095 | 3300028379 | Bacteria | 5551 |
| 297 | Ga0268266_10040687 | 3300028379 | Bacteria | 3963 |
| 298 | Ga0268266_10091359 | 3300028379 | Bacteria | 2669 |
| 299 | Ga0268266_10335613 | 3300028379 | Bacteria | 1418 |
| 300 | Ga0268266_10564552 | 3300028379 | Bacteria | 1091 |
| 301 | Ga0268265_10000010 | 3300028380 | Bacteria | 370129 |
| 302 | Ga0268265_10002946 | 3300028380 | Bacteria | 12471 |
| 303 | Ga0268264_10000007 | 3300028381 | Bacteria | 815790 |
| 304 | Ga0268264_10004702 | 3300028381 | Bacteria | 11600 |
| 305 | Ga0265327_10022776 | 3300031251 | Bacteria | 3731 |
| 306 | Ga0307405_10516291 | 3300031731 | Bacteria | 960 |
| 307 | Ga0307413_10010210 | 3300031824 | Bacteria | 4540 |
| 308 | Ga0307410_10067917 | 3300031852 | Bacteria | 2460 |
| 309 | Ga0307406_10114405 | 3300031901 | Bacteria | 1863 |
| 310 | Ga0307407_10243881 | 3300031903 | Bacteria | 1227 |
| 311 | Ga0307409_100144777 | 3300031995 | Bacteria | 2053 |
| 312 | Ga0307409_100226586 | 3300031995 | Bacteria | 1691 |
| 313 | Ga0307411_10057291 | 3300032005 | Bacteria | 2573 |
| 314 | Ga0307415_100038996 | 3300032126 | Bacteria | 3135 |
| 315 | Ga0307415_100457750 | 3300032126 | Bacteria | 1105 |
| 316 | Ga0373926_0000954 | 3300035083 | Bacteria | 8386 |
| 317 | Ga0373940_0110420 | 3300035088 | Bacteria | 844 |
| 318 | Ga0373952_0014883 | 3300035092 | Bacteria | 1563 |
| 319 | Ga0373939_0139759 | 3300035114 | Bacteria | 872 |
| 320 | Ga0373942_0039190 | 3300035207 | Bacteria | 1288 |
| 321 | Ga0373962_0193217 | 3300035242 | Bacteria | 686 |
| 322 | Ga0373931_0010828 | 3300035691 | Bacteria | 4389 |
| 323 | Ga0373935_0013456 | 3300035692 | Bacteria | 4937 |
| 324 | Ga0373947_0000002 | 3300035725 | Bacteria | 383924 |
| 325 | Ga0373947_0273523 | 3300035725 | Bacteria | 1122 |
| 326 | Ga0316584_0026131 | 3300036712 | Bacteria | 4289 |
| 327 | Ga0395898_0186321 | 3300037466 | Bacteria | 1983 |
| 328 | Ga0395901_0041482 | 3300038443 | Bacteria | 4770 |
| 329 | Ga0436365_0768449 | 3300039437 | Bacteria | 3761 |
| 330 | Ga0436365_1472485 | 3300039437 | Bacteria | 19466 |
| 331 | Ga0436363_1552280 | 3300039450 | Bacteria | 1701 |
| 332 | Ga0439461_0004455 | 3300041410 | Bacteria | 2340 |
| 333 | Ga0439466_0024420 | 3300041411 | Bacteria | 2118 |
| 334 | Ga0439466_0027114 | 3300041411 | Bacteria | 1985 |
| 335 | Ga0439466_0048526 | 3300041411 | Bacteria | 1396 |
| 336 | Ga0439465_0001917 | 3300041413 | Bacteria | 6818 |
| 337 | Ga0439465_0002533 | 3300041413 | Bacteria | 5961 |
| 338 | Ga0439465_0003858 | 3300041413 | Bacteria | 4890 |
| 339 | Ga0451789_0481125 | 3300041443 | Bacteria | 1990 |
| 340 | Ga0451791_0336379 | 3300041451 | Bacteria | 1404 |
| 341 | Ga0451795_1118406 | 3300041456 | Bacteria | 2748 |
| 342 | Ga0439431_0000791 | 3300041997 | Bacteria | 6836 |
| 343 | Ga0439442_031856 | 3300042002 | Bacteria | 1101 |
| 344 | Ga0439442_041894 | 3300042002 | Bacteria | 962 |
| 345 | Ga0439445_0001479 | 3300042004 | Bacteria | 5116 |
| 346 | Ga0439450_047649 | 3300042008 | Bacteria | 1011 |
| 347 | Ga0439434_0014255 | 3300042435 | Bacteria | 2364 |
| 348 | Ga0466969_0044608 | 3300044656 | Bacteria | 2204 |
| 349 | Ga0466972_0004630 | 3300044658 | Bacteria | 6887 |
| 350 | Ga0466972_0005419 | 3300044658 | Bacteria | 6392 |
| 351 | Ga0466972_0006094 | 3300044658 | Bacteria | 6055 |
| 352 | Ga0466972_0018036 | 3300044658 | Bacteria | 3530 |
| 353 | Ga0466972_0052643 | 3300044658 | Bacteria | 1961 |
| 354 | Ga0466972_0214054 | 3300044658 | Bacteria | 902 |
| 355 | Ga0466965_0001293 | 3300044683 | Bacteria | 9967 |
| 356 | Ga0466965_0007161 | 3300044683 | Bacteria | 5110 |
| 357 | Ga0466965_0089381 | 3300044683 | Bacteria | 1565 |
| 358 | Ga0466966_0002708 | 3300044684 | Bacteria | 11624 |
| 359 | Ga0466966_0007481 | 3300044684 | Bacteria | 7238 |
| 360 | Ga0466966_0031021 | 3300044684 | Bacteria | 3467 |
| 361 | Ga0466966_0039461 | 3300044684 | Bacteria | 3041 |
| 362 | Ga0466966_0051115 | 3300044684 | Bacteria | 2628 |
| 363 | Ga0466961_0002435 | 3300044693 | Bacteria | 11547 |
| 364 | Ga0466961_0095027 | 3300044693 | Bacteria | 1880 |
| 365 | Ga0466961_0118247 | 3300044693 | Bacteria | 1665 |
| 366 | Ga0466961_0133963 | 3300044693 | Bacteria | 1553 |
| 367 | Ga0466961_0207690 | 3300044693 | Bacteria | 1209 |
| 368 | Ga0466963_0021557 | 3300044694 | Bacteria | 4067 |
| 369 | Ga0466963_0031951 | 3300044694 | Bacteria | 3405 |
| 370 | Ga0466964_0044042 | 3300044706 | Bacteria | 1812 |
| 371 | Ga0466964_0165316 | 3300044706 | Bacteria | 1037 |
| 372 | Ga0466968_0001059 | 3300044735 | Bacteria | 9752 |
| 373 | Ga0466968_0005573 | 3300044735 | Bacteria | 4716 |
| 374 | Ga0466968_0011608 | 3300044735 | Bacteria | 3435 |
| 375 | Ga0466970_0009717 | 3300044765 | Bacteria | 4867 |
| 376 | Ga0466970_0064479 | 3300044765 | Bacteria | 1964 |
| 377 | Ga0466970_0267114 | 3300044765 | Bacteria | 960 |
| 378 | Ga0466957_0003131 | 3300044842 | Bacteria | 9007 |
| 379 | Ga0466957_0016543 | 3300044842 | Bacteria | 4313 |
| 380 | Ga0466957_0037442 | 3300044842 | Bacteria | 2921 |
| 381 | Ga0466957_0070327 | 3300044842 | Bacteria | 2163 |
| 382 | Ga0466957_0071835 | 3300044842 | Bacteria | 2141 |
| 383 | Ga0466960_0000250 | 3300044901 | Bacteria | 18567 |
| 384 | Ga0466960_0002318 | 3300044901 | Bacteria | 7146 |
| 385 | Ga0466960_0052586 | 3300044901 | Bacteria | 1971 |
| 386 | Ga0466960_0067075 | 3300044901 | Bacteria | 1776 |
| 387 | Ga0466960_0215671 | 3300044901 | Bacteria | 1054 |
| 388 | Ga0466960_0235860 | 3300044901 | Bacteria | 1011 |
| 389 | Ga0466959_0010871 | 3300045049 | Bacteria | 6523 |
| 390 | Ga0466959_0038977 | 3300045049 | Bacteria | 3511 |
| 391 | Ga0466959_0086965 | 3300045049 | Bacteria | 2248 |
| 392 | Ga0466959_0091046 | 3300045049 | Bacteria | 2190 |
| 393 | Ga0466959_0116419 | 3300045049 | Bacteria | 1903 |
| 394 | Ga0466959_0153334 | 3300045049 | Bacteria | 1623 |
| 395 | Ga0466959_0155306 | 3300045049 | Bacteria | 1611 |
| 396 | Ga0466958_0028446 | 3300045836 | Bacteria | 3314 |
| 397 | Ga0466958_0066351 | 3300045836 | Bacteria | 2203 |
| 398 | Ga0466958_0174056 | 3300045836 | Bacteria | 1364 |
| 399 | Ga0466967_0009722 | 3300045976 | Bacteria | 7162 |
| 400 | Ga0466967_0025879 | 3300045976 | Bacteria | 4847 |
| 401 | Ga0466967_0092389 | 3300045976 | Bacteria | 2752 |
| 402 | Ga0466967_0132359 | 3300045976 | Bacteria | 2316 |
| 403 | Ga0466967_0161616 | 3300045976 | Bacteria | 2103 |
| 404 | Ga0495629_0021149 | 3300046459 | Bacteria | 4643 |
| 405 | Ga0495638_0004056 | 3300046460 | Bacteria | 11229 |
| 406 | Ga0495638_0120841 | 3300046460 | Bacteria | 1548 |
| 407 | Ga0495641_0062335 | 3300046461 | Bacteria | 1682 |
| 408 | Ga0495580_0235945 | 3300046472 | Bacteria | 1255 |
| 409 | Ga0495582_0023073 | 3300046473 | Bacteria | 3404 |
| 410 | Ga0495606_0007438 | 3300046507 | Bacteria | 9799 |
| 411 | Ga0495648_0001449 | 3300046524 | Bacteria | 23191 |
| 412 | Ga0495666_0160849 | 3300046526 | Bacteria | 1041 |
| 413 | Ga0495640_0201960 | 3300046533 | Bacteria | 1259 |
| 414 | Ga0495611_0009134 | 3300046648 | Bacteria | 4191 |
| 415 | Ga0495625_0211300 | 3300046660 | Bacteria | 1275 |
| 416 | Ga0495658_0041410 | 3300046683 | Bacteria | 2566 |
| 417 | Ga0495613_0450727 | 3300046689 | Bacteria | 872 |
| 418 | Ga0495581_0009648 | 3300047315 | Bacteria | 5584 |
| 419 | Ga0495674_0141610 | 3300047319 | Bacteria | 2021 |
| 420 | Ga0495672_0003532 | 3300047320 | Bacteria | 13314 |
| 421 | Ga0495672_0036289 | 3300047320 | Bacteria | 3028 |
| 422 | Ga0495676_0057255 | 3300047321 | Bacteria | 3076 |
| 423 | Ga0495673_0000367 | 3300047469 | Bacteria | 54316 |
| 424 | Ga0495686_0001444 | 3300047472 | Bacteria | 25909 |
| 425 | Ga0495686_0143076 | 3300047472 | Bacteria | 1410 |
| 426 | Ga0495626_0145094 | 3300048091 | Bacteria | 1004 |
| 427 | Ga0496100_0000023 | 3300048903 | Bacteria | 121977 |
| 428 | Ga0496100_0000321 | 3300048903 | Bacteria | 23657 |
| 429 | Ga0496100_0001647 | 3300048903 | Bacteria | 11061 |
| 430 | Ga0496100_0002214 | 3300048903 | Bacteria | 9823 |
| 431 | Ga0496100_0004279 | 3300048903 | Bacteria | 7556 |
| 432 | Ga0496100_0010428 | 3300048903 | Bacteria | 5259 |
| 433 | Ga0496100_0222626 | 3300048903 | Bacteria | 1385 |
| 434 | Ga0496100_0379933 | 3300048903 | Bacteria | 1073 |
| 435 | Ga0496101_0000046 | 3300048904 | Bacteria | 155997 |
| 436 | Ga0496101_0000089 | 3300048904 | Bacteria | 98287 |
| 437 | Ga0496101_0000941 | 3300048904 | Bacteria | 17189 |
| 438 | Ga0496101_0030721 | 3300048904 | Bacteria | 3770 |
| 439 | Ga0496101_0074392 | 3300048904 | Bacteria | 2498 |
| 440 | Ga0496101_0145363 | 3300048904 | Bacteria | 1810 |
| 441 | Ga0496101_0259760 | 3300048904 | Bacteria | 1354 |
| 442 | Ga0496102_0000025 | 3300048905 | Bacteria | 227201 |
| 443 | Ga0496102_0000060 | 3300048905 | Bacteria | 167774 |
| 444 | Ga0496102_0000873 | 3300048905 | Bacteria | 28789 |
| 445 | Ga0496102_0003346 | 3300048905 | Bacteria | 13589 |
| 446 | Ga0496102_0010556 | 3300048905 | Bacteria | 7953 |
| 447 | Ga0496102_0034449 | 3300048905 | Bacteria | 4554 |
| 448 | Ga0496102_0167245 | 3300048905 | Bacteria | 2069 |
| 449 | Ga0496103_0000022 | 3300048906 | Bacteria | 227208 |
| 450 | Ga0496103_0000494 | 3300048906 | Bacteria | 32551 |
| 451 | Ga0496103_0001263 | 3300048906 | Bacteria | 17262 |
| 452 | Ga0496103_0001334 | 3300048906 | Bacteria | 16712 |
| 453 | Ga0496103_0156400 | 3300048906 | Bacteria | 1461 |
| 454 | Ga0496103_0166141 | 3300048906 | Bacteria | 1416 |
| 455 | Ga0496103_0258352 | 3300048906 | Bacteria | 1121 |
| 456 | Ga0496104_0033219 | 3300048907 | Bacteria | 4805 |
| 457 | Ga0496104_0266328 | 3300048907 | Bacteria | 1626 |
| 458 | Ga0496105_0025756 | 3300048908 | Bacteria | 4792 |
| 459 | Ga0496105_0410400 | 3300048908 | Bacteria | 1074 |
| 460 | Ga0496105_0645163 | 3300048908 | Bacteria | 817 |
| 461 | Ga0496106_0001191 | 3300048909 | Bacteria | 19408 |
| 462 | Ga0496106_0002689 | 3300048909 | Bacteria | 13201 |
| 463 | Ga0496106_0008922 | 3300048909 | Bacteria | 7414 |
| 464 | Ga0496106_0032954 | 3300048909 | Bacteria | 3863 |
| 465 | Ga0496106_0111312 | 3300048909 | Bacteria | 2132 |
| 466 | Ga0496107_0000580 | 3300048910 | Bacteria | 20406 |
| 467 | Ga0496107_0004677 | 3300048910 | Bacteria | 9290 |
| 468 | Ga0496107_0053168 | 3300048910 | Bacteria | 2922 |
| 469 | Ga0496108_0000453 | 3300048911 | Bacteria | 32720 |
| 470 | Ga0496108_0002763 | 3300048911 | Bacteria | 14052 |
| 471 | Ga0496108_0061619 | 3300048911 | Bacteria | 3157 |
| 472 | Ga0496108_0076130 | 3300048911 | Bacteria | 2836 |
| 473 | Ga0496109_0000037 | 3300048912 | Bacteria | 151906 |
| 474 | Ga0496109_0015309 | 3300048912 | Bacteria | 6680 |
| 475 | Ga0496109_0019637 | 3300048912 | Bacteria | 5961 |
| 476 | Ga0496109_0021341 | 3300048912 | Bacteria | 5726 |
| 477 | Ga0496109_0217850 | 3300048912 | Bacteria | 1795 |
| 478 | Ga0496109_0243204 | 3300048912 | Bacteria | 1694 |
| 479 | Ga0496109_0581324 | 3300048912 | Bacteria | 1056 |
| 480 | Ga0496110_0000823 | 3300048913 | Bacteria | 21775 |
| 481 | Ga0496110_0097530 | 3300048913 | Bacteria | 2634 |
| 482 | Ga0496110_0128739 | 3300048913 | Bacteria | 2285 |
| 483 | Ga0496110_0230507 | 3300048913 | Bacteria | 1684 |
| 484 | Ga0496111_0008588 | 3300048914 | Bacteria | 6770 |
| 485 | Ga0496111_0264904 | 3300048914 | Bacteria | 1275 |
| 486 | Ga0496112_0003504 | 3300048915 | Bacteria | 13009 |
| 487 | Ga0496112_0017157 | 3300048915 | Bacteria | 6799 |
| 488 | Ga0496112_0167614 | 3300048915 | Bacteria | 2162 |
| 489 | Ga0496112_0202525 | 3300048915 | Bacteria | 1944 |
| 490 | Ga0496113_0003388 | 3300048916 | Bacteria | 9534 |
| 491 | Ga0496113_0009242 | 3300048916 | Bacteria | 6467 |
| 492 | Ga0496113_0035764 | 3300048916 | Bacteria | 3634 |
| 493 | Ga0496113_0079626 | 3300048916 | Bacteria | 2509 |
| 494 | Ga0496113_0221680 | 3300048916 | Bacteria | 1507 |
| 495 | Ga0496114_0000207 | 3300048917 | Bacteria | 42841 |
| 496 | Ga0496114_0000360 | 3300048917 | Bacteria | 33359 |
| 497 | Ga0496114_0003506 | 3300048917 | Bacteria | 12041 |
| 498 | Ga0496115_0007831 | 3300048918 | Bacteria | 7877 |
| 499 | Ga0496115_0009317 | 3300048918 | Bacteria | 7296 |
| 500 | Ga0496115_0041143 | 3300048918 | Bacteria | 3676 |
| 501 | Ga0496115_0401482 | 3300048918 | Bacteria | 1112 |
| 502 | Ga0496116_0000059 | 3300048919 | Bacteria | 274491 |
| 503 | Ga0496116_0016405 | 3300048919 | Bacteria | 5796 |
| 504 | Ga0496116_0018445 | 3300048919 | Bacteria | 5379 |
| 505 | Ga0496117_0000055 | 3300048920 | Bacteria | 274518 |
| 506 | Ga0496117_0000595 | 3300048920 | Bacteria | 59503 |
| 507 | Ga0496117_0080614 | 3300048920 | Bacteria | 2139 |
| 508 | Ga0496118_0000058 | 3300048921 | Bacteria | 227245 |
| 509 | Ga0496118_0000786 | 3300048921 | Bacteria | 50796 |
| 510 | Ga0496118_0022748 | 3300048921 | Bacteria | 5465 |
| 511 | Ga0496119_0000278 | 3300048922 | Bacteria | 71878 |
| 512 | Ga0496119_0010357 | 3300048922 | Bacteria | 7852 |
| 513 | Ga0496119_0010955 | 3300048922 | Bacteria | 7571 |
| 514 | Ga0496119_0169691 | 3300048922 | Bacteria | 1153 |
| 515 | Ga0496120_0000384 | 3300048923 | Bacteria | 71475 |
| 516 | Ga0496120_0007979 | 3300048923 | Bacteria | 7794 |
| 517 | Ga0496120_0027029 | 3300048923 | Bacteria | 3536 |
| 518 | Ga0496121_0000068 | 3300048924 | Bacteria | 259210 |
| 519 | Ga0496121_0000113 | 3300048924 | Bacteria | 181807 |
| 520 | Ga0496121_0014051 | 3300048924 | Bacteria | 8545 |
| 521 | Ga0496122_0000687 | 3300048925 | Bacteria | 67409 |
| 522 | Ga0496122_0039559 | 3300048925 | Bacteria | 3759 |
| 523 | Ga0496123_0010123 | 3300048926 | Bacteria | 8382 |
| 524 | Ga0496124_0000065 | 3300048927 | Bacteria | 223594 |
| 525 | Ga0496124_0149803 | 3300048927 | Bacteria | 1832 |
| 526 | Ga0496124_0177292 | 3300048927 | Bacteria | 1644 |
| 527 | Ga0496124_0273841 | 3300048927 | Bacteria | 1234 |
| 528 | Ga0496125_0000008 | 3300048928 | Bacteria | 704677 |
| 529 | Ga0496125_0058629 | 3300048928 | Bacteria | 3109 |
| 530 | Ga0496125_0076529 | 3300048928 | Bacteria | 2583 |
| 531 | Ga0496125_0253074 | 3300048928 | Bacteria | 1110 |
| 532 | Ga0496126_0000062 | 3300048929 | Bacteria | 259210 |
| 533 | Ga0496126_0002477 | 3300048929 | Bacteria | 24860 |
| 534 | Ga0496126_0005460 | 3300048929 | Bacteria | 14506 |
| 535 | Ga0496126_0035619 | 3300048929 | Bacteria | 4662 |
| 536 | Ga0501032_0001215 | 3300049569 | Bacteria | 20609 |
| 537 | Ga0501032_0072340 | 3300049569 | Bacteria | 2298 |
| 538 | Ga0501033_0062513 | 3300049570 | Bacteria | 2742 |
| 539 | Ga0501033_0073398 | 3300049570 | Bacteria | 2512 |
| 540 | Ga0501034_0005626 | 3300049571 | Bacteria | 13648 |
| 541 | Ga0501037_0000222 | 3300049573 | Bacteria | 49681 |
| 542 | Ga0501038_0005120 | 3300049574 | Bacteria | 12175 |
| 543 | Ga0501039_0006680 | 3300049575 | Bacteria | 8769 |
| 544 | Ga0501043_0000225 | 3300049579 | Bacteria | 51378 |
| 545 | Ga0501043_0191932 | 3300049579 | Bacteria | 1588 |
| 546 | Ga0501043_0314654 | 3300049579 | Bacteria | 1194 |
| 547 | Ga0501046_0164711 | 3300049580 | Bacteria | 1666 |
| 548 | Ga0501047_0068328 | 3300049581 | Bacteria | 3422 |
| 549 | Ga0501048_0092463 | 3300049582 | Bacteria | 2133 |
| 550 | Ga0501067_0063962 | 3300049583 | Bacteria | 2037 |
| 551 | Ga0501068_0062085 | 3300049584 | Bacteria | 2271 |
| 552 | Ga0501070_0002172 | 3300049586 | Bacteria | 17248 |
| 553 | Ga0501070_0028310 | 3300049586 | Bacteria | 4699 |
| 554 | Ga0501070_0357468 | 3300049586 | Bacteria | 1185 |
| 555 | Ga0501073_0067031 | 3300049589 | Bacteria | 2502 |
| 556 | Ga0501077_0113876 | 3300049593 | Bacteria | 1715 |
| 557 | Ga0501080_0722631 | 3300049742 | Bacteria | 877 |
| 558 | Ga0501035_0000481 | 3300049822 | Bacteria | 44803 |
| 559 | Ga0501044_0002856 | 3300049823 | Bacteria | 19659 |
| 560 | Ga0501044_0020469 | 3300049823 | Bacteria | 7065 |
| 561 | Ga0501044_0034660 | 3300049823 | Bacteria | 5292 |
| 562 | nmdc:mga03683_77480_c1 | 3300050489 | Bacteria | 1430 |
| 563 | nmdc:mga03n38_21120_c1 | 3300050490 | Bacteria | 2615 |
| 564 | nmdc:mga03n38_29285_c1 | 3300050490 | Bacteria | 2303 |
| 565 | nmdc:mga03n38_30320_c1 | 3300050490 | Bacteria | 2273 |
| 566 | nmdc:mga03n38_32155_c1 | 3300050490 | Bacteria | 2220 |
| 567 | nmdc:mga03n38_33302_c1 | 3300050490 | Bacteria | 2191 |
| 568 | nmdc:mga03n38_39120_c1 | 3300050490 | Bacteria | 2055 |
| 569 | nmdc:mga03n38_41360_c1 | 3300050490 | Bacteria | 2008 |
| 570 | nmdc:mga03n38_76143_c1 | 3300050490 | Bacteria | 1565 |
| 571 | nmdc:mga00v17_157562_c1 | 3300050491 | Bacteria | 1460 |
| 572 | nmdc:mga00v17_202653_c1 | 3300050491 | Bacteria | 1283 |
| 573 | nmdc:mga00v17_21358_c1 | 3300050491 | Bacteria | 3721 |
| 574 | nmdc:mga00v17_315556_c1 | 3300050491 | Bacteria | 1016 |
| 575 | nmdc:mga00v17_33592_c1 | 3300050491 | Bacteria | 3041 |
| 576 | nmdc:mga00v17_359170_c1 | 3300050491 | Bacteria | 947 |
| 577 | nmdc:mga00v17_369705_c1 | 3300050491 | Bacteria | 932 |
| 578 | nmdc:mga00v17_43759_c1 | 3300050491 | Bacteria | 2698 |
| 579 | nmdc:mga00v17_71431_c1 | 3300050491 | Bacteria | 2151 |
| 580 | nmdc:mga0yw44_223390_c1 | 3300050492 | Bacteria | 1249 |
| 581 | nmdc:mga0yw44_401621_c1 | 3300050492 | Bacteria | 927 |
| 582 | nmdc:mga0yw44_43707_c1 | 3300050492 | Bacteria | 2676 |
| 583 | nmdc:mga0yw44_49605_c1 | 3300050492 | Bacteria | 2534 |
| 584 | nmdc:mga06z11_126914_c1 | 3300050494 | Bacteria | 1428 |
| 585 | nmdc:mga06z11_190145_c1 | 3300050494 | Bacteria | 1188 |
| 586 | nmdc:mga04h51_25363_c1 | 3300050495 | Bacteria | 1824 |
| 587 | nmdc:mga07m45_13863_c1 | 3300050496 | Bacteria | 4283 |
| 588 | nmdc:mga07m45_2227_c1 | 3300050496 | Bacteria | 9061 |
| 589 | nmdc:mga07m45_9068_c1 | 3300050496 | Bacteria | 5140 |
| 590 | nmdc:mga05p37_12562_c1 | 3300050507 | Bacteria | 10111 |
| 591 | nmdc:mga0qj67_63808_c1 | 3300050509 | Bacteria | 2929 |
| 592 | nmdc:mga06r32_95413_c1 | 3300050510 | Bacteria | 2911 |
| 593 | nmdc:mga0n895_1051848_c1 | 3300050512 | Bacteria | 793 |
| 594 | nmdc:mga0sz30_100449_c2 | 3300050516 | Bacteria | 947 |
| 595 | nmdc:mga0sz30_16615_c1 | 3300050516 | Bacteria | 2925 |
| 596 | nmdc:mga0sz30_187649_c1 | 3300050516 | Bacteria | 918 |
| 597 | nmdc:mga0sz30_30998_c1 | 3300050516 | Bacteria | 2211 |
| 598 | nmdc:mga0sz30_46633_c1 | 3300050516 | Bacteria | 1830 |
| 599 | nmdc:mga0sz30_52021_c1 | 3300050516 | Bacteria | 1739 |
| 600 | nmdc:mga0sz30_7873_c1 | 3300050516 | Bacteria | 1875 |
| 601 | nmdc:mga0sz30_81096_c1 | 3300050516 | Bacteria | 1404 |
| 602 | Ga0495655_0004396 | 3300053083 | Bacteria | 2405 |
| 603 | Ga0500643_004017 | 3300053087 | Bacteria | 6796 |
| 604 | Ga0500644_0092490 | 3300053088 | Bacteria | 1135 |
| 605 | Ga0500646_0111177 | 3300053090 | Bacteria | 871 |
| 606 | Ga0500641_0109115 | 3300053096 | Bacteria | 1191 |
| 607 | Ga0500553_068869 | 3300053101 | Bacteria | 1633 |
| 608 | Ga0500556_0006262 | 3300053104 | Bacteria | 3372 |
| 609 | Ga0500556_0066645 | 3300053104 | Bacteria | 1337 |
| 610 | Ga0500560_024754 | 3300053107 | Bacteria | 1756 |
| 611 | Ga0500614_013552 | 3300053123 | Bacteria | 1793 |
| 612 | Ga0500642_0157859 | 3300053130 | Bacteria | 1064 |
| 613 | Ga0500652_009736 | 3300053131 | Bacteria | 3264 |
| 614 | Ga0500652_093424 | 3300053131 | Bacteria | 1256 |
| 615 | Ga0500559_0100350 | 3300053136 | Bacteria | 1333 |
| 616 | Ga0500568_0107999 | 3300053139 | Bacteria | 1041 |
| 617 | Ga0500588_0064468 | 3300053146 | Bacteria | 1184 |
| 618 | Ga0500588_0136913 | 3300053146 | Bacteria | 877 |
| 619 | Ga0500603_034815 | 3300053150 | Bacteria | 1318 |
| 620 | Ga0500616_0002400 | 3300053153 | Bacteria | 15631 |
| 621 | Ga0500616_0057948 | 3300053153 | Bacteria | 2017 |
| 622 | Ga0500645_001463 | 3300053730 | Bacteria | 11884 |
| 623 | Ga0500645_014073 | 3300053730 | Bacteria | 2556 |
| 624 | Ga0466962_0085888 | 3300061719 | Bacteria | 1506 |
| 625 | Ga0466962_0157904 | 3300061719 | Bacteria | 1102 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044658 | Ga0466972_0214054 | Ga0466972_0214054_257_880 | 195 |
| 2 | 3300048091 | Ga0495626_0145094 | Ga0495626_0145094_355_975 | 206 |
| 3 | 3300035242 | Ga0373962_0193217 | Ga0373962_0193217_28_651 | 207 |
| 4 | 3300050490 | nmdc:mga03n38_32155_c1 | nmdc:mga03n38_32155_c1_1565_2188 | 207 |
| 5 | 3300050491 | nmdc:mga00v17_21358_c1 | nmdc:mga00v17_21358_c1_3081_3704 | 207 |
| 6 | 3300050512 | nmdc:mga0n895_1051848_c1 | nmdc:mga0n895_1051848_c1_138_761 | 207 |
| 7 | 3300035088 | Ga0373940_0110420 | Ga0373940_0110420_47_679 | 210 |
| 8 | 3300048905 | Ga0496102_0167245 | Ga0496102_0167245_47_679 | 210 |
| 9 | 3300048906 | Ga0496103_0156400 | Ga0496103_0156400_50_682 | 210 |
| 10 | 3300046683 | Ga0495658_0041410 | Ga0495658_0041410_128_862 | 213 |
| 11 | 3300053101 | Ga0500553_068869 | Ga0500553_068869_622_1362 | 213 |
| 12 | 3300053123 | Ga0500614_013552 | Ga0500614_013552_113_859 | 213 |
| 13 | 3300053150 | Ga0500603_034815 | Ga0500603_034815_369_1115 | 213 |
| 14 | 3300053107 | Ga0500560_024754 | Ga0500560_024754_373_1107 | 215 |
| 15 | 3300035725 | Ga0373947_0000002 | Ga0373947_0000002_316467_317606 | 220 |
| 16 | 3300035083 | Ga0373926_0000954 | Ga0373926_0000954_970_2046 | 221 |
| 17 | 3300048927 | Ga0496124_0177292 | Ga0496124_0177292_960_1631 | 221 |
| 18 | 3300035692 | Ga0373935_0013456 | Ga0373935_0013456_3324_4400 | 223 |
| 19 | 3300003320 | rootH2_10083697 | rootH2_100836975 | 226 |
| 20 | 3300003323 | rootH1_10101351 | rootH1_101013512 | 226 |
| 21 | 3300021384 | Ga0213876_10003702 | Ga0213876_100037025 | 226 |
| 22 | 3300039437 | Ga0436365_1472485 | Ga0436365_1472485_14537_15298 | 226 |
| 23 | 3300044684 | Ga0466966_0039461 | Ga0466966_0039461_873_1640 | 226 |
| 24 | 3300045049 | Ga0466959_0153334 | Ga0466959_0153334_674_1441 | 226 |
| 25 | iso_pu_bacteria | 2738541264 | 2738668045 | 227 |
| 26 | iso_pu_bacteria | 2738541356 | 2739147115 | 227 |
| 27 | 3300047315 | Ga0495581_0009648 | Ga0495581_0009648_3331_4089 | 228 |
| 28 | 3300050491 | nmdc:mga00v17_369705_c1 | nmdc:mga00v17_369705_c1_29_730 | 229 |
| 29 | 3300050516 | nmdc:mga0sz30_100449_c2 | nmdc:mga0sz30_100449_c2_218_919 | 229 |
| 30 | iso_pu_bacteria | 2643221715 | 2644635273 | 229 |
| 31 | iso_pu_bacteria | 2902810491 | 2902812850 | 229 |
| 32 | 3300003792 | Ga0055540_1000134 | Ga0055540_100013452 | 231 |
| 33 | 3300005335 | Ga0070666_10133633 | Ga0070666_101336332 | 231 |
| 34 | 3300005367 | Ga0070667_100000249 | Ga0070667_10000024928 | 231 |
| 35 | 3300005445 | Ga0070708_100189708 | Ga0070708_1001897081 | 231 |
| 36 | 3300009148 | Ga0105243_10422833 | Ga0105243_104228332 | 231 |
| 37 | 3300009545 | Ga0105237_10140080 | Ga0105237_101400802 | 231 |
| 38 | 3300010375 | Ga0105239_10015485 | Ga0105239_1001548510 | 231 |
| 39 | 3300025303 | Ga0209051_1000076 | Ga0209051_100007652 | 231 |
| 40 | 3300025903 | Ga0207680_10091542 | Ga0207680_100915423 | 231 |
| 41 | 3300025914 | Ga0207671_10026196 | Ga0207671_100261965 | 231 |
| 42 | 3300025986 | Ga0207658_10003482 | Ga0207658_1000348211 | 231 |
| 43 | 3300031251 | Ga0265327_10022776 | Ga0265327_100227763 | 231 |
| 44 | 3300044658 | Ga0466972_0006094 | Ga0466972_0006094_2412_3113 | 231 |
| 45 | 3300044683 | Ga0466965_0001293 | Ga0466965_0001293_5778_6479 | 231 |
| 46 | 3300044683 | Ga0466965_0089381 | Ga0466965_0089381_181_882 | 231 |
| 47 | 3300044706 | Ga0466964_0165316 | Ga0466964_0165316_182_883 | 231 |
| 48 | 3300044735 | Ga0466968_0001059 | Ga0466968_0001059_4979_5680 | 231 |
| 49 | 3300044765 | Ga0466970_0064479 | Ga0466970_0064479_357_1058 | 231 |
| 50 | 3300044842 | Ga0466957_0016543 | Ga0466957_0016543_2839_3540 | 231 |
| 51 | 3300044901 | Ga0466960_0000250 | Ga0466960_0000250_15187_15888 | 231 |
| 52 | 3300045049 | Ga0466959_0010871 | Ga0466959_0010871_2513_3214 | 231 |
| 53 | 3300045976 | Ga0466967_0025879 | Ga0466967_0025879_2666_3367 | 231 |
| 54 | 3300045976 | Ga0466967_0092389 | Ga0466967_0092389_183_884 | 231 |
| 55 | 3300048903 | Ga0496100_0000023 | Ga0496100_0000023_57338_58039 | 231 |
| 56 | 3300048903 | Ga0496100_0010428 | Ga0496100_0010428_556_1257 | 231 |
| 57 | 3300048904 | Ga0496101_0000089 | Ga0496101_0000089_90205_90906 | 231 |
| 58 | 3300048904 | Ga0496101_0259760 | Ga0496101_0259760_602_1303 | 231 |
| 59 | 3300048905 | Ga0496102_0010556 | Ga0496102_0010556_4241_4942 | 231 |
| 60 | 3300048906 | Ga0496103_0001263 | Ga0496103_0001263_15003_15704 | 231 |
| 61 | 3300048908 | Ga0496105_0645163 | Ga0496105_0645163_28_729 | 231 |
| 62 | 3300048909 | Ga0496106_0008922 | Ga0496106_0008922_5586_6287 | 231 |
| 63 | 3300048910 | Ga0496107_0004677 | Ga0496107_0004677_3228_3929 | 231 |
| 64 | 3300048911 | Ga0496108_0002763 | Ga0496108_0002763_3840_4541 | 231 |
| 65 | 3300048912 | Ga0496109_0000037 | Ga0496109_0000037_61002_61703 | 231 |
| 66 | 3300048913 | Ga0496110_0000823 | Ga0496110_0000823_6541_7242 | 231 |
| 67 | 3300048914 | Ga0496111_0008588 | Ga0496111_0008588_4227_4928 | 231 |
| 68 | 3300048915 | Ga0496112_0017157 | Ga0496112_0017157_71_772 | 231 |
| 69 | 3300048915 | Ga0496112_0202525 | Ga0496112_0202525_667_1362 | 231 |
| 70 | 3300048916 | Ga0496113_0035764 | Ga0496113_0035764_758_1459 | 231 |
| 71 | 3300048916 | Ga0496113_0221680 | Ga0496113_0221680_765_1466 | 231 |
| 72 | 3300048917 | Ga0496114_0000207 | Ga0496114_0000207_1317_2018 | 231 |
| 73 | 3300048918 | Ga0496115_0041143 | Ga0496115_0041143_1335_2036 | 231 |
| 74 | 3300048919 | Ga0496116_0018445 | Ga0496116_0018445_3106_3807 | 231 |
| 75 | 3300048920 | Ga0496117_0080614 | Ga0496117_0080614_421_1122 | 231 |
| 76 | 3300048921 | Ga0496118_0022748 | Ga0496118_0022748_421_1122 | 231 |
| 77 | 3300048922 | Ga0496119_0010357 | Ga0496119_0010357_5593_6294 | 231 |
| 78 | 3300048923 | Ga0496120_0027029 | Ga0496120_0027029_926_1627 | 231 |
| 79 | 3300048924 | Ga0496121_0000068 | Ga0496121_0000068_90204_90905 | 231 |
| 80 | 3300048925 | Ga0496122_0000687 | Ga0496122_0000687_15539_16240 | 231 |
| 81 | 3300048925 | Ga0496122_0039559 | Ga0496122_0039559_410_1111 | 231 |
| 82 | 3300048926 | Ga0496123_0010123 | Ga0496123_0010123_3706_4407 | 231 |
| 83 | 3300048927 | Ga0496124_0000065 | Ga0496124_0000065_132690_133391 | 231 |
| 84 | 3300048928 | Ga0496125_0000008 | Ga0496125_0000008_613773_614474 | 231 |
| 85 | 3300048929 | Ga0496126_0000062 | Ga0496126_0000062_90204_90905 | 231 |
| 86 | 3300048929 | Ga0496126_0005460 | Ga0496126_0005460_5558_6259 | 231 |
| 87 | 3300050491 | nmdc:mga00v17_202653_c1 | nmdc:mga00v17_202653_c1_14_709 | 231 |
| 88 | 3300005441 | Ga0070700_100350648 | Ga0070700_1003506482 | 232 |
| 89 | 3300006048 | Ga0075363_100018402 | Ga0075363_1000184023 | 232 |
| 90 | 3300009098 | Ga0105245_10056831 | Ga0105245_100568313 | 232 |
| 91 | 3300009553 | Ga0105249_10352031 | Ga0105249_103520312 | 232 |
| 92 | 3300010375 | Ga0105239_11229807 | Ga0105239_112298071 | 232 |
| 93 | 3300013308 | Ga0157375_10590150 | Ga0157375_105901502 | 232 |
| 94 | 3300025937 | Ga0207669_10322057 | Ga0207669_103220572 | 232 |
| 95 | 3300026067 | Ga0207678_10057966 | Ga0207678_100579664 | 232 |
| 96 | 3300026075 | Ga0207708_10316656 | Ga0207708_103166562 | 232 |
| 97 | 3300035725 | Ga0373947_0273523 | Ga0373947_0273523_276_974 | 232 |
| 98 | 3300046459 | Ga0495629_0021149 | Ga0495629_0021149_1991_2689 | 232 |
| 99 | 3300046461 | Ga0495641_0062335 | Ga0495641_0062335_936_1634 | 232 |
| 100 | 3300046472 | Ga0495580_0235945 | Ga0495580_0235945_532_1230 | 232 |
| 101 | 3300046473 | Ga0495582_0023073 | Ga0495582_0023073_2091_2789 | 232 |
| 102 | 3300046526 | Ga0495666_0160849 | Ga0495666_0160849_12_710 | 232 |
| 103 | 3300046533 | Ga0495640_0201960 | Ga0495640_0201960_239_937 | 232 |
| 104 | 3300046689 | Ga0495613_0450727 | Ga0495613_0450727_21_719 | 232 |
| 105 | 3300047319 | Ga0495674_0141610 | Ga0495674_0141610_1169_1867 | 232 |
| 106 | 3300047321 | Ga0495676_0057255 | Ga0495676_0057255_1009_1707 | 232 |
| 107 | 3300048905 | Ga0496102_0034449 | Ga0496102_0034449_3182_3889 | 232 |
| 108 | 3300048911 | Ga0496108_0076130 | Ga0496108_0076130_1181_1879 | 232 |
| 109 | 3300048912 | Ga0496109_0015309 | Ga0496109_0015309_4842_5540 | 232 |
| 110 | 3300048912 | Ga0496109_0243204 | Ga0496109_0243204_459_1157 | 232 |
| 111 | 3300048913 | Ga0496110_0128739 | Ga0496110_0128739_997_1695 | 232 |
| 112 | 3300048916 | Ga0496113_0009242 | Ga0496113_0009242_256_954 | 232 |
| 113 | 3300050490 | nmdc:mga03n38_29285_c1 | nmdc:mga03n38_29285_c1_927_1625 | 232 |
| 114 | 3300053083 | Ga0495655_0004396 | Ga0495655_0004396_1682_2380 | 232 |
| 115 | 3300005329 | Ga0070683_100433906 | Ga0070683_1004339061 | 233 |
| 116 | 3300005547 | Ga0070693_100423955 | Ga0070693_1004239551 | 233 |
| 117 | 3300014745 | Ga0157377_10449361 | Ga0157377_104493611 | 233 |
| 118 | 3300025909 | Ga0207705_10458973 | Ga0207705_104589731 | 233 |
| 119 | 3300026067 | Ga0207678_10234877 | Ga0207678_102348772 | 233 |
| 120 | 3300031901 | Ga0307406_10114405 | Ga0307406_101144052 | 233 |
| 121 | 3300041410 | Ga0439461_0004455 | Ga0439461_0004455_1250_1966 | 233 |
| 122 | 3300041411 | Ga0439466_0024420 | Ga0439466_0024420_538_1254 | 233 |
| 123 | 3300041997 | Ga0439431_0000791 | Ga0439431_0000791_5679_6395 | 233 |
| 124 | 3300042002 | Ga0439442_031856 | Ga0439442_031856_183_899 | 233 |
| 125 | 3300042004 | Ga0439445_0001479 | Ga0439445_0001479_3594_4310 | 233 |
| 126 | 3300042435 | Ga0439434_0014255 | Ga0439434_0014255_526_1242 | 233 |
| 127 | 3300050491 | nmdc:mga00v17_71431_c1 | nmdc:mga00v17_71431_c1_1028_1744 | 233 |
| 128 | iso_pu_bacteria | 2738541274 | 2738703922 | 234 |
| 129 | iso_pu_bacteria | 2738543028 | 2739330796 | 234 |
| 130 | iso_pu_bacteria | 2902799365 | 2902803978 | 234 |
| 131 | 3300006038 | Ga0075365_10454083 | Ga0075365_104540831 | 235 |
| 132 | 3300006051 | Ga0075364_10406719 | Ga0075364_104067192 | 235 |
| 133 | 3300006186 | Ga0075369_10051736 | Ga0075369_100517363 | 235 |
| 134 | 3300041411 | Ga0439466_0048526 | Ga0439466_0048526_108_818 | 235 |
| 135 | 3300041413 | Ga0439465_0001917 | Ga0439465_0001917_1024_1734 | 235 |
| 136 | 3300050491 | nmdc:mga00v17_359170_c1 | nmdc:mga00v17_359170_c1_106_813 | 235 |
| 137 | 3300050492 | nmdc:mga0yw44_401621_c1 | nmdc:mga0yw44_401621_c1_136_843 | 235 |
| 138 | 3300050516 | nmdc:mga0sz30_46633_c1 | nmdc:mga0sz30_46633_c1_791_1501 | 235 |
| 139 | iso_pu_bacteria | 2643221687 | 2644488838 | 235 |
| 140 | iso_pu_bacteria | 2842134933 | 2842137497 | 235 |
| 141 | iso_pu_bacteria | 2902837492 | 2902838712 | 235 |
| 142 | 3300005616 | Ga0068852_100168834 | Ga0068852_1001688342 | 236 |
| 143 | 3300009545 | Ga0105237_10000175 | Ga0105237_1000017574 | 236 |
| 144 | 3300010375 | Ga0105239_10058072 | Ga0105239_100580722 | 236 |
| 145 | 3300025914 | Ga0207671_10008374 | Ga0207671_100083748 | 236 |
| 146 | 3300026142 | Ga0207698_10241430 | Ga0207698_102414301 | 236 |
| 147 | 3300039437 | Ga0436365_0768449 | Ga0436365_0768449_298_1014 | 236 |
| 148 | 3300048903 | Ga0496100_0001647 | Ga0496100_0001647_3610_4344 | 236 |
| 149 | 3300048904 | Ga0496101_0000046 | Ga0496101_0000046_15705_16439 | 236 |
| 150 | 3300048905 | Ga0496102_0000025 | Ga0496102_0000025_62418_63152 | 236 |
| 151 | 3300048906 | Ga0496103_0000022 | Ga0496103_0000022_62418_63152 | 236 |
| 152 | 3300048909 | Ga0496106_0032954 | Ga0496106_0032954_2980_3714 | 236 |
| 153 | 3300048919 | Ga0496116_0000059 | Ga0496116_0000059_211340_212074 | 236 |
| 154 | 3300048920 | Ga0496117_0000055 | Ga0496117_0000055_62418_63152 | 236 |
| 155 | 3300048921 | Ga0496118_0000058 | Ga0496118_0000058_62418_63152 | 236 |
| 156 | 3300048922 | Ga0496119_0000278 | Ga0496119_0000278_55333_56067 | 236 |
| 157 | 3300048923 | Ga0496120_0000384 | Ga0496120_0000384_15409_16143 | 236 |
| 158 | 3300048924 | Ga0496121_0000113 | Ga0496121_0000113_165363_166097 | 236 |
| 159 | 3300048929 | Ga0496126_0002477 | Ga0496126_0002477_21324_22058 | 236 |
| 160 | iso_pu_bacteria | 2929212328 | 2929216285 | 236 |
| 161 | 3300006051 | Ga0075364_10005383 | Ga0075364_100053834 | 237 |
| 162 | 3300006186 | Ga0075369_10252892 | Ga0075369_102528921 | 237 |
| 163 | 3300006353 | Ga0075370_10015322 | Ga0075370_100153221 | 237 |
| 164 | 3300048912 | Ga0496109_0581324 | Ga0496109_0581324_145_861 | 237 |
| 165 | 3300048922 | Ga0496119_0169691 | Ga0496119_0169691_333_1097 | 237 |
| 166 | 3300050490 | nmdc:mga03n38_30320_c1 | nmdc:mga03n38_30320_c1_330_1067 | 237 |
| 167 | 3300050491 | nmdc:mga00v17_43759_c1 | nmdc:mga00v17_43759_c1_1632_2369 | 237 |
| 168 | 3300050516 | nmdc:mga0sz30_30998_c1 | nmdc:mga0sz30_30998_c1_1424_2161 | 237 |
| 169 | iso_pu_bacteria | 2902792274 | 2902797052 | 237 |
| 170 | iso_pu_bacteria | 2939582691 | 2939588372 | 237 |
| 171 | 3300005353 | Ga0070669_100009947 | Ga0070669_1000099476 | 238 |
| 172 | 3300005367 | Ga0070667_100000191 | Ga0070667_10000019116 | 238 |
| 173 | 3300005548 | Ga0070665_100003487 | Ga0070665_10000348710 | 238 |
| 174 | 3300005841 | Ga0068863_100012939 | Ga0068863_1000129396 | 238 |
| 175 | 3300005842 | Ga0068858_100006097 | Ga0068858_10000609711 | 238 |
| 176 | 3300005843 | Ga0068860_100000166 | Ga0068860_1000001665 | 238 |
| 177 | 3300005844 | Ga0068862_100000003 | Ga0068862_10000000321 | 238 |
| 178 | 3300006038 | Ga0075365_10255448 | Ga0075365_102554482 | 238 |
| 179 | 3300006186 | Ga0075369_10026915 | Ga0075369_100269152 | 238 |
| 180 | 3300009101 | Ga0105247_10000006 | Ga0105247_10000006305 | 238 |
| 181 | 3300009177 | Ga0105248_10000042 | Ga0105248_1000004265 | 238 |
| 182 | 3300009553 | Ga0105249_10000008 | Ga0105249_10000008112 | 238 |
| 183 | 3300013306 | Ga0163162_10454178 | Ga0163162_104541781 | 238 |
| 184 | 3300014325 | Ga0163163_10134954 | Ga0163163_101349542 | 238 |
| 185 | 3300014968 | Ga0157379_10048384 | Ga0157379_100483843 | 238 |
| 186 | 3300025900 | Ga0207710_10000114 | Ga0207710_1000011482 | 238 |
| 187 | 3300025923 | Ga0207681_10007054 | Ga0207681_100070546 | 238 |
| 188 | 3300025941 | Ga0207711_10004319 | Ga0207711_1000431912 | 238 |
| 189 | 3300025961 | Ga0207712_10000011 | Ga0207712_10000011208 | 238 |
| 190 | 3300025986 | Ga0207658_10000071 | Ga0207658_1000007136 | 238 |
| 191 | 3300026035 | Ga0207703_10013161 | Ga0207703_100131616 | 238 |
| 192 | 3300026088 | Ga0207641_10001975 | Ga0207641_1000197514 | 238 |
| 193 | 3300028379 | Ga0268266_10040687 | Ga0268266_100406873 | 238 |
| 194 | 3300028380 | Ga0268265_10000010 | Ga0268265_1000001022 | 238 |
| 195 | 3300028381 | Ga0268264_10000007 | Ga0268264_10000007556 | 238 |
| 196 | 3300036712 | Ga0316584_0026131 | Ga0316584_0026131_893_1627 | 238 |
| 197 | 3300042008 | Ga0439450_047649 | Ga0439450_047649_95_817 | 238 |
| 198 | 3300046460 | Ga0495638_0120841 | Ga0495638_0120841_392_1123 | 238 |
| 199 | 3300048903 | Ga0496100_0004279 | Ga0496100_0004279_5057_5776 | 238 |
| 200 | 3300048904 | Ga0496101_0030721 | Ga0496101_0030721_2777_3496 | 238 |
| 201 | 3300048905 | Ga0496102_0000060 | Ga0496102_0000060_162990_163709 | 238 |
| 202 | 3300048906 | Ga0496103_0001334 | Ga0496103_0001334_229_948 | 238 |
| 203 | 3300048910 | Ga0496107_0053168 | Ga0496107_0053168_391_1110 | 238 |
| 204 | 3300048918 | Ga0496115_0401482 | Ga0496115_0401482_186_917 | 238 |
| 205 | 3300048919 | Ga0496116_0016405 | Ga0496116_0016405_4949_5668 | 238 |
| 206 | 3300048920 | Ga0496117_0000595 | Ga0496117_0000595_53651_54370 | 238 |
| 207 | 3300048921 | Ga0496118_0000786 | Ga0496118_0000786_12150_12869 | 238 |
| 208 | 3300048922 | Ga0496119_0010955 | Ga0496119_0010955_3795_4514 | 238 |
| 209 | 3300048923 | Ga0496120_0007979 | Ga0496120_0007979_6727_7446 | 238 |
| 210 | 3300048924 | Ga0496121_0014051 | Ga0496121_0014051_6589_7308 | 238 |
| 211 | 3300048927 | Ga0496124_0273841 | Ga0496124_0273841_178_897 | 238 |
| 212 | 3300048928 | Ga0496125_0058629 | Ga0496125_0058629_1380_2111 | 238 |
| 213 | 3300048928 | Ga0496125_0076529 | Ga0496125_0076529_546_1265 | 238 |
| 214 | 3300048929 | Ga0496126_0035619 | Ga0496126_0035619_3026_3745 | 238 |
| 215 | 3300050492 | nmdc:mga0yw44_223390_c1 | nmdc:mga0yw44_223390_c1_239_970 | 238 |
| 216 | 3300050492 | nmdc:mga0yw44_43707_c1 | nmdc:mga0yw44_43707_c1_25_768 | 238 |
| 217 | 3300050516 | nmdc:mga0sz30_7873_c1 | nmdc:mga0sz30_7873_c1_731_1474 | 238 |
| 218 | 3300053090 | Ga0500646_0111177 | Ga0500646_0111177_90_809 | 238 |
| 219 | 3300053096 | Ga0500641_0109115 | Ga0500641_0109115_161_892 | 238 |
| 220 | 3300053130 | Ga0500642_0157859 | Ga0500642_0157859_43_774 | 238 |
| 221 | 3300053131 | Ga0500652_093424 | Ga0500652_093424_144_875 | 238 |
| 222 | 3300053136 | Ga0500559_0100350 | Ga0500559_0100350_559_1290 | 238 |
| 223 | 3300053139 | Ga0500568_0107999 | Ga0500568_0107999_109_840 | 238 |
| 224 | 3300053146 | Ga0500588_0136913 | Ga0500588_0136913_104_835 | 238 |
| 225 | 3300053730 | Ga0500645_001463 | Ga0500645_001463_2303_3034 | 238 |
| 226 | 3300053730 | Ga0500645_014073 | Ga0500645_014073_85_816 | 238 |
| 227 | 3300003792 | Ga0055540_1002706 | Ga0055540_10027069 | 239 |
| 228 | 3300003792 | Ga0055540_1003818 | Ga0055540_10038184 | 239 |
| 229 | 3300003792 | Ga0055540_1007916 | Ga0055540_10079164 | 239 |
| 230 | 3300005347 | Ga0070668_100006643 | Ga0070668_1000066436 | 239 |
| 231 | 3300005455 | Ga0070663_100196850 | Ga0070663_1001968503 | 239 |
| 232 | 3300006177 | Ga0075362_10044195 | Ga0075362_100441952 | 239 |
| 233 | 3300009092 | Ga0105250_10209034 | Ga0105250_102090341 | 239 |
| 234 | 3300025273 | Ga0209673_1002617 | Ga0209673_10026178 | 239 |
| 235 | 3300025303 | Ga0209051_1003302 | Ga0209051_10033027 | 239 |
| 236 | 3300025303 | Ga0209051_1004832 | Ga0209051_10048326 | 239 |
| 237 | 3300025303 | Ga0209051_1008643 | Ga0209051_10086434 | 239 |
| 238 | 3300025935 | Ga0207709_10298266 | Ga0207709_102982662 | 239 |
| 239 | 3300025972 | Ga0207668_10006197 | Ga0207668_100061976 | 239 |
| 240 | 3300026067 | Ga0207678_10130336 | Ga0207678_101303363 | 239 |
| 241 | 3300026067 | Ga0207678_10220019 | Ga0207678_102200193 | 239 |
| 242 | 3300026075 | Ga0207708_10505728 | Ga0207708_105057281 | 239 |
| 243 | 3300041443 | Ga0451789_0481125 | Ga0451789_0481125_76_813 | 239 |
| 244 | 3300041451 | Ga0451791_0336379 | Ga0451791_0336379_505_1242 | 239 |
| 245 | 3300041456 | Ga0451795_1118406 | Ga0451795_1118406_1516_2253 | 239 |
| 246 | 3300046460 | Ga0495638_0004056 | Ga0495638_0004056_8393_9112 | 239 |
| 247 | 3300046507 | Ga0495606_0007438 | Ga0495606_0007438_5276_6004 | 239 |
| 248 | 3300046524 | Ga0495648_0001449 | Ga0495648_0001449_15747_16475 | 239 |
| 249 | 3300046648 | Ga0495611_0009134 | Ga0495611_0009134_1598_2326 | 239 |
| 250 | 3300047320 | Ga0495672_0003532 | Ga0495672_0003532_9797_10525 | 239 |
| 251 | 3300047469 | Ga0495673_0000367 | Ga0495673_0000367_25209_25937 | 239 |
| 252 | 3300047472 | Ga0495686_0143076 | Ga0495686_0143076_536_1264 | 239 |
| 253 | 3300048903 | Ga0496100_0222626 | Ga0496100_0222626_79_807 | 239 |
| 254 | 3300048904 | Ga0496101_0074392 | Ga0496101_0074392_471_1199 | 239 |
| 255 | 3300048907 | Ga0496104_0266328 | Ga0496104_0266328_770_1498 | 239 |
| 256 | 3300048908 | Ga0496105_0410400 | Ga0496105_0410400_190_918 | 239 |
| 257 | 3300048909 | Ga0496106_0111312 | Ga0496106_0111312_322_1050 | 239 |
| 258 | 3300048927 | Ga0496124_0149803 | Ga0496124_0149803_912_1649 | 239 |
| 259 | 3300049570 | Ga0501033_0062513 | Ga0501033_0062513_1263_1988 | 239 |
| 260 | 3300049586 | Ga0501070_0357468 | Ga0501070_0357468_127_852 | 239 |
| 261 | 3300050489 | nmdc:mga03683_77480_c1 | nmdc:mga03683_77480_c1_10_747 | 239 |
| 262 | 3300050516 | nmdc:mga0sz30_81096_c1 | nmdc:mga0sz30_81096_c1_241_978 | 239 |
| 263 | 3300053087 | Ga0500643_004017 | Ga0500643_004017_2214_2942 | 239 |
| 264 | 3300053104 | Ga0500556_0006262 | Ga0500556_0006262_129_848 | 239 |
| 265 | 3300053104 | Ga0500556_0066645 | Ga0500556_0066645_292_1011 | 239 |
| 266 | 3300053131 | Ga0500652_009736 | Ga0500652_009736_1310_2035 | 239 |
| 267 | 3300053146 | Ga0500588_0064468 | Ga0500588_0064468_383_1102 | 239 |
| 268 | 3300053153 | Ga0500616_0002400 | Ga0500616_0002400_1977_2705 | 239 |
| 269 | 3300005456 | Ga0070678_100058911 | Ga0070678_1000589113 | 240 |
| 270 | 3300005548 | Ga0070665_100380893 | Ga0070665_1003808932 | 240 |
| 271 | 3300005841 | Ga0068863_100082108 | Ga0068863_1000821082 | 240 |
| 272 | 3300005842 | Ga0068858_100334928 | Ga0068858_1003349282 | 240 |
| 273 | 3300006051 | Ga0075364_10291537 | Ga0075364_102915372 | 240 |
| 274 | 3300009101 | Ga0105247_10118664 | Ga0105247_101186642 | 240 |
| 275 | 3300009176 | Ga0105242_10075637 | Ga0105242_100756372 | 240 |
| 276 | 3300009177 | Ga0105248_10021747 | Ga0105248_100217473 | 240 |
| 277 | 3300013308 | Ga0157375_10027547 | Ga0157375_100275472 | 240 |
| 278 | 3300025898 | Ga0207692_10235668 | Ga0207692_102356682 | 240 |
| 279 | 3300025934 | Ga0207686_10042042 | Ga0207686_100420423 | 240 |
| 280 | 3300025941 | Ga0207711_10080007 | Ga0207711_100800073 | 240 |
| 281 | 3300026088 | Ga0207641_10329810 | Ga0207641_103298102 | 240 |
| 282 | 3300028379 | Ga0268266_10335613 | Ga0268266_103356132 | 240 |
| 283 | 3300028379 | Ga0268266_10564552 | Ga0268266_105645521 | 240 |
| 284 | 3300037466 | Ga0395898_0186321 | Ga0395898_0186321_743_1501 | 240 |
| 285 | 3300038443 | Ga0395901_0041482 | Ga0395901_0041482_2314_3072 | 240 |
| 286 | 3300039450 | Ga0436363_1552280 | Ga0436363_1552280_90_812 | 240 |
| 287 | 3300044684 | Ga0466966_0007481 | Ga0466966_0007481_3192_3929 | 240 |
| 288 | 3300044684 | Ga0466966_0031021 | Ga0466966_0031021_550_1278 | 240 |
| 289 | 3300044693 | Ga0466961_0095027 | Ga0466961_0095027_21_758 | 240 |
| 290 | 3300044694 | Ga0466963_0031951 | Ga0466963_0031951_465_1202 | 240 |
| 291 | 3300044735 | Ga0466968_0005573 | Ga0466968_0005573_234_971 | 240 |
| 292 | 3300044765 | Ga0466970_0009717 | Ga0466970_0009717_3263_4000 | 240 |
| 293 | 3300045049 | Ga0466959_0086965 | Ga0466959_0086965_206_943 | 240 |
| 294 | 3300045836 | Ga0466958_0066351 | Ga0466958_0066351_985_1722 | 240 |
| 295 | 3300046660 | Ga0495625_0211300 | Ga0495625_0211300_65_787 | 240 |
| 296 | 3300048903 | Ga0496100_0000321 | Ga0496100_0000321_21727_22452 | 240 |
| 297 | 3300048904 | Ga0496101_0000941 | Ga0496101_0000941_6588_7313 | 240 |
| 298 | 3300048908 | Ga0496105_0025756 | Ga0496105_0025756_1812_2537 | 240 |
| 299 | 3300048909 | Ga0496106_0001191 | Ga0496106_0001191_3330_4055 | 240 |
| 300 | 3300048912 | Ga0496109_0021341 | Ga0496109_0021341_1905_2630 | 240 |
| 301 | 3300048917 | Ga0496114_0003506 | Ga0496114_0003506_3228_3953 | 240 |
| 302 | 3300048918 | Ga0496115_0009317 | Ga0496115_0009317_4139_4864 | 240 |
| 303 | 3300049569 | Ga0501032_0072340 | Ga0501032_0072340_843_1589 | 240 |
| 304 | 3300049570 | Ga0501033_0073398 | Ga0501033_0073398_1657_2403 | 240 |
| 305 | 3300049579 | Ga0501043_0314654 | Ga0501043_0314654_253_999 | 240 |
| 306 | 3300049580 | Ga0501046_0164711 | Ga0501046_0164711_238_984 | 240 |
| 307 | 3300049581 | Ga0501047_0068328 | Ga0501047_0068328_1998_2744 | 240 |
| 308 | 3300049582 | Ga0501048_0092463 | Ga0501048_0092463_1301_2047 | 240 |
| 309 | 3300049822 | Ga0501035_0000481 | Ga0501035_0000481_39263_40009 | 240 |
| 310 | 3300049823 | Ga0501044_0002856 | Ga0501044_0002856_16915_17661 | 240 |
| 311 | 3300050491 | nmdc:mga00v17_157562_c1 | nmdc:mga00v17_157562_c1_313_1041 | 240 |
| 312 | 3300050492 | nmdc:mga0yw44_49605_c1 | nmdc:mga0yw44_49605_c1_795_1520 | 240 |
| 313 | 3300053088 | Ga0500644_0092490 | Ga0500644_0092490_357_1079 | 240 |
| 314 | 3300053153 | Ga0500616_0057948 | Ga0500616_0057948_1251_1973 | 240 |
| 315 | 3300061719 | Ga0466962_0085888 | Ga0466962_0085888_462_1199 | 240 |
| 316 | 3300002077 | JGI24744J21845_10002625 | JGI24744J21845_100026254 | 241 |
| 317 | 3300002244 | JGI24742J22300_10013785 | JGI24742J22300_100137852 | 241 |
| 318 | 3300005328 | Ga0070676_10062815 | Ga0070676_100628153 | 241 |
| 319 | 3300005330 | Ga0070690_100068918 | Ga0070690_1000689183 | 241 |
| 320 | 3300005331 | Ga0070670_100114719 | Ga0070670_1001147192 | 241 |
| 321 | 3300005334 | Ga0068869_100616676 | Ga0068869_1006166761 | 241 |
| 322 | 3300005337 | Ga0070682_100021096 | Ga0070682_1000210962 | 241 |
| 323 | 3300005339 | Ga0070660_100076903 | Ga0070660_1000769032 | 241 |
| 324 | 3300005340 | Ga0070689_100014639 | Ga0070689_1000146393 | 241 |
| 325 | 3300005347 | Ga0070668_100004804 | Ga0070668_1000048042 | 241 |
| 326 | 3300005347 | Ga0070668_100005168 | Ga0070668_10000516811 | 241 |
| 327 | 3300005353 | Ga0070669_100376690 | Ga0070669_1003766901 | 241 |
| 328 | 3300005355 | Ga0070671_100004858 | Ga0070671_1000048589 | 241 |
| 329 | 3300005356 | Ga0070674_100000581 | Ga0070674_10000058116 | 241 |
| 330 | 3300005365 | Ga0070688_100015237 | Ga0070688_1000152374 | 241 |
| 331 | 3300005367 | Ga0070667_100014001 | Ga0070667_1000140017 | 241 |
| 332 | 3300005367 | Ga0070667_100022877 | Ga0070667_1000228776 | 241 |
| 333 | 3300005367 | Ga0070667_100167488 | Ga0070667_1001674882 | 241 |
| 334 | 3300005434 | Ga0070709_10112689 | Ga0070709_101126892 | 241 |
| 335 | 3300005437 | Ga0070710_10005428 | Ga0070710_100054282 | 241 |
| 336 | 3300005438 | Ga0070701_10050054 | Ga0070701_100500542 | 241 |
| 337 | 3300005439 | Ga0070711_100001467 | Ga0070711_10000146713 | 241 |
| 338 | 3300005440 | Ga0070705_100004751 | Ga0070705_1000047518 | 241 |
| 339 | 3300005441 | Ga0070700_100005401 | Ga0070700_1000054012 | 241 |
| 340 | 3300005444 | Ga0070694_100011967 | Ga0070694_1000119671 | 241 |
| 341 | 3300005455 | Ga0070663_100035642 | Ga0070663_1000356423 | 241 |
| 342 | 3300005456 | Ga0070678_100008146 | Ga0070678_1000081467 | 241 |
| 343 | 3300005457 | Ga0070662_100013537 | Ga0070662_1000135376 | 241 |
| 344 | 3300005459 | Ga0068867_100024024 | Ga0068867_1000240245 | 241 |
| 345 | 3300005539 | Ga0068853_100028693 | Ga0068853_1000286932 | 241 |
| 346 | 3300005539 | Ga0068853_100087656 | Ga0068853_1000876563 | 241 |
| 347 | 3300005545 | Ga0070695_100007477 | Ga0070695_1000074772 | 241 |
| 348 | 3300005546 | Ga0070696_100004718 | Ga0070696_1000047189 | 241 |
| 349 | 3300005547 | Ga0070693_100105057 | Ga0070693_1001050571 | 241 |
| 350 | 3300005548 | Ga0070665_100070529 | Ga0070665_1000705295 | 241 |
| 351 | 3300005549 | Ga0070704_100000677 | Ga0070704_1000006772 | 241 |
| 352 | 3300005563 | Ga0068855_100040762 | Ga0068855_1000407626 | 241 |
| 353 | 3300005578 | Ga0068854_100014805 | Ga0068854_1000148056 | 241 |
| 354 | 3300005614 | Ga0068856_100240195 | Ga0068856_1002401953 | 241 |
| 355 | 3300005615 | Ga0070702_100103424 | Ga0070702_1001034243 | 241 |
| 356 | 3300005616 | Ga0068852_100033994 | Ga0068852_1000339943 | 241 |
| 357 | 3300005617 | Ga0068859_100001601 | Ga0068859_1000016016 | 241 |
| 358 | 3300005617 | Ga0068859_100952406 | Ga0068859_1009524061 | 241 |
| 359 | 3300005718 | Ga0068866_10000520 | Ga0068866_1000052011 | 241 |
| 360 | 3300005719 | Ga0068861_100003598 | Ga0068861_1000035982 | 241 |
| 361 | 3300005719 | Ga0068861_100755752 | Ga0068861_1007557521 | 241 |
| 362 | 3300005841 | Ga0068863_100010519 | Ga0068863_1000105199 | 241 |
| 363 | 3300005842 | Ga0068858_100014971 | Ga0068858_1000149717 | 241 |
| 364 | 3300005843 | Ga0068860_100006908 | Ga0068860_1000069081 | 241 |
| 365 | 3300005844 | Ga0068862_100088655 | Ga0068862_1000886552 | 241 |
| 366 | 3300005844 | Ga0068862_100445674 | Ga0068862_1004456741 | 241 |
| 367 | 3300005937 | Ga0081455_10067557 | Ga0081455_100675572 | 241 |
| 368 | 3300005981 | Ga0081538_10101894 | Ga0081538_101018942 | 241 |
| 369 | 3300006048 | Ga0075363_100000454 | Ga0075363_1000004542 | 241 |
| 370 | 3300006048 | Ga0075363_100001144 | Ga0075363_1000011445 | 241 |
| 371 | 3300006048 | Ga0075363_100005022 | Ga0075363_1000050227 | 241 |
| 372 | 3300006048 | Ga0075363_100036166 | Ga0075363_1000361663 | 241 |
| 373 | 3300006048 | Ga0075363_100039226 | Ga0075363_1000392263 | 241 |
| 374 | 3300006048 | Ga0075363_100078622 | Ga0075363_1000786222 | 241 |
| 375 | 3300006048 | Ga0075363_100249329 | Ga0075363_1002493292 | 241 |
| 376 | 3300006051 | Ga0075364_10002046 | Ga0075364_100020465 | 241 |
| 377 | 3300006051 | Ga0075364_10019149 | Ga0075364_100191491 | 241 |
| 378 | 3300006051 | Ga0075364_10032430 | Ga0075364_100324303 | 241 |
| 379 | 3300006163 | Ga0070715_10021834 | Ga0070715_100218343 | 241 |
| 380 | 3300006173 | Ga0070716_100010114 | Ga0070716_1000101146 | 241 |
| 381 | 3300006175 | Ga0070712_100001110 | Ga0070712_10000111016 | 241 |
| 382 | 3300006177 | Ga0075362_10114645 | Ga0075362_101146452 | 241 |
| 383 | 3300006178 | Ga0075367_10008558 | Ga0075367_100085585 | 241 |
| 384 | 3300006178 | Ga0075367_10225349 | Ga0075367_102253492 | 241 |
| 385 | 3300006186 | Ga0075369_10000607 | Ga0075369_100006077 | 241 |
| 386 | 3300006186 | Ga0075369_10011042 | Ga0075369_100110422 | 241 |
| 387 | 3300006186 | Ga0075369_10025324 | Ga0075369_100253242 | 241 |
| 388 | 3300006186 | Ga0075369_10154357 | Ga0075369_101543572 | 241 |
| 389 | 3300006195 | Ga0075366_10062099 | Ga0075366_100620993 | 241 |
| 390 | 3300006237 | Ga0097621_100112401 | Ga0097621_1001124012 | 241 |
| 391 | 3300006353 | Ga0075370_10014652 | Ga0075370_100146525 | 241 |
| 392 | 3300006353 | Ga0075370_10104268 | Ga0075370_101042682 | 241 |
| 393 | 3300006844 | Ga0075428_100001482 | Ga0075428_10000148220 | 241 |
| 394 | 3300006846 | Ga0075430_100086951 | Ga0075430_1000869513 | 241 |
| 395 | 3300006847 | Ga0075431_100099832 | Ga0075431_1000998324 | 241 |
| 396 | 3300006881 | Ga0068865_100004263 | Ga0068865_1000042639 | 241 |
| 397 | 3300006931 | Ga0097620_100001601 | Ga0097620_10000160119 | 241 |
| 398 | 3300006931 | Ga0097620_100952382 | Ga0097620_1009523821 | 241 |
| 399 | 3300009098 | Ga0105245_10000546 | Ga0105245_1000054616 | 241 |
| 400 | 3300009101 | Ga0105247_10000268 | Ga0105247_1000026816 | 241 |
| 401 | 3300009147 | Ga0114129_10006853 | Ga0114129_1000685312 | 241 |
| 402 | 3300009148 | Ga0105243_10001875 | Ga0105243_1000187515 | 241 |
| 403 | 3300009174 | Ga0105241_10038459 | Ga0105241_100384593 | 241 |
| 404 | 3300009176 | Ga0105242_10001078 | Ga0105242_100010789 | 241 |
| 405 | 3300009177 | Ga0105248_10005867 | Ga0105248_100058679 | 241 |
| 406 | 3300009545 | Ga0105237_10008949 | Ga0105237_100089496 | 241 |
| 407 | 3300009553 | Ga0105249_10001494 | Ga0105249_100014947 | 241 |
| 408 | 3300009553 | Ga0105249_10037507 | Ga0105249_100375076 | 241 |
| 409 | 3300010375 | Ga0105239_10057646 | Ga0105239_100576465 | 241 |
| 410 | 3300011119 | Ga0105246_10773996 | Ga0105246_107739961 | 241 |
| 411 | 3300013297 | Ga0157378_10000438 | Ga0157378_1000043813 | 241 |
| 412 | 3300013306 | Ga0163162_10008681 | Ga0163162_100086818 | 241 |
| 413 | 3300013306 | Ga0163162_10081003 | Ga0163162_100810035 | 241 |
| 414 | 3300013308 | Ga0157375_10002558 | Ga0157375_100025582 | 241 |
| 415 | 3300014325 | Ga0163163_10045891 | Ga0163163_100458913 | 241 |
| 416 | 3300014326 | Ga0157380_10001136 | Ga0157380_100011368 | 241 |
| 417 | 3300017792 | Ga0163161_10001864 | Ga0163161_1000186415 | 241 |
| 418 | 3300017792 | Ga0163161_10454452 | Ga0163161_104544522 | 241 |
| 419 | 3300025885 | Ga0207653_10062752 | Ga0207653_100627522 | 241 |
| 420 | 3300025898 | Ga0207692_10001998 | Ga0207692_100019987 | 241 |
| 421 | 3300025899 | Ga0207642_10000093 | Ga0207642_100000936 | 241 |
| 422 | 3300025900 | Ga0207710_10004621 | Ga0207710_100046216 | 241 |
| 423 | 3300025901 | Ga0207688_10001107 | Ga0207688_100011075 | 241 |
| 424 | 3300025904 | Ga0207647_10200202 | Ga0207647_102002022 | 241 |
| 425 | 3300025905 | Ga0207685_10016984 | Ga0207685_100169843 | 241 |
| 426 | 3300025906 | Ga0207699_10349614 | Ga0207699_103496141 | 241 |
| 427 | 3300025907 | Ga0207645_10015974 | Ga0207645_100159746 | 241 |
| 428 | 3300025911 | Ga0207654_10140491 | Ga0207654_101404913 | 241 |
| 429 | 3300025914 | Ga0207671_10015547 | Ga0207671_100155477 | 241 |
| 430 | 3300025915 | Ga0207693_10002045 | Ga0207693_1000204516 | 241 |
| 431 | 3300025916 | Ga0207663_10011346 | Ga0207663_100113461 | 241 |
| 432 | 3300025919 | Ga0207657_10116159 | Ga0207657_101161593 | 241 |
| 433 | 3300025925 | Ga0207650_10168498 | Ga0207650_101684983 | 241 |
| 434 | 3300025927 | Ga0207687_10000192 | Ga0207687_1000019233 | 241 |
| 435 | 3300025929 | Ga0207664_10113234 | Ga0207664_101132343 | 241 |
| 436 | 3300025929 | Ga0207664_10485016 | Ga0207664_104850162 | 241 |
| 437 | 3300025931 | Ga0207644_10035309 | Ga0207644_100353094 | 241 |
| 438 | 3300025931 | Ga0207644_10209552 | Ga0207644_102095521 | 241 |
| 439 | 3300025932 | Ga0207690_10006095 | Ga0207690_100060954 | 241 |
| 440 | 3300025933 | Ga0207706_10050314 | Ga0207706_100503141 | 241 |
| 441 | 3300025934 | Ga0207686_10000761 | Ga0207686_1000076117 | 241 |
| 442 | 3300025935 | Ga0207709_10003124 | Ga0207709_1000312411 | 241 |
| 443 | 3300025937 | Ga0207669_10000794 | Ga0207669_100007948 | 241 |
| 444 | 3300025938 | Ga0207704_10001730 | Ga0207704_100017305 | 241 |
| 445 | 3300025939 | Ga0207665_10002960 | Ga0207665_100029604 | 241 |
| 446 | 3300025941 | Ga0207711_10005647 | Ga0207711_100056476 | 241 |
| 447 | 3300025942 | Ga0207689_10106862 | Ga0207689_101068622 | 241 |
| 448 | 3300025949 | Ga0207667_10215304 | Ga0207667_102153043 | 241 |
| 449 | 3300025961 | Ga0207712_10007913 | Ga0207712_100079133 | 241 |
| 450 | 3300025961 | Ga0207712_10409967 | Ga0207712_104099672 | 241 |
| 451 | 3300025972 | Ga0207668_10001297 | Ga0207668_100012978 | 241 |
| 452 | 3300025972 | Ga0207668_10441699 | Ga0207668_104416991 | 241 |
| 453 | 3300025981 | Ga0207640_10001367 | Ga0207640_100013678 | 241 |
| 454 | 3300025986 | Ga0207658_10001438 | Ga0207658_1000143810 | 241 |
| 455 | 3300025986 | Ga0207658_10028827 | Ga0207658_100288275 | 241 |
| 456 | 3300026023 | Ga0207677_10002641 | Ga0207677_100026416 | 241 |
| 457 | 3300026035 | Ga0207703_10002411 | Ga0207703_1000241111 | 241 |
| 458 | 3300026041 | Ga0207639_10001924 | Ga0207639_1000192414 | 241 |
| 459 | 3300026041 | Ga0207639_10333285 | Ga0207639_103332852 | 241 |
| 460 | 3300026067 | Ga0207678_10046342 | Ga0207678_100463423 | 241 |
| 461 | 3300026075 | Ga0207708_10000587 | Ga0207708_1000058721 | 241 |
| 462 | 3300026078 | Ga0207702_10192627 | Ga0207702_101926272 | 241 |
| 463 | 3300026088 | Ga0207641_10012640 | Ga0207641_100126403 | 241 |
| 464 | 3300026089 | Ga0207648_10001309 | Ga0207648_1000130912 | 241 |
| 465 | 3300026118 | Ga0207675_100001516 | Ga0207675_1000015169 | 241 |
| 466 | 3300026121 | Ga0207683_10000275 | Ga0207683_1000027516 | 241 |
| 467 | 3300028379 | Ga0268266_10021095 | Ga0268266_100210955 | 241 |
| 468 | 3300028379 | Ga0268266_10091359 | Ga0268266_100913592 | 241 |
| 469 | 3300028380 | Ga0268265_10002946 | Ga0268265_100029468 | 241 |
| 470 | 3300028381 | Ga0268264_10004702 | Ga0268264_100047026 | 241 |
| 471 | 3300031731 | Ga0307405_10516291 | Ga0307405_105162911 | 241 |
| 472 | 3300031824 | Ga0307413_10010210 | Ga0307413_100102104 | 241 |
| 473 | 3300031852 | Ga0307410_10067917 | Ga0307410_100679172 | 241 |
| 474 | 3300031903 | Ga0307407_10243881 | Ga0307407_102438811 | 241 |
| 475 | 3300031995 | Ga0307409_100144777 | Ga0307409_1001447772 | 241 |
| 476 | 3300031995 | Ga0307409_100226586 | Ga0307409_1002265862 | 241 |
| 477 | 3300032005 | Ga0307411_10057291 | Ga0307411_100572913 | 241 |
| 478 | 3300032126 | Ga0307415_100038996 | Ga0307415_1000389961 | 241 |
| 479 | 3300035114 | Ga0373939_0139759 | Ga0373939_0139759_97_822 | 241 |
| 480 | 3300035207 | Ga0373942_0039190 | Ga0373942_0039190_431_1156 | 241 |
| 481 | 3300041411 | Ga0439466_0027114 | Ga0439466_0027114_852_1577 | 241 |
| 482 | 3300041413 | Ga0439465_0002533 | Ga0439465_0002533_4223_4957 | 241 |
| 483 | 3300041413 | Ga0439465_0003858 | Ga0439465_0003858_2188_2913 | 241 |
| 484 | 3300042002 | Ga0439442_041894 | Ga0439442_041894_153_878 | 241 |
| 485 | 3300044658 | Ga0466972_0004630 | Ga0466972_0004630_59_784 | 241 |
| 486 | 3300044658 | Ga0466972_0005419 | Ga0466972_0005419_1704_2429 | 241 |
| 487 | 3300044658 | Ga0466972_0018036 | Ga0466972_0018036_1820_2545 | 241 |
| 488 | 3300044658 | Ga0466972_0052643 | Ga0466972_0052643_549_1274 | 241 |
| 489 | 3300044683 | Ga0466965_0007161 | Ga0466965_0007161_1141_1866 | 241 |
| 490 | 3300044706 | Ga0466964_0044042 | Ga0466964_0044042_31_756 | 241 |
| 491 | 3300044735 | Ga0466968_0011608 | Ga0466968_0011608_316_1041 | 241 |
| 492 | 3300044765 | Ga0466970_0267114 | Ga0466970_0267114_184_909 | 241 |
| 493 | 3300044842 | Ga0466957_0070327 | Ga0466957_0070327_832_1557 | 241 |
| 494 | 3300044842 | Ga0466957_0071835 | Ga0466957_0071835_1279_2004 | 241 |
| 495 | 3300044901 | Ga0466960_0002318 | Ga0466960_0002318_1465_2190 | 241 |
| 496 | 3300044901 | Ga0466960_0067075 | Ga0466960_0067075_249_974 | 241 |
| 497 | 3300044901 | Ga0466960_0215671 | Ga0466960_0215671_215_940 | 241 |
| 498 | 3300045049 | Ga0466959_0091046 | Ga0466959_0091046_1178_1903 | 241 |
| 499 | 3300045976 | Ga0466967_0009722 | Ga0466967_0009722_3471_4196 | 241 |
| 500 | 3300045976 | Ga0466967_0132359 | Ga0466967_0132359_148_873 | 241 |
| 501 | 3300045976 | Ga0466967_0161616 | Ga0466967_0161616_1035_1760 | 241 |
| 502 | 3300047320 | Ga0495672_0036289 | Ga0495672_0036289_1215_1940 | 241 |
| 503 | 3300047472 | Ga0495686_0001444 | Ga0495686_0001444_1401_2138 | 241 |
| 504 | 3300048903 | Ga0496100_0002214 | Ga0496100_0002214_4173_4898 | 241 |
| 505 | 3300048903 | Ga0496100_0379933 | Ga0496100_0379933_173_898 | 241 |
| 506 | 3300048904 | Ga0496101_0145363 | Ga0496101_0145363_892_1617 | 241 |
| 507 | 3300048905 | Ga0496102_0000873 | Ga0496102_0000873_14583_15308 | 241 |
| 508 | 3300048905 | Ga0496102_0003346 | Ga0496102_0003346_9979_10704 | 241 |
| 509 | 3300048906 | Ga0496103_0000494 | Ga0496103_0000494_21848_22573 | 241 |
| 510 | 3300048906 | Ga0496103_0166141 | Ga0496103_0166141_271_996 | 241 |
| 511 | 3300048906 | Ga0496103_0258352 | Ga0496103_0258352_330_1055 | 241 |
| 512 | 3300048907 | Ga0496104_0033219 | Ga0496104_0033219_12_737 | 241 |
| 513 | 3300048909 | Ga0496106_0002689 | Ga0496106_0002689_6339_7064 | 241 |
| 514 | 3300048910 | Ga0496107_0000580 | Ga0496107_0000580_10776_11501 | 241 |
| 515 | 3300048911 | Ga0496108_0061619 | Ga0496108_0061619_768_1493 | 241 |
| 516 | 3300048912 | Ga0496109_0217850 | Ga0496109_0217850_351_1076 | 241 |
| 517 | 3300048913 | Ga0496110_0097530 | Ga0496110_0097530_1899_2624 | 241 |
| 518 | 3300048913 | Ga0496110_0230507 | Ga0496110_0230507_290_1015 | 241 |
| 519 | 3300048914 | Ga0496111_0264904 | Ga0496111_0264904_518_1243 | 241 |
| 520 | 3300048915 | Ga0496112_0003504 | Ga0496112_0003504_11692_12417 | 241 |
| 521 | 3300048916 | Ga0496113_0003388 | Ga0496113_0003388_7883_8608 | 241 |
| 522 | 3300048917 | Ga0496114_0000360 | Ga0496114_0000360_21470_22195 | 241 |
| 523 | 3300048918 | Ga0496115_0007831 | Ga0496115_0007831_3905_4630 | 241 |
| 524 | 3300048928 | Ga0496125_0253074 | Ga0496125_0253074_29_754 | 241 |
| 525 | 3300049579 | Ga0501043_0191932 | Ga0501043_0191932_800_1552 | 241 |
| 526 | 3300049586 | Ga0501070_0028310 | Ga0501070_0028310_2078_2803 | 241 |
| 527 | 3300049742 | Ga0501080_0722631 | Ga0501080_0722631_112_837 | 241 |
| 528 | 3300049823 | Ga0501044_0020469 | Ga0501044_0020469_1243_2010 | 241 |
| 529 | 3300050490 | nmdc:mga03n38_21120_c1 | nmdc:mga03n38_21120_c1_1833_2558 | 241 |
| 530 | 3300050490 | nmdc:mga03n38_33302_c1 | nmdc:mga03n38_33302_c1_700_1425 | 241 |
| 531 | 3300050490 | nmdc:mga03n38_39120_c1 | nmdc:mga03n38_39120_c1_853_1578 | 241 |
| 532 | 3300050490 | nmdc:mga03n38_41360_c1 | nmdc:mga03n38_41360_c1_1089_1814 | 241 |
| 533 | 3300050490 | nmdc:mga03n38_76143_c1 | nmdc:mga03n38_76143_c1_695_1420 | 241 |
| 534 | 3300050491 | nmdc:mga00v17_315556_c1 | nmdc:mga00v17_315556_c1_147_872 | 241 |
| 535 | 3300050491 | nmdc:mga00v17_33592_c1 | nmdc:mga00v17_33592_c1_1872_2597 | 241 |
| 536 | 3300050494 | nmdc:mga06z11_126914_c1 | nmdc:mga06z11_126914_c1_110_835 | 241 |
| 537 | 3300050494 | nmdc:mga06z11_190145_c1 | nmdc:mga06z11_190145_c1_208_933 | 241 |
| 538 | 3300050495 | nmdc:mga04h51_25363_c1 | nmdc:mga04h51_25363_c1_29_754 | 241 |
| 539 | 3300050496 | nmdc:mga07m45_13863_c1 | nmdc:mga07m45_13863_c1_3469_4194 | 241 |
| 540 | 3300050496 | nmdc:mga07m45_2227_c1 | nmdc:mga07m45_2227_c1_6046_6771 | 241 |
| 541 | 3300050496 | nmdc:mga07m45_9068_c1 | nmdc:mga07m45_9068_c1_141_866 | 241 |
| 542 | 3300050507 | nmdc:mga05p37_12562_c1 | nmdc:mga05p37_12562_c1_6697_7422 | 241 |
| 543 | 3300050509 | nmdc:mga0qj67_63808_c1 | nmdc:mga0qj67_63808_c1_1368_2093 | 241 |
| 544 | 3300050510 | nmdc:mga06r32_95413_c1 | nmdc:mga06r32_95413_c1_1997_2722 | 241 |
| 545 | 3300050516 | nmdc:mga0sz30_16615_c1 | nmdc:mga0sz30_16615_c1_1633_2358 | 241 |
| 546 | 3300050516 | nmdc:mga0sz30_187649_c1 | nmdc:mga0sz30_187649_c1_128_853 | 241 |
| 547 | 3300050516 | nmdc:mga0sz30_52021_c1 | nmdc:mga0sz30_52021_c1_261_986 | 241 |
| 548 | 3300044684 | Ga0466966_0051115 | Ga0466966_0051115_1818_2582 | 242 |
| 549 | 3300044693 | Ga0466961_0118247 | Ga0466961_0118247_661_1425 | 242 |
| 550 | 3300044693 | Ga0466961_0207690 | Ga0466961_0207690_195_959 | 242 |
| 551 | 3300044842 | Ga0466957_0037442 | Ga0466957_0037442_1553_2317 | 242 |
| 552 | 3300044901 | Ga0466960_0235860 | Ga0466960_0235860_56_820 | 242 |
| 553 | 3300045049 | Ga0466959_0155306 | Ga0466959_0155306_662_1426 | 242 |
| 554 | 3300045836 | Ga0466958_0174056 | Ga0466958_0174056_534_1298 | 242 |
| 555 | 3300049569 | Ga0501032_0001215 | Ga0501032_0001215_15453_16181 | 242 |
| 556 | 3300049571 | Ga0501034_0005626 | Ga0501034_0005626_12473_13201 | 242 |
| 557 | 3300049573 | Ga0501037_0000222 | Ga0501037_0000222_31559_32287 | 242 |
| 558 | 3300049574 | Ga0501038_0005120 | Ga0501038_0005120_3054_3782 | 242 |
| 559 | 3300049575 | Ga0501039_0006680 | Ga0501039_0006680_3397_4125 | 242 |
| 560 | 3300049579 | Ga0501043_0000225 | Ga0501043_0000225_35431_36159 | 242 |
| 561 | 3300049583 | Ga0501067_0063962 | Ga0501067_0063962_415_1143 | 242 |
| 562 | 3300049584 | Ga0501068_0062085 | Ga0501068_0062085_1353_2081 | 242 |
| 563 | 3300049586 | Ga0501070_0002172 | Ga0501070_0002172_6863_7591 | 242 |
| 564 | 3300049589 | Ga0501073_0067031 | Ga0501073_0067031_900_1628 | 242 |
| 565 | 3300049593 | Ga0501077_0113876 | Ga0501077_0113876_84_812 | 242 |
| 566 | 3300049823 | Ga0501044_0034660 | Ga0501044_0034660_3226_3954 | 242 |
| 567 | 3300061719 | Ga0466962_0157904 | Ga0466962_0157904_16_780 | 242 |
| 568 | 3300044693 | Ga0466961_0133963 | Ga0466961_0133963_381_1157 | 243 |
| 569 | 3300045049 | Ga0466959_0116419 | Ga0466959_0116419_939_1715 | 243 |
| 570 | 3300001991 | JGI24743J22301_10014965 | JGI24743J22301_100149652 | 244 |
| 571 | 3300002073 | JGI24745J21846_1003720 | JGI24745J21846_10037202 | 244 |
| 572 | 3300002077 | JGI24744J21845_10000009 | JGI24744J21845_100000091 | 244 |
| 573 | 3300005334 | Ga0068869_100016210 | Ga0068869_1000162104 | 244 |
| 574 | 3300005337 | Ga0070682_100055105 | Ga0070682_1000551052 | 244 |
| 575 | 3300005434 | Ga0070709_10077038 | Ga0070709_100770383 | 244 |
| 576 | 3300005437 | Ga0070710_10003776 | Ga0070710_100037762 | 244 |
| 577 | 3300005439 | Ga0070711_100045002 | Ga0070711_1000450022 | 244 |
| 578 | 3300005440 | Ga0070705_100098840 | Ga0070705_1000988402 | 244 |
| 579 | 3300005456 | Ga0070678_100163806 | Ga0070678_1001638061 | 244 |
| 580 | 3300005457 | Ga0070662_100161959 | Ga0070662_1001619593 | 244 |
| 581 | 3300005539 | Ga0068853_100173947 | Ga0068853_1001739472 | 244 |
| 582 | 3300005547 | Ga0070693_100075378 | Ga0070693_1000753782 | 244 |
| 583 | 3300005548 | Ga0070665_100045561 | Ga0070665_1000455615 | 244 |
| 584 | 3300005549 | Ga0070704_100699863 | Ga0070704_1006998632 | 244 |
| 585 | 3300005578 | Ga0068854_100072482 | Ga0068854_1000724821 | 244 |
| 586 | 3300005616 | Ga0068852_100045495 | Ga0068852_1000454954 | 244 |
| 587 | 3300005618 | Ga0068864_100161505 | Ga0068864_1001615052 | 244 |
| 588 | 3300005718 | Ga0068866_10047924 | Ga0068866_100479242 | 244 |
| 589 | 3300005719 | Ga0068861_100159822 | Ga0068861_1001598222 | 244 |
| 590 | 3300005843 | Ga0068860_100234542 | Ga0068860_1002345422 | 244 |
| 591 | 3300006163 | Ga0070715_10016250 | Ga0070715_100162502 | 244 |
| 592 | 3300006175 | Ga0070712_100064996 | Ga0070712_1000649963 | 244 |
| 593 | 3300006358 | Ga0068871_100027734 | Ga0068871_1000277346 | 244 |
| 594 | 3300009101 | Ga0105247_10013812 | Ga0105247_100138125 | 244 |
| 595 | 3300010159 | Ga0099796_10020316 | Ga0099796_100203163 | 244 |
| 596 | 3300013105 | Ga0157369_10527693 | Ga0157369_105276931 | 244 |
| 597 | 3300013296 | Ga0157374_10003900 | Ga0157374_1000390015 | 244 |
| 598 | 3300014745 | Ga0157377_10041674 | Ga0157377_100416742 | 244 |
| 599 | 3300014968 | Ga0157379_10012283 | Ga0157379_100122832 | 244 |
| 600 | 3300014969 | Ga0157376_10739286 | Ga0157376_107392861 | 244 |
| 601 | 3300025901 | Ga0207688_10056743 | Ga0207688_100567433 | 244 |
| 602 | 3300025903 | Ga0207680_10356756 | Ga0207680_103567561 | 244 |
| 603 | 3300025904 | Ga0207647_10014725 | Ga0207647_100147252 | 244 |
| 604 | 3300025905 | Ga0207685_10070113 | Ga0207685_100701132 | 244 |
| 605 | 3300025915 | Ga0207693_10000694 | Ga0207693_1000069421 | 244 |
| 606 | 3300025916 | Ga0207663_10032882 | Ga0207663_100328821 | 244 |
| 607 | 3300025923 | Ga0207681_10361613 | Ga0207681_103616132 | 244 |
| 608 | 3300025932 | Ga0207690_10324383 | Ga0207690_103243831 | 244 |
| 609 | 3300025933 | Ga0207706_10207358 | Ga0207706_102073583 | 244 |
| 610 | 3300025935 | Ga0207709_10352201 | Ga0207709_103522012 | 244 |
| 611 | 3300025936 | Ga0207670_10207166 | Ga0207670_102071662 | 244 |
| 612 | 3300025937 | Ga0207669_10034952 | Ga0207669_100349522 | 244 |
| 613 | 3300025938 | Ga0207704_10211349 | Ga0207704_102113492 | 244 |
| 614 | 3300025941 | Ga0207711_10490822 | Ga0207711_104908221 | 244 |
| 615 | 3300025942 | Ga0207689_10013622 | Ga0207689_100136226 | 244 |
| 616 | 3300025981 | Ga0207640_10086459 | Ga0207640_100864593 | 244 |
| 617 | 3300026023 | Ga0207677_10082201 | Ga0207677_100822012 | 244 |
| 618 | 3300026067 | Ga0207678_10006766 | Ga0207678_100067665 | 244 |
| 619 | 3300026088 | Ga0207641_10275978 | Ga0207641_102759782 | 244 |
| 620 | 3300026095 | Ga0207676_10038375 | Ga0207676_100383754 | 244 |
| 621 | 3300026118 | Ga0207675_100015385 | Ga0207675_1000153857 | 244 |
| 622 | 3300026118 | Ga0207675_100089981 | Ga0207675_1000899812 | 244 |
| 623 | 3300026121 | Ga0207683_10010271 | Ga0207683_100102712 | 244 |
| 624 | 3300032126 | Ga0307415_100457750 | Ga0307415_1004577502 | 244 |
| 625 | 3300035092 | Ga0373952_0014883 | Ga0373952_0014883_446_1180 | 244 |
| 626 | 3300035691 | Ga0373931_0010828 | Ga0373931_0010828_2988_3722 | 244 |
| 627 | 3300044656 | Ga0466969_0044608 | Ga0466969_0044608_1075_1812 | 244 |
| 628 | 3300044684 | Ga0466966_0002708 | Ga0466966_0002708_1060_1797 | 244 |
| 629 | 3300044693 | Ga0466961_0002435 | Ga0466961_0002435_1054_1791 | 244 |
| 630 | 3300044694 | Ga0466963_0021557 | Ga0466963_0021557_3259_3996 | 244 |
| 631 | 3300044842 | Ga0466957_0003131 | Ga0466957_0003131_4597_5334 | 244 |
| 632 | 3300044901 | Ga0466960_0052586 | Ga0466960_0052586_756_1529 | 244 |
| 633 | 3300045049 | Ga0466959_0038977 | Ga0466959_0038977_2343_3080 | 244 |
| 634 | 3300045836 | Ga0466958_0028446 | Ga0466958_0028446_2343_3080 | 244 |
| 635 | 3300048911 | Ga0496108_0000453 | Ga0496108_0000453_25423_26157 | 244 |
| 636 | 3300048912 | Ga0496109_0019637 | Ga0496109_0019637_4685_5419 | 244 |
| 637 | 3300048915 | Ga0496112_0167614 | Ga0496112_0167614_921_1655 | 244 |
| 638 | 3300048916 | Ga0496113_0079626 | Ga0496113_0079626_1010_1744 | 244 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5kym-assembly2.cif.gz_B | crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima | 0.7404 | 10 | 210 |
| 5kym-assembly1.cif.gz_A | crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima | 0.6895 | 10 | 203 |
| 1k30-assembly1.cif.gz_A | crystal structure analysis of squash (cucurbita moschata) glycerol-3-phosphate (1)-acyltransferase | 0.6726 | 3 | 204 |
| 1iuq-assembly1.cif.gz_A | the 1.55 a crystal structure of glycerol-3-phosphate acyltransferase | 0.6295 | 3 | 207 |
| 5kym-assembly2.cif.gz_B | crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima | 0.5962 | 10 | 210 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53516_20_152_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.9286 | 20 | 150 | 3.40.50.2000 |
| af_O53516_20_152_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.9085 | 20 | 150 | 3.40.50.2000 |
| af_Q2FXJ7_19_144_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.819 | 21 | 150 | 3.40.50.2000 |
| af_Q2FXJ7_19_144_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.7958 | 21 | 150 | 3.40.50.2000 |
| af_Q8GXU8_180_307_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.7915 | 24 | 150 | 3.40.50.2000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5C7N015-F1-model_v4 | 1-acyl-sn-glycerol-3-phosphate acyltransferase | 0.9525 | 1 | 211 |
GO:0003841
GO:0005886 GO:0006654 |
| AF-A0A5C7N015-F1-model_v4 | 1-acyl-sn-glycerol-3-phosphate acyltransferase | 0.9481 | 1 | 211 |
GO:0003841
GO:0005886 GO:0006654 |
| AF-A0A354XNP0-F1-model_v4 | deleted | 0.9391 | 1 | 205 |
|
| AF-A0A354XNP0-F1-model_v4 | deleted | 0.9347 | 1 | 205 |
|
| AF-A0A1C3P815-F1-model_v4 | Phospholipid/glycerol acyltransferase | 0.9333 | 1 | 214 |
GO:0003841
GO:0005886 GO:0006654 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar