F471498

General Info

Members Datasets Scaffolds Average Seq Length
638 320 625 268

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_100080768|Ga0068859_1000807685
Length 314
Sequence MTSVTKPRAATPTPDQITPATGFAGVAETALLEPAGRKPWRRALLKLWKRRGAMVGLAFVVFFVVLAVFAPWLSPQDPVATSWSAVRKAPSAAHWFGTDEIGRDVLSRVIWGARASLLAGLVSVGISLSVGVPLGLFAGYTGRWPDLLISRLTDALLACPFLILAIALAAFLGPSLTNAMVAIGVAATPIFIRLTRAQVLAVKLEDYVEAARAVGNSHVRIALRHVLPNVXXPIIVQATLAIAAAVIAEASLSFLGLGQQPPAPSWGSMLNTAKNYIENAPWMAVWPGLSIFLLVLSFNLLGDGLRDALDPRQG

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
3 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
4 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
5 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
6 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
7 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
8 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
9 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
10 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
11 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
123 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
125 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
185 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
186 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
187 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
188 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
189 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
190 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
191 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
192 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
193 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
194 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
195 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
196 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
197 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
198 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
199 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
200 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
201 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
202 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
203 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
205 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
206 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
207 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
208 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
209 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
210 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
211 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
212 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
213 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
214 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
215 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
217 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
218 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
219 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
222 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
223 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
224 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
225 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
226 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
227 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
228 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
229 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
230 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
231 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
232 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
233 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
234 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
235 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
236 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
237 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
238 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
239 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
240 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
241 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
242 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
243 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
244 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
245 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
246 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
247 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
248 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
249 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
250 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
251 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
252 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
253 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
254 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
255 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
256 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
257 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
258 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
259 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
260 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
261 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
262 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
263 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
264 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
265 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
266 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
267 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
268 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
269 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
270 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
271 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
272 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
273 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
274 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
275 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
276 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
277 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
278 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
279 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
280 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
281 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
282 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
283 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
284 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
285 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
286 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
287 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
296 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
297 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
298 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
299 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
300 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
302 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
303 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
304 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
305 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
306 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
307 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
308 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
309 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
310 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
311 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
312 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
313 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
314 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
315 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
316 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
317 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
318 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
319 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
320 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.96
Metatranscriptomes 0
Isolates 2.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.57
Nodule 0.16
Rhizoplane 2.66
Rhizosphere 93.89
Stem 0
Stem Tuber 0
Unclassified 1.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10003260 3300003203 Bacteria 7641
2 Ga0065165_1001592 3300005262 Bacteria 23308
3 Ga0070658_10031175 3300005327 Bacteria 4281
4 Ga0070658_10096029 3300005327 Bacteria 2447
5 Ga0070676_10002360 3300005328 Bacteria 9667
6 Ga0070683_100010121 3300005329 Bacteria 8092
7 Ga0070683_100205102 3300005329 Bacteria 1872
8 Ga0070690_100000758 3300005330 Bacteria 16523
9 Ga0070670_100005773 3300005331 Bacteria 10459
10 Ga0070670_100048071 3300005331 Bacteria 3672
11 Ga0070677_10162312 3300005333 Bacteria 1049
12 Ga0068869_100001116 3300005334 Bacteria 15641
13 Ga0068869_100001795 3300005334 Bacteria 12871
14 Ga0068869_100092721 3300005334 Bacteria 2274
15 Ga0070666_10017112 3300005335 Bacteria 4645
16 Ga0070680_100007592 3300005336 Bacteria 8272
17 Ga0070680_100466360 3300005336 Bacteria 1079
18 Ga0070682_100013702 3300005337 Bacteria 4673
19 Ga0068868_100042239 3300005338 Bacteria 3557
20 Ga0068868_100059252 3300005338 Bacteria 3028
21 Ga0070660_100005190 3300005339 Bacteria 9000
22 Ga0070660_100086433 3300005339 Bacteria 2467
23 Ga0070689_100002598 3300005340 Bacteria 11834
24 Ga0070689_100095961 3300005340 Bacteria 2343
25 Ga0070689_100168138 3300005340 Bacteria 1776
26 Ga0070691_10000694 3300005341 Bacteria 13130
27 Ga0070687_100007779 3300005343 Bacteria 4496
28 Ga0070661_100000659 3300005344 Bacteria 25350
29 Ga0070661_100072171 3300005344 Bacteria 2540
30 Ga0070661_100155182 3300005344 Bacteria 1732
31 Ga0070668_100049546 3300005347 Bacteria 3232
32 Ga0070669_100017827 3300005353 Bacteria 5068
33 Ga0070669_100443612 3300005353 Bacteria 1069
34 Ga0070671_100006686 3300005355 Bacteria 9221
35 Ga0070671_100057316 3300005355 Bacteria 3241
36 Ga0070671_100274570 3300005355 Bacteria 1433
37 Ga0070673_100020993 3300005364 Bacteria 4723
38 Ga0070673_100189630 3300005364 Bacteria 1765
39 Ga0070688_100002144 3300005365 Bacteria 9936
40 Ga0070688_100166294 3300005365 Bacteria 1519
41 Ga0070688_100236304 3300005365 Bacteria 1295
42 Ga0070659_100112321 3300005366 Bacteria 2200
43 Ga0070659_100228776 3300005366 Bacteria 1536
44 Ga0070667_100001779 3300005367 Bacteria 19196
45 Ga0070667_100210859 3300005367 Bacteria 1726
46 Ga0070709_10052822 3300005434 Bacteria 2556
47 Ga0070709_10072947 3300005434 Bacteria 2221
48 Ga0070709_10092584 3300005434 Bacteria 1997
49 Ga0070714_100003517 3300005435 Bacteria 11697
50 Ga0070714_100009908 3300005435 Bacteria 7515
51 Ga0070713_100000245 3300005436 Bacteria 35800
52 Ga0070713_100016747 3300005436 Bacteria 5519
53 Ga0070713_100025557 3300005436 Bacteria 4618
54 Ga0070713_100149844 3300005436 Bacteria 2074
55 Ga0070710_10043325 3300005437 Bacteria 2492
56 Ga0070701_10003369 3300005438 Bacteria 6315
57 Ga0070711_100027797 3300005439 Bacteria 3716
58 Ga0070705_100002078 3300005440 Bacteria 10221
59 Ga0070705_100005843 3300005440 Bacteria 6019
60 Ga0070705_100113820 3300005440 Bacteria 1734
61 Ga0070700_100004325 3300005441 Bacteria 7411
62 Ga0070700_100087074 3300005441 Bacteria 2030
63 Ga0070694_100001894 3300005444 Bacteria 12395
64 Ga0070694_100097568 3300005444 Bacteria 2073
65 Ga0070708_100028650 3300005445 Bacteria 4795
66 Ga0070708_100149757 3300005445 Bacteria 2169
67 Ga0070678_100007972 3300005456 Bacteria 6314
68 Ga0070678_100172493 3300005456 Bacteria 1763
69 Ga0070662_100005485 3300005457 Bacteria 8108
70 Ga0070681_10145961 3300005458 Bacteria 2295
71 Ga0068867_100005732 3300005459 Bacteria 8810
72 Ga0068867_100028185 3300005459 Bacteria 4042
73 Ga0070685_10000448 3300005466 Bacteria 23992
74 Ga0070706_100037877 3300005467 Bacteria 4452
75 Ga0070707_100367534 3300005468 Bacteria 1397
76 Ga0070699_100044652 3300005518 Bacteria 3836
77 Ga0070679_100027662 3300005530 Bacteria 5582
78 Ga0070679_100045246 3300005530 Bacteria 4387
79 Ga0070679_100052746 3300005530 Bacteria 4049
80 Ga0070679_100530988 3300005530 Bacteria 1120
81 Ga0070684_100016572 3300005535 Bacteria 6026
82 Ga0070697_100157407 3300005536 Bacteria 1918
83 Ga0068853_100013146 3300005539 Bacteria 6756
84 Ga0068853_100042965 3300005539 Bacteria 3866
85 Ga0068853_100195839 3300005539 Bacteria 1838
86 Ga0070672_100070832 3300005543 Bacteria 2772
87 Ga0070686_100002471 3300005544 Bacteria 10187
88 Ga0070686_100054878 3300005544 Bacteria 2550
89 Ga0070695_100003461 3300005545 Bacteria 9223
90 Ga0070695_100107440 3300005545 Bacteria 1888
91 Ga0070696_100002305 3300005546 Bacteria 12593
92 Ga0070696_100003044 3300005546 Bacteria 11138
93 Ga0070693_100001109 3300005547 Bacteria 12086
94 Ga0070693_100001266 3300005547 Bacteria 11435
95 Ga0070704_100003882 3300005549 Bacteria 8604
96 Ga0070704_100179606 3300005549 Bacteria 1691
97 Ga0068855_100006508 3300005563 Bacteria 14206
98 Ga0068855_100016235 3300005563 Bacteria 8954
99 Ga0068855_100017636 3300005563 Bacteria 8584
100 Ga0068855_100051761 3300005563 Bacteria 4837
101 Ga0068855_100073398 3300005563 Bacteria 3975
102 Ga0070664_100000157 3300005564 Bacteria 47128
103 Ga0070664_100211943 3300005564 Bacteria 1731
104 Ga0068857_100003114 3300005577 Bacteria 13726
105 Ga0068854_100001475 3300005578 Bacteria 14240
106 Ga0068854_100003215 3300005578 Bacteria 10192
107 Ga0068854_100022691 3300005578 Bacteria 4282
108 Ga0068856_100002108 3300005614 Bacteria 20635
109 Ga0068856_100379201 3300005614 Bacteria 1433
110 Ga0070702_100003013 3300005615 Bacteria 7447
111 Ga0070702_100190369 3300005615 Bacteria 1350
112 Ga0070702_100193765 3300005615 Bacteria 1339
113 Ga0068852_100001236 3300005616 Bacteria 17018
114 Ga0068852_100018602 3300005616 Bacteria 5475
115 Ga0068852_100024227 3300005616 Bacteria 4901
116 Ga0068852_100099422 3300005616 Bacteria 2622
117 Ga0068852_100166378 3300005616 Bacteria 2063
118 Ga0068852_100335603 3300005616 Bacteria 1472
119 Ga0068859_100001470 3300005617 Bacteria 24006
120 Ga0068859_100006424 3300005617 Bacteria 11926
121 Ga0068859_100046798 3300005617 Bacteria 4344
122 Ga0068859_100080768 3300005617 Bacteria 3293
123 Ga0068864_100000854 3300005618 Bacteria 25707
124 Ga0068864_100004243 3300005618 Bacteria 11795
125 Ga0068864_100022813 3300005618 Bacteria 5250
126 Ga0068866_10000959 3300005718 Bacteria 12686
127 Ga0068866_10068561 3300005718 Bacteria 1866
128 Ga0068861_100001299 3300005719 Bacteria 15627
129 Ga0068861_100001821 3300005719 Bacteria 13736
130 Ga0068861_100005158 3300005719 Bacteria 8814
131 Ga0068851_10026978 3300005834 Bacteria 2827
132 Ga0068851_10056578 3300005834 Bacteria 2001
133 Ga0068851_10145535 3300005834 Bacteria 1292
134 Ga0068870_10016278 3300005840 Bacteria 3549
135 Ga0068870_10122531 3300005840 Bacteria 1500
136 Ga0068863_100010525 3300005841 Bacteria 8981
137 Ga0068863_100010697 3300005841 Bacteria 8911
138 Ga0068863_100083294 3300005841 Bacteria 3031
139 Ga0068863_100104969 3300005841 Bacteria 2688
140 Ga0068858_100003231 3300005842 Bacteria 16256
141 Ga0068858_100004095 3300005842 Bacteria 14365
142 Ga0068858_100016904 3300005842 Bacteria 6850
143 Ga0068858_100022830 3300005842 Bacteria 5835
144 Ga0068860_100004201 3300005843 Bacteria 14760
145 Ga0068860_100005275 3300005843 Bacteria 13119
146 Ga0068860_100014167 3300005843 Bacteria 7820
147 Ga0068860_100155685 3300005843 Bacteria 2202
148 Ga0068862_100002444 3300005844 Bacteria 16490
149 Ga0068862_100076096 3300005844 Bacteria 2904
150 Ga0081539_10000259 3300005985 Bacteria 121997
151 Ga0070712_100006268 3300006175 Bacteria 7368
152 Ga0070712_100346605 3300006175 Bacteria 1214
153 Ga0075367_10190991 3300006178 Bacteria 1278
154 Ga0097621_100023572 3300006237 Bacteria 4793
155 Ga0097621_100026853 3300006237 Bacteria 4522
156 Ga0097621_100030851 3300006237 Bacteria 4247
157 Ga0097621_100152468 3300006237 Bacteria 1982
158 Ga0068871_100006330 3300006358 Bacteria 8365
159 Ga0068871_100053039 3300006358 Bacteria 3286
160 Ga0068871_100218732 3300006358 Bacteria 1649
161 Ga0068871_100336341 3300006358 Bacteria 1332
162 Ga0075428_100002197 3300006844 Bacteria 21099
163 Ga0075428_100004095 3300006844 Bacteria 16048
164 Ga0075433_10001178 3300006852 Bacteria 18995
165 Ga0075434_100000065 3300006871 Bacteria 54115
166 Ga0075434_100001217 3300006871 Bacteria 21379
167 Ga0075429_100004896 3300006880 Bacteria 11538
168 Ga0068865_100003091 3300006881 Bacteria 9960
169 Ga0068865_100004151 3300006881 Bacteria 8711
170 Ga0068865_100092953 3300006881 Bacteria 2192
171 Ga0068865_100195530 3300006881 Bacteria 1567
172 Ga0075436_100000205 3300006914 Bacteria 36621
173 Ga0075436_100003082 3300006914 Bacteria 11419
174 Ga0075436_100004957 3300006914 Bacteria 9151
175 Ga0075436_100010808 3300006914 Bacteria 6263
176 Ga0075436_100268977 3300006914 Bacteria 1217
177 Ga0097620_100001470 3300006931 Bacteria 24006
178 Ga0097620_100006424 3300006931 Bacteria 11926
179 Ga0097620_100046798 3300006931 Bacteria 4344
180 Ga0097620_100080769 3300006931 Bacteria 3293
181 Ga0075435_100000549 3300007076 Bacteria 23038
182 Ga0075435_100040049 3300007076 Bacteria 3741
183 Ga0099794_10235953 3300007265 Bacteria 942
184 Ga0105240_10001136 3300009093 Bacteria 46645
185 Ga0105240_10009467 3300009093 Bacteria 13793
186 Ga0105240_10015704 3300009093 Bacteria 10276
187 Ga0105240_10048926 3300009093 Bacteria 5341
188 Ga0105240_10113094 3300009093 Bacteria 3281
189 Ga0111539_10002089 3300009094 Bacteria 26701
190 Ga0105245_10000259 3300009098 Bacteria 50388
191 Ga0105245_10058242 3300009098 Bacteria 3477
192 Ga0105245_10067338 3300009098 Bacteria 3243
193 Ga0105245_10108480 3300009098 Bacteria 2578
194 Ga0105245_10189223 3300009098 Bacteria 1971
195 Ga0105245_10198774 3300009098 Bacteria 1924
196 Ga0105245_10404843 3300009098 Bacteria 1364
197 Ga0105247_10014150 3300009101 Bacteria 4786
198 Ga0105247_10031558 3300009101 Bacteria 3215
199 Ga0114129_10320646 3300009147 Bacteria 2060
200 Ga0105243_10004311 3300009148 Bacteria 11260
201 Ga0105243_10042561 3300009148 Bacteria 3556
202 Ga0105243_10046246 3300009148 Bacteria 3423
203 Ga0105243_10121867 3300009148 Bacteria 2200
204 Ga0105243_10350316 3300009148 Bacteria 1356
205 Ga0105241_10004693 3300009174 Bacteria 10089
206 Ga0105241_10055443 3300009174 Bacteria 3037
207 Ga0105241_10191479 3300009174 Bacteria 1703
208 Ga0105241_10326835 3300009174 Bacteria 1324
209 Ga0105242_10003634 3300009176 Bacteria 12007
210 Ga0105242_10012888 3300009176 Bacteria 6444
211 Ga0105248_10006620 3300009177 Bacteria 12697
212 Ga0105248_10247854 3300009177 Bacteria 2005
213 Ga0105248_10327962 3300009177 Bacteria 1724
214 Ga0105237_10041719 3300009545 Bacteria 4627
215 Ga0105238_10000203 3300009551 Bacteria 65825
216 Ga0105238_10056938 3300009551 Bacteria 3921
217 Ga0105238_10299634 3300009551 Bacteria 1591
218 Ga0105238_10328759 3300009551 Bacteria 1515
219 Ga0105249_10003563 3300009553 Bacteria 13472
220 Ga0105239_10331299 3300010375 Bacteria 1717
221 Ga0105239_10607546 3300010375 Bacteria 1248
222 Ga0105239_10610787 3300010375 Bacteria 1244
223 Ga0157371_10090273 3300013102 Bacteria 2171
224 Ga0157370_10057443 3300013104 Bacteria 3700
225 Ga0157369_10005296 3300013105 Bacteria 15032
226 Ga0157369_10102335 3300013105 Bacteria 3052
227 Ga0157374_10000569 3300013296 Bacteria 32720
228 Ga0157374_10260731 3300013296 Bacteria 1707
229 Ga0157374_10479420 3300013296 Bacteria 1247
230 Ga0157378_10002071 3300013297 Bacteria 17952
231 Ga0157378_10007333 3300013297 Bacteria 9633
232 Ga0157378_10074140 3300013297 Bacteria 3062
233 Ga0157378_10293819 3300013297 Bacteria 1570
234 Ga0163162_10150317 3300013306 Bacteria 2446
235 Ga0163162_10205008 3300013306 Bacteria 2101
236 Ga0163162_10396723 3300013306 Bacteria 1512
237 Ga0157372_10003769 3300013307 Bacteria 16282
238 Ga0157372_10004219 3300013307 Bacteria 15376
239 Ga0157372_10518955 3300013307 Bacteria 1389
240 Ga0157375_10042896 3300013308 Bacteria 4382
241 Ga0163163_10031354 3300014325 Bacteria 5130
242 Ga0163163_10206317 3300014325 Bacteria 2014
243 Ga0163163_10391932 3300014325 Bacteria 1447
244 Ga0157380_10091197 3300014326 Bacteria 2515
245 Ga0157380_10141298 3300014326 Bacteria 2069
246 Ga0182008_10056180 3300014497 Bacteria 1946
247 Ga0157379_10001798 3300014968 Bacteria 17673
248 Ga0157379_10010180 3300014968 Bacteria 8192
249 Ga0157379_10041206 3300014968 Bacteria 4123
250 Ga0157379_10172794 3300014968 Bacteria 1950
251 Ga0157376_10007668 3300014969 Bacteria 7728
252 Ga0157376_10139434 3300014969 Bacteria 2173
253 Ga0157376_10256005 3300014969 Bacteria 1637
254 Ga0163161_10078847 3300017792 Bacteria 2421
255 Ga0163161_10215238 3300017792 Bacteria 1486
256 Ga0213871_10013985 3300021441 Bacteria 1896
257 Ga0209673_1004167 3300025273 Bacteria 7905
258 Ga0209130_1022409 3300025284 Bacteria 1410
259 Ga0207656_10077202 3300025321 Bacteria 1491
260 Ga0207692_10005600 3300025898 Bacteria 5042
261 Ga0207710_10024820 3300025900 Bacteria 2584
262 Ga0207688_10040709 3300025901 Bacteria 2583
263 Ga0207688_10211807 3300025901 Bacteria 1164
264 Ga0207680_10077051 3300025903 Bacteria 2084
265 Ga0207699_10042304 3300025906 Bacteria 2638
266 Ga0207699_10059978 3300025906 Bacteria 2282
267 Ga0207645_10020661 3300025907 Bacteria 4306
268 Ga0207705_10123185 3300025909 Bacteria 1925
269 Ga0207684_10171613 3300025910 Bacteria 1869
270 Ga0207654_10058906 3300025911 Bacteria 2238
271 Ga0207707_10069557 3300025912 Bacteria 3068
272 Ga0207707_10148398 3300025912 Bacteria 2050
273 Ga0207695_10024731 3300025913 Bacteria 6745
274 Ga0207695_10034455 3300025913 Bacteria 5506
275 Ga0207695_10042211 3300025913 Bacteria 4875
276 Ga0207695_10053153 3300025913 Bacteria 4238
277 Ga0207671_10190939 3300025914 Bacteria 1597
278 Ga0207693_10000075 3300025915 Bacteria 88428
279 Ga0207693_10001554 3300025915 Bacteria 20275
280 Ga0207693_10255815 3300025915 Bacteria 1374
281 Ga0207663_10002965 3300025916 Bacteria 8209
282 Ga0207663_10020999 3300025916 Bacteria 3709
283 Ga0207663_10071494 3300025916 Bacteria 2239
284 Ga0207660_10005344 3300025917 Bacteria 8344
285 Ga0207662_10000106 3300025918 Bacteria 40137
286 Ga0207662_10233157 3300025918 Bacteria 1203
287 Ga0207657_10010554 3300025919 Bacteria 9210
288 Ga0207652_10021349 3300025921 Bacteria 5345
289 Ga0207652_10024991 3300025921 Bacteria 4961
290 Ga0207652_10198398 3300025921 Bacteria 1806
291 Ga0207646_10325852 3300025922 Bacteria 1388
292 Ga0207681_10046892 3300025923 Bacteria 2908
293 Ga0207681_10067542 3300025923 Bacteria 2479
294 Ga0207681_10096479 3300025923 Bacteria 2123
295 Ga0207694_10010215 3300025924 Bacteria 7078
296 Ga0207694_10080531 3300025924 Bacteria 2556
297 Ga0207694_10292142 3300025924 Bacteria 1341
298 Ga0207650_10002704 3300025925 Bacteria 12244
299 Ga0207650_10003970 3300025925 Bacteria 10126
300 Ga0207650_10017333 3300025925 Bacteria 5041
301 Ga0207659_10004187 3300025926 Bacteria 8711
302 Ga0207659_10110902 3300025926 Bacteria 2085
303 Ga0207659_10183670 3300025926 Bacteria 1659
304 Ga0207687_10013013 3300025927 Bacteria 5435
305 Ga0207687_10013670 3300025927 Bacteria 5300
306 Ga0207687_10028354 3300025927 Bacteria 3762
307 Ga0207687_10060485 3300025927 Bacteria 2672
308 Ga0207687_10071198 3300025927 Bacteria 2484
309 Ga0207700_10000182 3300025928 Bacteria 37846
310 Ga0207700_10207399 3300025928 Bacteria 1655
311 Ga0207664_10011875 3300025929 Bacteria 6213
312 Ga0207664_10019166 3300025929 Bacteria 5052
313 Ga0207644_10032208 3300025931 Bacteria 3655
314 Ga0207706_10017469 3300025933 Bacteria 6465
315 Ga0207686_10000195 3300025934 Bacteria 47027
316 Ga0207686_10005506 3300025934 Bacteria 6796
317 Ga0207686_10124526 3300025934 Bacteria 1759
318 Ga0207709_10002789 3300025935 Bacteria 10758
319 Ga0207709_10078074 3300025935 Bacteria 2124
320 Ga0207709_10125493 3300025935 Bacteria 1740
321 Ga0207670_10007642 3300025936 Bacteria 6051
322 Ga0207670_10023793 3300025936 Bacteria 3818
323 Ga0207670_10057827 3300025936 Bacteria 2632
324 Ga0207670_10156552 3300025936 Bacteria 1697
325 Ga0207670_10399836 3300025936 Bacteria 1098
326 Ga0207669_10330695 3300025937 Bacteria 1170
327 Ga0207704_10002100 3300025938 Bacteria 8926
328 Ga0207704_10007178 3300025938 Bacteria 5245
329 Ga0207691_10062120 3300025940 Bacteria 3391
330 Ga0207691_10076321 3300025940 Bacteria 3020
331 Ga0207711_10000092 3300025941 Bacteria 95507
332 Ga0207711_10151572 3300025941 Bacteria 2092
333 Ga0207689_10002122 3300025942 Bacteria 18651
334 Ga0207689_10004637 3300025942 Bacteria 12436
335 Ga0207689_10014709 3300025942 Bacteria 6645
336 Ga0207689_10148350 3300025942 Bacteria 1933
337 Ga0207689_10202626 3300025942 Bacteria 1638
338 Ga0207661_10062617 3300025944 Bacteria 3010
339 Ga0207667_10008844 3300025949 Bacteria 11919
340 Ga0207667_10023786 3300025949 Bacteria 6742
341 Ga0207667_10052223 3300025949 Bacteria 4306
342 Ga0207667_10077282 3300025949 Bacteria 3453
343 Ga0207667_10276358 3300025949 Bacteria 1717
344 Ga0207651_10064128 3300025960 Bacteria 2569
345 Ga0207712_10006365 3300025961 Bacteria 7452
346 Ga0207712_10023826 3300025961 Bacteria 4045
347 Ga0207668_10029406 3300025972 Bacteria 3601
348 Ga0207640_10004437 3300025981 Bacteria 7612
349 Ga0207640_10030353 3300025981 Bacteria 3327
350 Ga0207640_10558986 3300025981 Bacteria 963
351 Ga0207658_10021671 3300025986 Bacteria 4464
352 Ga0207677_10000477 3300026023 Bacteria 26249
353 Ga0207677_10001868 3300026023 Bacteria 11132
354 Ga0207677_10013156 3300026023 Bacteria 4784
355 Ga0207703_10000942 3300026035 Bacteria 28226
356 Ga0207703_10001714 3300026035 Bacteria 19689
357 Ga0207703_10003689 3300026035 Bacteria 12755
358 Ga0207703_10030057 3300026035 Bacteria 4291
359 Ga0207703_10048497 3300026035 Bacteria 3429
360 Ga0207703_10654143 3300026035 Bacteria 997
361 Ga0207639_10005827 3300026041 Bacteria 8345
362 Ga0207639_10095143 3300026041 Bacteria 2393
363 Ga0207708_10022592 3300026075 Bacteria 4750
364 Ga0207708_10134783 3300026075 Bacteria 1933
365 Ga0207702_10022972 3300026078 Bacteria 5174
366 Ga0207702_10050328 3300026078 Bacteria 3518
367 Ga0207702_10086936 3300026078 Bacteria 2727
368 Ga0207641_10006778 3300026088 Bacteria 9598
369 Ga0207641_10061930 3300026088 Bacteria 3191
370 Ga0207641_10191461 3300026088 Bacteria 1880
371 Ga0207648_10000432 3300026089 Bacteria 46265
372 Ga0207648_10005290 3300026089 Bacteria 13022
373 Ga0207676_10000097 3300026095 Bacteria 78464
374 Ga0207674_10006739 3300026116 Bacteria 13485
375 Ga0207674_10007170 3300026116 Bacteria 13019
376 Ga0207675_100003477 3300026118 Bacteria 15386
377 Ga0207675_100010235 3300026118 Bacteria 8789
378 Ga0207675_100012122 3300026118 Bacteria 8054
379 Ga0207675_100279452 3300026118 Bacteria 1622
380 Ga0207683_10004473 3300026121 Bacteria 12066
381 Ga0207683_10181180 3300026121 Bacteria 1910
382 Ga0207698_10000342 3300026142 Bacteria 27548
383 Ga0207698_10010169 3300026142 Bacteria 6029
384 Ga0207698_10031190 3300026142 Bacteria 3844
385 Ga0207698_10062549 3300026142 Bacteria 2907
386 Ga0207698_10065985 3300026142 Bacteria 2846
387 Ga0207698_10094591 3300026142 Bacteria 2457
388 Ga0207428_10005555 3300027907 Bacteria 11742
389 Ga0207428_10029949 3300027907 Bacteria 4502
390 Ga0268265_10003603 3300028380 Bacteria 11062
391 Ga0268265_10004946 3300028380 Bacteria 9159
392 Ga0268264_10002492 3300028381 Bacteria 16186
393 Ga0268264_10003797 3300028381 Bacteria 12956
394 Ga0268264_10005206 3300028381 Bacteria 11019
395 Ga0268264_10204893 3300028381 Bacteria 1807
396 Ga0268264_10711753 3300028381 Bacteria 998
397 Ga0307517_10173379 3300028786 Bacteria 1412
398 Ga0265327_10008541 3300031251 Bacteria 7605
399 Ga0307408_100153285 3300031548 Bacteria 1821
400 Ga0307405_10016367 3300031731 Bacteria 4043
401 Ga0307413_10025208 3300031824 Bacteria 3256
402 Ga0307410_10031132 3300031852 Bacteria 3419
403 Ga0307406_10011423 3300031901 Bacteria 5040
404 Ga0307407_10007454 3300031903 Bacteria 4957
405 Ga0307412_10009165 3300031911 Bacteria 5672
406 Ga0307416_100002319 3300032002 Bacteria 10879
407 Ga0307411_10124259 3300032005 Bacteria 1873
408 Ga0307415_100014674 3300032126 Bacteria 4615
409 Ga0307507_10032398 3300033179 Bacteria 5457
410 Ga0307507_10185535 3300033179 Bacteria 1476
411 Ga0307510_10017493 3300033180 Bacteria 8449
412 Ga0373938_0005198 3300034957 Bacteria 2206
413 Ga0373934_0012796 3300035086 Bacteria 3169
414 Ga0373940_0007438 3300035088 Bacteria 2473
415 Ga0373949_0015930 3300035090 Bacteria 1683
416 Ga0373952_0031600 3300035092 Bacteria 1178
417 Ga0373923_0001271 3300035111 Bacteria 7103
418 Ga0373923_0018240 3300035111 Bacteria 2698
419 Ga0373932_0003337 3300035112 Bacteria 3873
420 Ga0373936_0004217 3300035113 Bacteria 5422
421 Ga0373939_0006886 3300035114 Bacteria 2749
422 Ga0373941_0047079 3300035115 Bacteria 1357
423 Ga0373945_0058444 3300035116 Bacteria 1434
424 Ga0373953_0017685 3300035117 Bacteria 2625
425 Ga0373953_0031907 3300035117 Bacteria 2051
426 Ga0373954_0001687 3300035118 Bacteria 9061
427 Ga0373956_0057199 3300035119 Bacteria 1762
428 Ga0373957_0005960 3300035120 Bacteria 3813
429 Ga0373924_0002698 3300035410 Bacteria 5986
430 Ga0373924_0103964 3300035410 Bacteria 1223
431 Ga0373924_0118282 3300035410 Bacteria 1149
432 Ga0373931_0006196 3300035691 Bacteria 5579
433 Ga0373935_0015015 3300035692 Bacteria 4676
434 Ga0373935_0075107 3300035692 Bacteria 2186
435 Ga0373927_0004898 3300035695 Bacteria 9305
436 Ga0373927_0032587 3300035695 Bacteria 3394
437 Ga0373927_0043499 3300035695 Bacteria 2908
438 Ga0373927_0143418 3300035695 Bacteria 1563
439 Ga0373927_0210790 3300035695 Bacteria 1276
440 Ga0373933_0009864 3300035724 Bacteria 5228
441 Ga0373933_0068353 3300035724 Bacteria 2158
442 Ga0373933_0147412 3300035724 Bacteria 1489
443 Ga0373947_0015558 3300035725 Bacteria 4370
444 Ga0373937_0000617 3300036401 Bacteria 31286
445 Ga0373937_0009900 3300036401 Bacteria 8311
446 Ga0373937_0010116 3300036401 Bacteria 8227
447 Ga0373937_0026358 3300036401 Bacteria 5253
448 Ga0373937_0137954 3300036401 Bacteria 2281
449 Ga0373937_0174679 3300036401 Bacteria 2016
450 Ga0373937_0196366 3300036401 Bacteria 1897
451 Ga0373937_0203694 3300036401 Bacteria 1860
452 Ga0373937_0240721 3300036401 Bacteria 1705
453 Ga0373925_0001443 3300037068 Bacteria 20590
454 Ga0373925_0013522 3300037068 Bacteria 5908
455 Ga0373925_0019542 3300037068 Bacteria 4928
456 Ga0373925_0144755 3300037068 Bacteria 1862
457 Ga0373925_0152530 3300037068 Bacteria 1815
458 Ga0373925_0186762 3300037068 Bacteria 1643
459 Ga0373925_0228869 3300037068 Bacteria 1486
460 Ga0395899_0006274 3300037312 Bacteria 9203
461 Ga0395899_0281454 3300037312 Bacteria 1131
462 Ga0395900_0017926 3300037418 Bacteria 7227
463 Ga0395900_0032576 3300037418 Bacteria 5360
464 Ga0395900_0069470 3300037418 Bacteria 3620
465 Ga0395900_0367240 3300037418 Bacteria 1409
466 Ga0395898_0009885 3300037466 Bacteria 10002
467 Ga0395905_0013205 3300037471 Bacteria 7926
468 Ga0395905_0373351 3300037471 Bacteria 1320
469 Ga0395901_0157927 3300038443 Bacteria 2381
470 Ga0436365_1126210 3300039437 Bacteria 3397
471 Ga0436360_0943536 3300039438 Bacteria 1901
472 Ga0451789_1198229 3300041443 Bacteria 1085
473 Ga0439460_0031819 3300042461 Bacteria 1507
474 Ga0451577_0062496 3300042876 Bacteria 3321
475 Ga0451577_0099606 3300042876 Bacteria 2596
476 Ga0466972_0127299 3300044658 Bacteria 1200
477 Ga0453683_0002535 3300044673 Bacteria 14099
478 Ga0466965_0250933 3300044683 Bacteria 949
479 Ga0451576_0005623 3300045051 Bacteria 15652
480 Ga0451576_0265319 3300045051 Bacteria 1795
481 Ga0451576_0320252 3300045051 Bacteria 1622
482 Ga0495629_0111044 3300046459 Bacteria 1911
483 Ga0495629_0370319 3300046459 Bacteria 976
484 Ga0495651_0214143 3300046462 Bacteria 1338
485 Ga0495653_0041235 3300046463 Bacteria 3604
486 Ga0495653_0212882 3300046463 Bacteria 1304
487 Ga0495580_0022959 3300046472 Bacteria 4587
488 Ga0495580_0045319 3300046472 Bacteria 3124
489 Ga0495582_0007568 3300046473 Bacteria 6005
490 Ga0495582_0016966 3300046473 Bacteria 3987
491 Ga0495582_0071100 3300046473 Bacteria 1925
492 Ga0495639_0092210 3300046475 Bacteria 1422
493 Ga0495664_0003053 3300046477 Bacteria 9068
494 Ga0495664_0007319 3300046477 Bacteria 6126
495 Ga0495664_0101414 3300046477 Bacteria 1734
496 Ga0495608_0018027 3300046511 Bacteria 4877
497 Ga0495608_0024516 3300046511 Bacteria 4123
498 Ga0495608_0060111 3300046511 Bacteria 2501
499 Ga0495608_0164152 3300046511 Bacteria 1411
500 Ga0495618_0110079 3300046514 Bacteria 1764
501 Ga0495618_0186227 3300046514 Bacteria 1318
502 Ga0495618_0262736 3300046514 Bacteria 1081
503 Ga0495628_0071714 3300046516 Bacteria 2699
504 Ga0495628_0096061 3300046516 Bacteria 2290
505 Ga0495628_0228026 3300046516 Bacteria 1397
506 Ga0495628_0290812 3300046516 Bacteria 1211
507 Ga0495666_0013392 3300046526 Bacteria 4090
508 Ga0495652_0062389 3300046529 Bacteria 3143
509 Ga0495652_0137533 3300046529 Bacteria 1925
510 Ga0495652_0266012 3300046529 Bacteria 1263
511 Ga0495665_0008093 3300046531 Bacteria 5702
512 Ga0495640_0170817 3300046533 Bacteria 1389
513 Ga0495586_0009428 3300046535 Bacteria 5196
514 Ga0495587_0003341 3300046536 Bacteria 10703
515 Ga0495621_0004002 3300046539 Bacteria 4100
516 Ga0495645_0001840 3300046543 Bacteria 14412
517 Ga0495645_0002129 3300046543 Bacteria 13443
518 Ga0495667_0005117 3300046559 Bacteria 8859
519 Ga0495667_0266350 3300046559 Bacteria 1089
520 Ga0495634_0224160 3300046642 Bacteria 1159
521 Ga0495634_0233051 3300046642 Bacteria 1132
522 Ga0495635_0007041 3300046663 Bacteria 7858
523 Ga0495635_0047336 3300046663 Bacteria 2966
524 Ga0495659_0023080 3300046664 Bacteria 2111
525 Ga0495588_0052636 3300046674 Bacteria 2099
526 Ga0495657_0030305 3300046675 Bacteria 3791
527 Ga0495657_0182231 3300046675 Bacteria 1288
528 Ga0495599_0008663 3300046678 Bacteria 6190
529 Ga0495599_0036601 3300046678 Bacteria 3083
530 Ga0495623_0006686 3300046679 Bacteria 7503
531 Ga0495623_0019336 3300046679 Bacteria 4404
532 Ga0495623_0145446 3300046679 Bacteria 1406
533 Ga0495646_0007881 3300046680 Bacteria 6763
534 Ga0495646_0193073 3300046680 Bacteria 1112
535 Ga0495647_0000090 3300046681 Bacteria 22381
536 Ga0495647_0001373 3300046681 Bacteria 7513
537 Ga0495647_0065975 3300046681 Bacteria 1438
538 Ga0495658_0034842 3300046683 Bacteria 2764
539 Ga0495658_0042701 3300046683 Bacteria 2532
540 Ga0495613_0210490 3300046689 Bacteria 1368
541 Ga0495581_0083140 3300047315 Bacteria 1854
542 Ga0495604_0021483 3300047317 Bacteria 5153
543 Ga0495674_0258116 3300047319 Bacteria 1432
544 Ga0495676_0116064 3300047321 Bacteria 1956
545 Ga0495680_0146658 3300047322 Bacteria 1723
546 Ga0495680_0197139 3300047322 Bacteria 1446
547 Ga0495680_0240673 3300047322 Bacteria 1285
548 Ga0495675_0001066 3300047444 Bacteria 16664
549 Ga0495675_0076048 3300047444 Bacteria 2116
550 Ga0495675_0121505 3300047444 Bacteria 1626
551 Ga0495675_0131935 3300047444 Bacteria 1552
552 Ga0495681_0029983 3300047470 Bacteria 2777
553 Ga0495684_0022823 3300047471 Bacteria 4813
554 Ga0495684_0041179 3300047471 Bacteria 3540
555 Ga0495684_0057820 3300047471 Bacteria 2955
556 Ga0495593_0114237 3300047673 Bacteria 1377
557 Ga0495602_0000223 3300048088 Bacteria 52927
558 Ga0495602_0029198 3300048088 Bacteria 5260
559 Ga0495602_0073820 3300048088 Bacteria 2902
560 Ga0495602_0190070 3300048088 Bacteria 1575
561 Ga0496100_0012926 3300048903 Bacteria 4800
562 Ga0496101_0101900 3300048904 Bacteria 2150
563 Ga0496102_0046330 3300048905 Bacteria 3949
564 Ga0496104_0531076 3300048907 Bacteria 1087
565 Ga0496105_0013888 3300048908 Bacteria 6399
566 Ga0496105_0032134 3300048908 Bacteria 4306
567 Ga0496108_0034123 3300048911 Bacteria 4228
568 Ga0496108_0317920 3300048911 Bacteria 1357
569 Ga0496109_0037699 3300048912 Bacteria 4368
570 Ga0496109_0260485 3300048912 Bacteria 1633
571 Ga0496110_0169794 3300048913 Bacteria 1979
572 Ga0496111_0111208 3300048914 Bacteria 2018
573 Ga0496112_0001692 3300048915 Bacteria 17195
574 Ga0496112_0103601 3300048915 Bacteria 2816
575 Ga0496115_0007448 3300048918 Bacteria 8055
576 Ga0496115_0104555 3300048918 Bacteria 2324
577 Ga0496119_0016001 3300048922 Bacteria 5733
578 Ga0501034_0024597 3300049571 Bacteria 6126
579 Ga0501036_0212590 3300049572 Bacteria 1625
580 Ga0501038_0471173 3300049574 Bacteria 963
581 Ga0501039_0095895 3300049575 Bacteria 2313
582 Ga0501039_0362219 3300049575 Bacteria 1139
583 Ga0501041_0014368 3300049577 Bacteria 4701
584 Ga0501043_0051968 3300049579 Bacteria 3220
585 Ga0501046_0004878 3300049580 Bacteria 12085
586 Ga0501047_0048945 3300049581 Bacteria 4081
587 Ga0501047_0093104 3300049581 Bacteria 2893
588 Ga0501072_0003747 3300049588 Bacteria 11471
589 Ga0501072_0018302 3300049588 Bacteria 5392
590 Ga0501074_0138669 3300049590 Bacteria 1740
591 Ga0501075_0031987 3300049591 Bacteria 3908
592 Ga0501076_0000393 3300049592 Bacteria 27377
593 Ga0501080_0101510 3300049742 Bacteria 2669
594 Ga0501044_0245593 3300049823 Bacteria 1733
595 Ga0501044_0470233 3300049823 Bacteria 1161
596 Ga0501045_0002454 3300049824 Bacteria 12609
597 nmdc:mga05p37_5610_c1 3300050507 Bacteria 14749
598 nmdc:mga05p37_587852_c1 3300050507 Unclassified 1259
599 nmdc:mga09592_233661_c1 3300050508 Bacteria 1593
600 nmdc:mga09592_4157_c1 3300050508 Bacteria 11694
601 nmdc:mga08y16_5051_c1 3300050511 Bacteria 13793
602 nmdc:mga08y16_9559_c1 3300050511 Bacteria 10179
603 nmdc:mga0n895_193932_c1 3300050512 Bacteria 2062
604 nmdc:mga0n895_310158_c1 3300050512 Bacteria 1599
605 nmdc:mga0n895_84_c1 3300050512 Bacteria 54345
606 nmdc:mga0rr50_31298_c1 3300050513 Bacteria 3777
607 nmdc:mga0rr50_3216_c1 3300050513 Bacteria 9354
608 nmdc:mga08x19_2051_c1 3300050514 Bacteria 12350
609 nmdc:mga08x19_2433_c1 3300050514 Bacteria 11304
610 nmdc:mga08x19_2749_c1 3300050514 Bacteria 10627
611 nmdc:mga0a205_12231_c1 3300050515 Bacteria 7936
612 nmdc:mga0a205_1704_c1 3300050515 Bacteria 18985
613 nmdc:mga0a205_450508_c1 3300050515 Bacteria 1147
614 Ga0495601_0000430 3300053077 Bacteria 21991
615 Ga0495601_0021336 3300053077 Bacteria 3966
616 Ga0495612_0000708 3300053078 Bacteria 13528
617 Ga0495619_0012600 3300053085 Bacteria 5323
618 Ga0495619_0147561 3300053085 Bacteria 1622
619 Ga0500578_0000311 3300053086 Bacteria 59919
620 Ga0500566_0170858 3300053094 Bacteria 1124
621 Ga0500566_0182489 3300053094 Bacteria 1075
622 Ga0500593_000131 3300053117 Bacteria 29789
623 Ga0500645_000397 3300053730 Bacteria 30509
624 Ga0500661_000702 3300055283 Bacteria 6241
625 Ga0530510_0000048 3300061734 Bacteria 56268

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005334 Ga0068869_100092721 Ga0068869_1000927212 219
2 3300013308 Ga0157375_10042896 Ga0157375_100428963 220
3 3300044683 Ga0466965_0250933 Ga0466965_0250933_107_889 231
4 3300005331 Ga0070670_100048071 Ga0070670_1000480714 235
5 3300050512 nmdc:mga0n895_193932_c1 nmdc:mga0n895_193932_c1_987_1865 236
6 3300005355 Ga0070671_100057316 Ga0070671_1000573162 241
7 3300053094 Ga0500566_0182489 Ga0500566_0182489_128_1000 242
8 3300050515 nmdc:mga0a205_450508_c1 nmdc:mga0a205_450508_c1_48_854 243
9 3300053730 Ga0500645_000397 Ga0500645_000397_18244_19116 243
10 3300035088 Ga0373940_0007438 Ga0373940_0007438_1319_2128 244
11 3300035090 Ga0373949_0015930 Ga0373949_0015930_493_1302 244
12 3300035092 Ga0373952_0031600 Ga0373952_0031600_136_945 244
13 3300035112 Ga0373932_0003337 Ga0373932_0003337_572_1381 244
14 3300035115 Ga0373941_0047079 Ga0373941_0047079_505_1314 244
15 3300045051 Ga0451576_0320252 Ga0451576_0320252_441_1250 244
16 3300050513 nmdc:mga0rr50_3216_c1 nmdc:mga0rr50_3216_c1_8071_8880 244
17 3300050514 nmdc:mga08x19_2749_c1 nmdc:mga08x19_2749_c1_8851_9660 244
18 3300050515 nmdc:mga0a205_1704_c1 nmdc:mga0a205_1704_c1_4643_5452 244
19 3300025926 Ga0207659_10183670 Ga0207659_101836701 246
20 3300028786 Ga0307517_10173379 Ga0307517_101733792 246
21 3300010375 Ga0105239_10607546 Ga0105239_106075462 247
22 3300025916 Ga0207663_10071494 Ga0207663_100714942 247
23 3300035111 Ga0373923_0018240 Ga0373923_0018240_469_1311 247
24 3300036401 Ga0373937_0026358 Ga0373937_0026358_3993_4835 247
25 3300037068 Ga0373925_0228869 Ga0373925_0228869_623_1465 247
26 3300046462 Ga0495651_0214143 Ga0495651_0214143_119_961 247
27 3300046477 Ga0495664_0003053 Ga0495664_0003053_3854_4696 247
28 3300046511 Ga0495608_0060111 Ga0495608_0060111_354_1196 247
29 3300046529 Ga0495652_0062389 Ga0495652_0062389_732_1574 247
30 3300046533 Ga0495640_0170817 Ga0495640_0170817_305_1147 247
31 3300046536 Ga0495587_0003341 Ga0495587_0003341_9378_10220 247
32 3300046543 Ga0495645_0001840 Ga0495645_0001840_5305_6147 247
33 3300046663 Ga0495635_0047336 Ga0495635_0047336_1988_2830 247
34 3300046678 Ga0495599_0008663 Ga0495599_0008663_1031_1873 247
35 3300046679 Ga0495623_0145446 Ga0495623_0145446_393_1235 247
36 3300046680 Ga0495646_0007881 Ga0495646_0007881_2365_3207 247
37 3300047444 Ga0495675_0001066 Ga0495675_0001066_13611_14453 247
38 3300047471 Ga0495684_0057820 Ga0495684_0057820_10_852 247
39 3300048088 Ga0495602_0000223 Ga0495602_0000223_28952_29794 247
40 3300048088 Ga0495602_0190070 Ga0495602_0190070_719_1561 247
41 3300053077 Ga0495601_0000430 Ga0495601_0000430_8283_9125 247
42 3300053078 Ga0495612_0000708 Ga0495612_0000708_11819_12661 247
43 3300053085 Ga0495619_0147561 Ga0495619_0147561_160_1002 247
44 3300042876 Ga0451577_0062496 Ga0451577_0062496_1914_2768 248
45 3300005327 Ga0070658_10031175 Ga0070658_100311753 249
46 3300005563 Ga0068855_100017636 Ga0068855_1000176367 249
47 3300005616 Ga0068852_100018602 Ga0068852_1000186026 249
48 3300006178 Ga0075367_10190991 Ga0075367_101909911 249
49 3300009551 Ga0105238_10056938 Ga0105238_100569382 249
50 3300013105 Ga0157369_10005296 Ga0157369_100052966 249
51 3300013307 Ga0157372_10003769 Ga0157372_100037696 249
52 3300025924 Ga0207694_10010215 Ga0207694_100102153 249
53 3300025949 Ga0207667_10077282 Ga0207667_100772822 249
54 3300026035 Ga0207703_10654143 Ga0207703_106541431 249
55 3300026142 Ga0207698_10010169 Ga0207698_100101694 249
56 3300035692 Ga0373935_0075107 Ga0373935_0075107_1034_1858 249
57 3300035695 Ga0373927_0143418 Ga0373927_0143418_95_919 249
58 3300039437 Ga0436365_1126210 Ga0436365_1126210_2173_2997 249
59 3300005364 Ga0070673_100189630 Ga0070673_1001896302 250
60 3300009098 Ga0105245_10189223 Ga0105245_101892232 250
61 3300025942 Ga0207689_10202626 Ga0207689_102026262 250
62 3300031548 Ga0307408_100153285 Ga0307408_1001532852 250
63 3300031731 Ga0307405_10016367 Ga0307405_100163672 250
64 3300031824 Ga0307413_10025208 Ga0307413_100252081 250
65 3300031852 Ga0307410_10031132 Ga0307410_100311322 250
66 3300031901 Ga0307406_10011423 Ga0307406_100114231 250
67 3300031903 Ga0307407_10007454 Ga0307407_100074543 250
68 3300031911 Ga0307412_10009165 Ga0307412_100091658 250
69 3300032002 Ga0307416_100002319 Ga0307416_1000023191 250
70 3300032005 Ga0307411_10124259 Ga0307411_101242592 250
71 3300032126 Ga0307415_100014674 Ga0307415_1000146744 250
72 3300053086 Ga0500578_0000311 Ga0500578_0000311_34784_35662 250
73 3300053117 Ga0500593_000131 Ga0500593_000131_7284_8156 250
74 3300005262 Ga0065165_1001592 Ga0065165_100159223 251
75 3300006237 Ga0097621_100026853 Ga0097621_1000268532 251
76 3300006358 Ga0068871_100336341 Ga0068871_1003363412 251
77 3300009098 Ga0105245_10058242 Ga0105245_100582422 251
78 3300009098 Ga0105245_10404843 Ga0105245_104048432 251
79 3300009148 Ga0105243_10350316 Ga0105243_103503162 251
80 3300009176 Ga0105242_10012888 Ga0105242_100128883 251
81 3300009177 Ga0105248_10247854 Ga0105248_102478542 251
82 3300013296 Ga0157374_10260731 Ga0157374_102607312 251
83 3300013306 Ga0163162_10396723 Ga0163162_103967232 251
84 3300014325 Ga0163163_10391932 Ga0163163_103919322 251
85 3300014969 Ga0157376_10139434 Ga0157376_101394342 251
86 3300025273 Ga0209673_1004167 Ga0209673_10041678 251
87 3300025927 Ga0207687_10060485 Ga0207687_100604852 251
88 3300025934 Ga0207686_10124526 Ga0207686_101245262 251
89 3300035119 Ga0373956_0057199 Ga0373956_0057199_67_945 251
90 3300035724 Ga0373933_0068353 Ga0373933_0068353_368_1246 251
91 3300036401 Ga0373937_0010116 Ga0373937_0010116_4430_5308 251
92 3300046463 Ga0495653_0041235 Ga0495653_0041235_86_964 251
93 3300046477 Ga0495664_0101414 Ga0495664_0101414_630_1508 251
94 3300046511 Ga0495608_0018027 Ga0495608_0018027_3635_4513 251
95 3300046516 Ga0495628_0071714 Ga0495628_0071714_586_1464 251
96 3300046529 Ga0495652_0137533 Ga0495652_0137533_502_1380 251
97 3300046543 Ga0495645_0002129 Ga0495645_0002129_7225_8103 251
98 3300046642 Ga0495634_0224160 Ga0495634_0224160_47_925 251
99 3300046675 Ga0495657_0030305 Ga0495657_0030305_275_1153 251
100 3300046678 Ga0495599_0036601 Ga0495599_0036601_367_1245 251
101 3300046679 Ga0495623_0006686 Ga0495623_0006686_561_1439 251
102 3300046680 Ga0495646_0193073 Ga0495646_0193073_219_1097 251
103 3300047322 Ga0495680_0146658 Ga0495680_0146658_774_1652 251
104 3300047444 Ga0495675_0131935 Ga0495675_0131935_425_1303 251
105 3300047471 Ga0495684_0022823 Ga0495684_0022823_1162_2040 251
106 3300048088 Ga0495602_0029198 Ga0495602_0029198_2654_3532 251
107 3300053077 Ga0495601_0021336 Ga0495601_0021336_351_1229 251
108 3300053085 Ga0495619_0012600 Ga0495619_0012600_511_1389 251
109 3300005336 Ga0070680_100466360 Ga0070680_1004663601 252
110 3300005344 Ga0070661_100155182 Ga0070661_1001551822 252
111 3300025284 Ga0209130_1022409 Ga0209130_10224092 252
112 3300025928 Ga0207700_10207399 Ga0207700_102073992 252
113 3300041443 Ga0451789_1198229 Ga0451789_1198229_15_893 252
114 3300005333 Ga0070677_10162312 Ga0070677_101623121 253
115 3300013102 Ga0157371_10090273 Ga0157371_100902732 253
116 3300035695 Ga0373927_0032587 Ga0373927_0032587_933_1811 253
117 3300035695 Ga0373927_0043499 Ga0373927_0043499_731_1624 253
118 3300035724 Ga0373933_0147412 Ga0373933_0147412_64_951 253
119 3300036401 Ga0373937_0137954 Ga0373937_0137954_866_1753 253
120 3300037068 Ga0373925_0152530 Ga0373925_0152530_870_1748 253
121 3300005366 Ga0070659_100228776 Ga0070659_1002287762 255
122 3300005441 Ga0070700_100087074 Ga0070700_1000870742 255
123 3300005445 Ga0070708_100028650 Ga0070708_1000286501 255
124 3300005456 Ga0070678_100172493 Ga0070678_1001724932 255
125 3300005457 Ga0070662_100005485 Ga0070662_1000054858 255
126 3300005459 Ga0068867_100028185 Ga0068867_1000281854 255
127 3300005563 Ga0068855_100051761 Ga0068855_1000517612 255
128 3300005616 Ga0068852_100335603 Ga0068852_1003356032 255
129 3300005718 Ga0068866_10068561 Ga0068866_100685612 255
130 3300005719 Ga0068861_100005158 Ga0068861_10000515810 255
131 3300005842 Ga0068858_100022830 Ga0068858_10002283010 255
132 3300005843 Ga0068860_100004201 Ga0068860_10000420110 255
133 3300006881 Ga0068865_100003091 Ga0068865_10000309112 255
134 3300009093 Ga0105240_10009467 Ga0105240_100094672 255
135 3300009148 Ga0105243_10046246 Ga0105243_100462464 255
136 3300013297 Ga0157378_10002071 Ga0157378_1000207115 255
137 3300014326 Ga0157380_10091197 Ga0157380_100911972 255
138 3300014968 Ga0157379_10172794 Ga0157379_101727943 255
139 3300017792 Ga0163161_10215238 Ga0163161_102152382 255
140 3300025913 Ga0207695_10024731 Ga0207695_100247312 255
141 3300025923 Ga0207681_10046892 Ga0207681_100468924 255
142 3300025935 Ga0207709_10078074 Ga0207709_100780741 255
143 3300025938 Ga0207704_10007178 Ga0207704_100071788 255
144 3300025940 Ga0207691_10076321 Ga0207691_100763212 255
145 3300025949 Ga0207667_10008844 Ga0207667_100088448 255
146 3300025961 Ga0207712_10023826 Ga0207712_100238264 255
147 3300026035 Ga0207703_10030057 Ga0207703_100300576 255
148 3300026075 Ga0207708_10134783 Ga0207708_101347832 255
149 3300026089 Ga0207648_10000432 Ga0207648_100004324 255
150 3300026118 Ga0207675_100012122 Ga0207675_10001212210 255
151 3300026121 Ga0207683_10181180 Ga0207683_101811802 255
152 3300028381 Ga0268264_10204893 Ga0268264_102048932 255
153 3300035410 Ga0373924_0118282 Ga0373924_0118282_24_866 255
154 3300044673 Ga0453683_0002535 Ga0453683_0002535_1730_2611 255
155 3300045051 Ga0451576_0005623 Ga0451576_0005623_2508_3389 255
156 3300046689 Ga0495613_0210490 Ga0495613_0210490_68_946 255
157 3300033180 Ga0307510_10017493 Ga0307510_100174932 256
158 3300035117 Ga0373953_0031907 Ga0373953_0031907_66_953 256
159 3300035120 Ga0373957_0005960 Ga0373957_0005960_391_1278 256
160 3300035410 Ga0373924_0103964 Ga0373924_0103964_114_1001 256
161 3300035724 Ga0373933_0009864 Ga0373933_0009864_2333_3220 256
162 3300036401 Ga0373937_0000617 Ga0373937_0000617_12715_13602 256
163 3300046511 Ga0495608_0024516 Ga0495608_0024516_2815_3702 256
164 3300046514 Ga0495618_0110079 Ga0495618_0110079_854_1741 256
165 3300046559 Ga0495667_0005117 Ga0495667_0005117_1018_1905 256
166 3300047319 Ga0495674_0258116 Ga0495674_0258116_303_1190 256
167 3300047322 Ga0495680_0197139 Ga0495680_0197139_532_1419 256
168 3300047444 Ga0495675_0121505 Ga0495675_0121505_24_911 256
169 3300049581 Ga0501047_0093104 Ga0501047_0093104_339_1232 256
170 3300049590 Ga0501074_0138669 Ga0501074_0138669_792_1676 256
171 3300049823 Ga0501044_0245593 Ga0501044_0245593_72_965 256
172 3300009174 Ga0105241_10055443 Ga0105241_100554432 257
173 3300014325 Ga0163163_10206317 Ga0163163_102063172 257
174 3300025911 Ga0207654_10058906 Ga0207654_100589062 257
175 3300025925 Ga0207650_10002704 Ga0207650_100027043 257
176 3300025926 Ga0207659_10004187 Ga0207659_100041872 257
177 3300036401 Ga0373937_0203694 Ga0373937_0203694_409_1284 257
178 3300046516 Ga0495628_0096061 Ga0495628_0096061_737_1630 257
179 3300048088 Ga0495602_0073820 Ga0495602_0073820_1958_2833 257
180 3300005616 Ga0068852_100099422 Ga0068852_1000994223 258
181 3300026142 Ga0207698_10065985 Ga0207698_100659853 258
182 3300037418 Ga0395900_0032576 Ga0395900_0032576_1571_2446 258
183 3300037471 Ga0395905_0013205 Ga0395905_0013205_6445_7320 258
184 3300047470 Ga0495681_0029983 Ga0495681_0029983_486_1394 258
185 3300048918 Ga0496115_0104555 Ga0496115_0104555_666_1541 258
186 3300005436 Ga0070713_100000245 Ga0070713_10000024522 259
187 3300009551 Ga0105238_10328759 Ga0105238_103287592 259
188 3300025924 Ga0207694_10292142 Ga0207694_102921421 259
189 3300025928 Ga0207700_10000182 Ga0207700_1000018226 259
190 3300037068 Ga0373925_0144755 Ga0373925_0144755_346_1233 259
191 iso_pu_bacteria 8046767195 8046770677 259
192 iso_pu_bacteria 8057575449 8057579948 259
193 3300005335 Ga0070666_10017112 Ga0070666_100171124 260
194 3300005338 Ga0068868_100059252 Ga0068868_1000592523 260
195 3300005340 Ga0070689_100095961 Ga0070689_1000959612 260
196 3300005353 Ga0070669_100443612 Ga0070669_1004436122 260
197 3300005355 Ga0070671_100006686 Ga0070671_1000066868 260
198 3300005364 Ga0070673_100020993 Ga0070673_1000209932 260
199 3300005365 Ga0070688_100002144 Ga0070688_1000021448 260
200 3300005367 Ga0070667_100210859 Ga0070667_1002108592 260
201 3300005434 Ga0070709_10072947 Ga0070709_100729472 260
202 3300005436 Ga0070713_100016747 Ga0070713_1000167474 260
203 3300005437 Ga0070710_10043325 Ga0070710_100433254 260
204 3300005439 Ga0070711_100027797 Ga0070711_1000277974 260
205 3300005456 Ga0070678_100007972 Ga0070678_1000079723 260
206 3300005466 Ga0070685_10000448 Ga0070685_1000044827 260
207 3300005543 Ga0070672_100070832 Ga0070672_1000708322 260
208 3300005544 Ga0070686_100054878 Ga0070686_1000548783 260
209 3300005547 Ga0070693_100001109 Ga0070693_1000011095 260
210 3300005578 Ga0068854_100001475 Ga0068854_1000014758 260
211 3300005614 Ga0068856_100379201 Ga0068856_1003792012 260
212 3300005615 Ga0070702_100193765 Ga0070702_1001937652 260
213 3300005616 Ga0068852_100166378 Ga0068852_1001663782 260
214 3300005618 Ga0068864_100000854 Ga0068864_1000008544 260
215 3300005841 Ga0068863_100010697 Ga0068863_1000106979 260
216 3300005842 Ga0068858_100004095 Ga0068858_10000409515 260
217 3300005843 Ga0068860_100155685 Ga0068860_1001556852 260
218 3300006175 Ga0070712_100006268 Ga0070712_1000062688 260
219 3300006237 Ga0097621_100152468 Ga0097621_1001524683 260
220 3300006358 Ga0068871_100218732 Ga0068871_1002187322 260
221 3300006881 Ga0068865_100092953 Ga0068865_1000929532 260
222 3300007265 Ga0099794_10235953 Ga0099794_102359531 260
223 3300009098 Ga0105245_10067338 Ga0105245_100673383 260
224 3300009098 Ga0105245_10108480 Ga0105245_101084802 260
225 3300009101 Ga0105247_10014150 Ga0105247_100141503 260
226 3300009148 Ga0105243_10121867 Ga0105243_101218672 260
227 3300009177 Ga0105248_10006620 Ga0105248_1000662012 260
228 3300009551 Ga0105238_10299634 Ga0105238_102996343 260
229 3300010375 Ga0105239_10331299 Ga0105239_103312992 260
230 3300013296 Ga0157374_10000569 Ga0157374_1000056934 260
231 3300013297 Ga0157378_10293819 Ga0157378_102938192 260
232 3300013306 Ga0163162_10150317 Ga0163162_101503172 260
233 3300013306 Ga0163162_10205008 Ga0163162_102050082 260
234 3300014968 Ga0157379_10010180 Ga0157379_100101808 260
235 3300014969 Ga0157376_10256005 Ga0157376_102560052 260
236 3300017792 Ga0163161_10078847 Ga0163161_100788472 260
237 3300021441 Ga0213871_10013985 Ga0213871_100139852 260
238 3300025898 Ga0207692_10005600 Ga0207692_100056007 260
239 3300025903 Ga0207680_10077051 Ga0207680_100770512 260
240 3300025906 Ga0207699_10059978 Ga0207699_100599782 260
241 3300025915 Ga0207693_10000075 Ga0207693_1000007556 260
242 3300025916 Ga0207663_10002965 Ga0207663_100029656 260
243 3300025922 Ga0207646_10325852 Ga0207646_103258521 260
244 3300025923 Ga0207681_10096479 Ga0207681_100964793 260
245 3300025924 Ga0207694_10080531 Ga0207694_100805312 260
246 3300025925 Ga0207650_10017333 Ga0207650_100173336 260
247 3300025927 Ga0207687_10013670 Ga0207687_100136702 260
248 3300025927 Ga0207687_10028354 Ga0207687_100283543 260
249 3300025931 Ga0207644_10032208 Ga0207644_100322084 260
250 3300025933 Ga0207706_10017469 Ga0207706_100174699 260
251 3300025934 Ga0207686_10000195 Ga0207686_1000019517 260
252 3300025936 Ga0207670_10023793 Ga0207670_100237933 260
253 3300025940 Ga0207691_10062120 Ga0207691_100621204 260
254 3300025941 Ga0207711_10000092 Ga0207711_1000009236 260
255 3300025942 Ga0207689_10014709 Ga0207689_100147095 260
256 3300025960 Ga0207651_10064128 Ga0207651_100641283 260
257 3300026023 Ga0207677_10000477 Ga0207677_100004776 260
258 3300026035 Ga0207703_10001714 Ga0207703_1000171421 260
259 3300026078 Ga0207702_10086936 Ga0207702_100869364 260
260 3300026088 Ga0207641_10006778 Ga0207641_100067785 260
261 3300026095 Ga0207676_10000097 Ga0207676_1000009764 260
262 3300026121 Ga0207683_10004473 Ga0207683_1000447310 260
263 3300026142 Ga0207698_10062549 Ga0207698_100625494 260
264 3300028381 Ga0268264_10003797 Ga0268264_100037972 260
265 3300033179 Ga0307507_10032398 Ga0307507_100323984 260
266 3300033179 Ga0307507_10185535 Ga0307507_101855352 260
267 3300035086 Ga0373934_0012796 Ga0373934_0012796_2079_2954 260
268 3300035111 Ga0373923_0001271 Ga0373923_0001271_3317_4192 260
269 3300035117 Ga0373953_0017685 Ga0373953_0017685_562_1437 260
270 3300035118 Ga0373954_0001687 Ga0373954_0001687_2264_3139 260
271 3300036401 Ga0373937_0009900 Ga0373937_0009900_6014_6889 260
272 3300037068 Ga0373925_0001443 Ga0373925_0001443_11984_12859 260
273 3300037068 Ga0373925_0019542 Ga0373925_0019542_898_1773 260
274 3300037312 Ga0395899_0006274 Ga0395899_0006274_598_1485 260
275 3300037418 Ga0395900_0069470 Ga0395900_0069470_379_1266 260
276 3300037418 Ga0395900_0367240 Ga0395900_0367240_144_1031 260
277 3300037466 Ga0395898_0009885 Ga0395898_0009885_2393_3280 260
278 3300037471 Ga0395905_0373351 Ga0395905_0373351_414_1301 260
279 3300038443 Ga0395901_0157927 Ga0395901_0157927_16_903 260
280 3300039438 Ga0436360_0943536 Ga0436360_0943536_608_1477 260
281 3300044658 Ga0466972_0127299 Ga0466972_0127299_248_1132 260
282 3300046459 Ga0495629_0111044 Ga0495629_0111044_462_1337 260
283 3300046463 Ga0495653_0212882 Ga0495653_0212882_240_1115 260
284 3300046472 Ga0495580_0022959 Ga0495580_0022959_362_1237 260
285 3300046472 Ga0495580_0045319 Ga0495580_0045319_1634_2509 260
286 3300046473 Ga0495582_0007568 Ga0495582_0007568_2652_3527 260
287 3300046473 Ga0495582_0016966 Ga0495582_0016966_608_1483 260
288 3300046475 Ga0495639_0092210 Ga0495639_0092210_215_1090 260
289 3300046477 Ga0495664_0007319 Ga0495664_0007319_4385_5260 260
290 3300046511 Ga0495608_0164152 Ga0495608_0164152_509_1384 260
291 3300046514 Ga0495618_0262736 Ga0495618_0262736_23_898 260
292 3300046516 Ga0495628_0228026 Ga0495628_0228026_459_1334 260
293 3300046516 Ga0495628_0290812 Ga0495628_0290812_49_924 260
294 3300046531 Ga0495665_0008093 Ga0495665_0008093_2029_2904 260
295 3300046539 Ga0495621_0004002 Ga0495621_0004002_546_1421 260
296 3300046642 Ga0495634_0233051 Ga0495634_0233051_230_1105 260
297 3300046663 Ga0495635_0007041 Ga0495635_0007041_1946_2821 260
298 3300046664 Ga0495659_0023080 Ga0495659_0023080_542_1417 260
299 3300046674 Ga0495588_0052636 Ga0495588_0052636_366_1241 260
300 3300046675 Ga0495657_0182231 Ga0495657_0182231_229_1104 260
301 3300046679 Ga0495623_0019336 Ga0495623_0019336_1930_2805 260
302 3300046681 Ga0495647_0001373 Ga0495647_0001373_2355_3230 260
303 3300046681 Ga0495647_0065975 Ga0495647_0065975_157_1032 260
304 3300046683 Ga0495658_0034842 Ga0495658_0034842_1112_1987 260
305 3300047315 Ga0495581_0083140 Ga0495581_0083140_573_1448 260
306 3300047317 Ga0495604_0021483 Ga0495604_0021483_1751_2626 260
307 3300047322 Ga0495680_0240673 Ga0495680_0240673_162_1037 260
308 3300047444 Ga0495675_0076048 Ga0495675_0076048_295_1170 260
309 3300047471 Ga0495684_0041179 Ga0495684_0041179_212_1087 260
310 3300047673 Ga0495593_0114237 Ga0495593_0114237_358_1233 260
311 3300048903 Ga0496100_0012926 Ga0496100_0012926_79_954 260
312 3300048904 Ga0496101_0101900 Ga0496101_0101900_1261_2136 260
313 3300048907 Ga0496104_0531076 Ga0496104_0531076_127_1002 260
314 3300048908 Ga0496105_0013888 Ga0496105_0013888_4568_5443 260
315 3300048911 Ga0496108_0317920 Ga0496108_0317920_230_1105 260
316 3300048912 Ga0496109_0260485 Ga0496109_0260485_57_932 260
317 3300048913 Ga0496110_0169794 Ga0496110_0169794_70_945 260
318 3300048915 Ga0496112_0001692 Ga0496112_0001692_16096_16971 260
319 3300048918 Ga0496115_0007448 Ga0496115_0007448_1614_2489 260
320 3300049572 Ga0501036_0212590 Ga0501036_0212590_125_991 260
321 3300049577 Ga0501041_0014368 Ga0501041_0014368_3316_4182 260
322 3300049588 Ga0501072_0003747 Ga0501072_0003747_2570_3436 260
323 3300049591 Ga0501075_0031987 Ga0501075_0031987_295_1161 260
324 3300049592 Ga0501076_0000393 Ga0501076_0000393_2707_3573 260
325 3300049824 Ga0501045_0002454 Ga0501045_0002454_2864_3730 260
326 3300053094 Ga0500566_0170858 Ga0500566_0170858_82_954 260
327 3300055283 Ga0500661_000702 Ga0500661_000702_730_1602 260
328 3300061734 Ga0530510_0000048 Ga0530510_0000048_21493_22359 260
329 iso_pu_bacteria 2585427608 2585901854 260
330 iso_pu_bacteria 2852387548 2852394641 260
331 iso_pu_bacteria 3005416602 3005416810 260
332 iso_pu_bacteria 8005314921 8005320543 260
333 3300005329 Ga0070683_100205102 Ga0070683_1002051021 261
334 3300005339 Ga0070660_100086433 Ga0070660_1000864333 261
335 3300005344 Ga0070661_100072171 Ga0070661_1000721713 261
336 3300005366 Ga0070659_100112321 Ga0070659_1001123212 261
337 3300005434 Ga0070709_10052822 Ga0070709_100528222 261
338 3300005436 Ga0070713_100149844 Ga0070713_1001498442 261
339 3300005440 Ga0070705_100005843 Ga0070705_1000058432 261
340 3300005444 Ga0070694_100097568 Ga0070694_1000975682 261
341 3300005445 Ga0070708_100149757 Ga0070708_1001497572 261
342 3300005467 Ga0070706_100037877 Ga0070706_1000378772 261
343 3300005468 Ga0070707_100367534 Ga0070707_1003675342 261
344 3300005518 Ga0070699_100044652 Ga0070699_1000446523 261
345 3300005530 Ga0070679_100530988 Ga0070679_1005309882 261
346 3300005536 Ga0070697_100157407 Ga0070697_1001574071 261
347 3300005545 Ga0070695_100107440 Ga0070695_1001074402 261
348 3300005549 Ga0070704_100179606 Ga0070704_1001796062 261
349 3300005564 Ga0070664_100211943 Ga0070664_1002119432 261
350 3300005834 Ga0068851_10056578 Ga0068851_100565782 261
351 3300006175 Ga0070712_100346605 Ga0070712_1003466052 261
352 3300006914 Ga0075436_100268977 Ga0075436_1002689771 261
353 3300009093 Ga0105240_10113094 Ga0105240_101130943 261
354 3300009098 Ga0105245_10198774 Ga0105245_101987742 261
355 3300009545 Ga0105237_10041719 Ga0105237_100417192 261
356 3300010375 Ga0105239_10610787 Ga0105239_106107871 261
357 3300013104 Ga0157370_10057443 Ga0157370_100574432 261
358 3300025906 Ga0207699_10042304 Ga0207699_100423044 261
359 3300025910 Ga0207684_10171613 Ga0207684_101716132 261
360 3300025915 Ga0207693_10001554 Ga0207693_100015544 261
361 3300025919 Ga0207657_10010554 Ga0207657_100105549 261
362 3300025927 Ga0207687_10071198 Ga0207687_100711983 261
363 3300025941 Ga0207711_10151572 Ga0207711_101515721 261
364 3300025942 Ga0207689_10148350 Ga0207689_101483502 261
365 3300026116 Ga0207674_10007170 Ga0207674_1000717011 261
366 3300035410 Ga0373924_0002698 Ga0373924_0002698_2936_3817 261
367 3300036401 Ga0373937_0174679 Ga0373937_0174679_737_1624 261
368 3300037068 Ga0373925_0186762 Ga0373925_0186762_540_1427 261
369 3300046514 Ga0495618_0186227 Ga0495618_0186227_197_1084 261
370 3300046529 Ga0495652_0266012 Ga0495652_0266012_250_1137 261
371 3300046559 Ga0495667_0266350 Ga0495667_0266350_88_975 261
372 3300048915 Ga0496112_0103601 Ga0496112_0103601_684_1559 261
373 iso_pu_bacteria 2511231002 2511247214 261
374 iso_pu_bacteria 2585428057 2587727368 261
375 iso_pu_bacteria 2585428058 2587735274 261
376 iso_pu_bacteria 2588253510 2588294790 261
377 iso_pu_bacteria 2643221592 2643967856 261
378 iso_pu_bacteria 2643221625 2644143244 261
379 iso_pu_bacteria 2643221648 2644271668 261
380 3300005338 Ga0068868_100042239 Ga0068868_1000422392 262
381 3300005530 Ga0070679_100045246 Ga0070679_1000452462 262
382 3300005616 Ga0068852_100001236 Ga0068852_10000123618 262
383 3300005834 Ga0068851_10026978 Ga0068851_100269783 262
384 3300006237 Ga0097621_100030851 Ga0097621_1000308515 262
385 3300006358 Ga0068871_100053039 Ga0068871_1000530393 262
386 3300006871 Ga0075434_100000065 Ga0075434_10000006559 262
387 3300006914 Ga0075436_100000205 Ga0075436_10000020544 262
388 3300006914 Ga0075436_100004957 Ga0075436_1000049576 262
389 3300007076 Ga0075435_100040049 Ga0075435_1000400495 262
390 3300009093 Ga0105240_10015704 Ga0105240_100157047 262
391 3300025913 Ga0207695_10034455 Ga0207695_100344556 262
392 3300025981 Ga0207640_10558986 Ga0207640_105589861 262
393 3300026023 Ga0207677_10013156 Ga0207677_100131563 262
394 3300026142 Ga0207698_10000342 Ga0207698_100003427 262
395 3300048908 Ga0496105_0032134 Ga0496105_0032134_192_1067 262
396 3300048914 Ga0496111_0111208 Ga0496111_0111208_1091_1966 262
397 3300050512 nmdc:mga0n895_310158_c1 nmdc:mga0n895_310158_c1_58_939 262
398 3300050512 nmdc:mga0n895_84_c1 nmdc:mga0n895_84_c1_36248_37117 262
399 3300050513 nmdc:mga0rr50_31298_c1 nmdc:mga0rr50_31298_c1_148_1017 262
400 3300050514 nmdc:mga08x19_2051_c1 nmdc:mga08x19_2051_c1_4064_4945 262
401 3300050514 nmdc:mga08x19_2433_c1 nmdc:mga08x19_2433_c1_5533_6399 262
402 3300005434 Ga0070709_10092584 Ga0070709_100925841 263
403 3300005617 Ga0068859_100080768 Ga0068859_1000807685 263
404 3300006844 Ga0075428_100004095 Ga0075428_10000409514 263
405 3300006880 Ga0075429_100004896 Ga0075429_1000048963 263
406 3300006931 Ga0097620_100080769 Ga0097620_1000807695 263
407 3300009147 Ga0114129_10320646 Ga0114129_103206462 263
408 3300013105 Ga0157369_10102335 Ga0157369_101023353 263
409 3300013296 Ga0157374_10479420 Ga0157374_104794202 263
410 3300027907 Ga0207428_10005555 Ga0207428_1000555512 263
411 3300031251 Ga0265327_10008541 Ga0265327_100085417 263
412 3300042461 Ga0439460_0031819 Ga0439460_0031819_18_884 263
413 3300049575 Ga0501039_0362219 Ga0501039_0362219_133_999 263
414 3300049588 Ga0501072_0018302 Ga0501072_0018302_1746_2612 263
415 3300050507 nmdc:mga05p37_5610_c1 nmdc:mga05p37_5610_c1_12553_13419 263
416 3300050508 nmdc:mga09592_4157_c1 nmdc:mga09592_4157_c1_1393_2259 263
417 3300050511 nmdc:mga08y16_9559_c1 nmdc:mga08y16_9559_c1_8179_9045 263
418 3300005330 Ga0070690_100000758 Ga0070690_10000075813 264
419 3300005334 Ga0068869_100001795 Ga0068869_10000179510 264
420 3300005336 Ga0070680_100007592 Ga0070680_1000075924 264
421 3300005337 Ga0070682_100013702 Ga0070682_1000137022 264
422 3300005340 Ga0070689_100002598 Ga0070689_1000025987 264
423 3300005340 Ga0070689_100168138 Ga0070689_1001681381 264
424 3300005341 Ga0070691_10000694 Ga0070691_100006948 264
425 3300005343 Ga0070687_100007779 Ga0070687_1000077792 264
426 3300005365 Ga0070688_100166294 Ga0070688_1001662942 264
427 3300005438 Ga0070701_10003369 Ga0070701_100033695 264
428 3300005440 Ga0070705_100002078 Ga0070705_1000020787 264
429 3300005441 Ga0070700_100004325 Ga0070700_1000043257 264
430 3300005444 Ga0070694_100001894 Ga0070694_1000018948 264
431 3300005458 Ga0070681_10145961 Ga0070681_101459613 264
432 3300005459 Ga0068867_100005732 Ga0068867_1000057322 264
433 3300005530 Ga0070679_100052746 Ga0070679_1000527463 264
434 3300005539 Ga0068853_100042965 Ga0068853_1000429655 264
435 3300005544 Ga0070686_100002471 Ga0070686_1000024717 264
436 3300005545 Ga0070695_100003461 Ga0070695_1000034619 264
437 3300005546 Ga0070696_100002305 Ga0070696_1000023058 264
438 3300005546 Ga0070696_100003044 Ga0070696_10000304412 264
439 3300005547 Ga0070693_100001266 Ga0070693_1000012667 264
440 3300005549 Ga0070704_100003882 Ga0070704_1000038828 264
441 3300005563 Ga0068855_100016235 Ga0068855_1000162353 264
442 3300005578 Ga0068854_100003215 Ga0068854_1000032152 264
443 3300005615 Ga0070702_100003013 Ga0070702_1000030133 264
444 3300005615 Ga0070702_100190369 Ga0070702_1001903692 264
445 3300005617 Ga0068859_100006424 Ga0068859_1000064247 264
446 3300005617 Ga0068859_100046798 Ga0068859_1000467983 264
447 3300005618 Ga0068864_100022813 Ga0068864_1000228133 264
448 3300005718 Ga0068866_10000959 Ga0068866_100009598 264
449 3300005719 Ga0068861_100001299 Ga0068861_1000012996 264
450 3300005840 Ga0068870_10122531 Ga0068870_101225312 264
451 3300005841 Ga0068863_100104969 Ga0068863_1001049692 264
452 3300005842 Ga0068858_100016904 Ga0068858_1000169044 264
453 3300005843 Ga0068860_100005275 Ga0068860_1000052759 264
454 3300005844 Ga0068862_100002444 Ga0068862_1000024448 264
455 3300006237 Ga0097621_100023572 Ga0097621_1000235722 264
456 3300006358 Ga0068871_100006330 Ga0068871_1000063307 264
457 3300006852 Ga0075433_10001178 Ga0075433_100011787 264
458 3300006871 Ga0075434_100001217 Ga0075434_10000121715 264
459 3300006881 Ga0068865_100004151 Ga0068865_1000041517 264
460 3300006914 Ga0075436_100003082 Ga0075436_10000308211 264
461 3300006931 Ga0097620_100006424 Ga0097620_1000064247 264
462 3300006931 Ga0097620_100046798 Ga0097620_1000467983 264
463 3300007076 Ga0075435_100000549 Ga0075435_10000054917 264
464 3300009098 Ga0105245_10000259 Ga0105245_1000025962 264
465 3300009148 Ga0105243_10004311 Ga0105243_100043118 264
466 3300009148 Ga0105243_10042561 Ga0105243_100425613 264
467 3300009174 Ga0105241_10004693 Ga0105241_100046939 264
468 3300009176 Ga0105242_10003634 Ga0105242_100036348 264
469 3300009177 Ga0105248_10327962 Ga0105248_103279621 264
470 3300009553 Ga0105249_10003563 Ga0105249_1000356310 264
471 3300013297 Ga0157378_10007333 Ga0157378_100073338 264
472 3300014326 Ga0157380_10141298 Ga0157380_101412982 264
473 3300014968 Ga0157379_10041206 Ga0157379_100412062 264
474 3300014969 Ga0157376_10007668 Ga0157376_100076684 264
475 3300025901 Ga0207688_10040709 Ga0207688_100407092 264
476 3300025912 Ga0207707_10069557 Ga0207707_100695572 264
477 3300025917 Ga0207660_10005344 Ga0207660_100053447 264
478 3300025918 Ga0207662_10000106 Ga0207662_100001069 264
479 3300025921 Ga0207652_10024991 Ga0207652_100249912 264
480 3300025921 Ga0207652_10198398 Ga0207652_101983981 264
481 3300025926 Ga0207659_10110902 Ga0207659_101109022 264
482 3300025927 Ga0207687_10013013 Ga0207687_100130134 264
483 3300025934 Ga0207686_10005506 Ga0207686_100055063 264
484 3300025935 Ga0207709_10002789 Ga0207709_100027898 264
485 3300025935 Ga0207709_10125493 Ga0207709_101254932 264
486 3300025936 Ga0207670_10007642 Ga0207670_100076424 264
487 3300025936 Ga0207670_10057827 Ga0207670_100578272 264
488 3300025938 Ga0207704_10002100 Ga0207704_100021005 264
489 3300025942 Ga0207689_10004637 Ga0207689_100046378 264
490 3300025949 Ga0207667_10023786 Ga0207667_100237863 264
491 3300025961 Ga0207712_10006365 Ga0207712_100063654 264
492 3300025981 Ga0207640_10004437 Ga0207640_100044378 264
493 3300026023 Ga0207677_10001868 Ga0207677_100018687 264
494 3300026035 Ga0207703_10003689 Ga0207703_1000368912 264
495 3300026035 Ga0207703_10048497 Ga0207703_100484973 264
496 3300026041 Ga0207639_10095143 Ga0207639_100951432 264
497 3300026075 Ga0207708_10022592 Ga0207708_100225927 264
498 3300026078 Ga0207702_10022972 Ga0207702_100229722 264
499 3300026088 Ga0207641_10191461 Ga0207641_101914612 264
500 3300026089 Ga0207648_10005290 Ga0207648_100052907 264
501 3300026118 Ga0207675_100010235 Ga0207675_1000102352 264
502 3300026142 Ga0207698_10031190 Ga0207698_100311903 264
503 3300028380 Ga0268265_10003603 Ga0268265_100036037 264
504 3300028381 Ga0268264_10005206 Ga0268264_100052067 264
505 3300034957 Ga0373938_0005198 Ga0373938_0005198_435_1304 264
506 3300035113 Ga0373936_0004217 Ga0373936_0004217_4538_5407 264
507 3300035114 Ga0373939_0006886 Ga0373939_0006886_1487_2356 264
508 3300035116 Ga0373945_0058444 Ga0373945_0058444_398_1267 264
509 3300035691 Ga0373931_0006196 Ga0373931_0006196_4197_5066 264
510 3300035692 Ga0373935_0015015 Ga0373935_0015015_1042_1911 264
511 3300035695 Ga0373927_0004898 Ga0373927_0004898_398_1267 264
512 3300035695 Ga0373927_0210790 Ga0373927_0210790_36_923 264
513 3300036401 Ga0373937_0196366 Ga0373937_0196366_743_1630 264
514 3300037068 Ga0373925_0013522 Ga0373925_0013522_3883_4752 264
515 3300046459 Ga0495629_0370319 Ga0495629_0370319_74_961 264
516 3300046473 Ga0495582_0071100 Ga0495582_0071100_342_1211 264
517 3300046526 Ga0495666_0013392 Ga0495666_0013392_1213_2082 264
518 3300046535 Ga0495586_0009428 Ga0495586_0009428_3960_4829 264
519 3300046681 Ga0495647_0000090 Ga0495647_0000090_9656_10525 264
520 3300046683 Ga0495658_0042701 Ga0495658_0042701_390_1259 264
521 3300047321 Ga0495676_0116064 Ga0495676_0116064_193_1062 264
522 3300005327 Ga0070658_10096029 Ga0070658_100960293 265
523 3300005328 Ga0070676_10002360 Ga0070676_100023607 265
524 3300005329 Ga0070683_100010121 Ga0070683_1000101213 265
525 3300005331 Ga0070670_100005773 Ga0070670_1000057738 265
526 3300005334 Ga0068869_100001116 Ga0068869_1000011165 265
527 3300005339 Ga0070660_100005190 Ga0070660_1000051902 265
528 3300005344 Ga0070661_100000659 Ga0070661_10000065922 265
529 3300005347 Ga0070668_100049546 Ga0070668_1000495463 265
530 3300005353 Ga0070669_100017827 Ga0070669_1000178274 265
531 3300005355 Ga0070671_100274570 Ga0070671_1002745701 265
532 3300005367 Ga0070667_100001779 Ga0070667_1000017792 265
533 3300005435 Ga0070714_100003517 Ga0070714_10000351710 265
534 3300005435 Ga0070714_100009908 Ga0070714_1000099087 265
535 3300005436 Ga0070713_100025557 Ga0070713_1000255576 265
536 3300005440 Ga0070705_100113820 Ga0070705_1001138202 265
537 3300005530 Ga0070679_100027662 Ga0070679_1000276623 265
538 3300005535 Ga0070684_100016572 Ga0070684_1000165723 265
539 3300005539 Ga0068853_100013146 Ga0068853_1000131467 265
540 3300005539 Ga0068853_100195839 Ga0068853_1001958392 265
541 3300005563 Ga0068855_100006508 Ga0068855_1000065083 265
542 3300005563 Ga0068855_100073398 Ga0068855_1000733984 265
543 3300005564 Ga0070664_100000157 Ga0070664_10000015731 265
544 3300005577 Ga0068857_100003114 Ga0068857_1000031142 265
545 3300005578 Ga0068854_100022691 Ga0068854_1000226914 265
546 3300005614 Ga0068856_100002108 Ga0068856_1000021089 265
547 3300005616 Ga0068852_100024227 Ga0068852_1000242273 265
548 3300005617 Ga0068859_100001470 Ga0068859_1000014705 265
549 3300005618 Ga0068864_100004243 Ga0068864_1000042435 265
550 3300005719 Ga0068861_100001821 Ga0068861_1000018215 265
551 3300005834 Ga0068851_10145535 Ga0068851_101455352 265
552 3300005840 Ga0068870_10016278 Ga0068870_100162783 265
553 3300005841 Ga0068863_100010525 Ga0068863_1000105253 265
554 3300005841 Ga0068863_100083294 Ga0068863_1000832943 265
555 3300005842 Ga0068858_100003231 Ga0068858_10000323118 265
556 3300005843 Ga0068860_100014167 Ga0068860_1000141678 265
557 3300005844 Ga0068862_100076096 Ga0068862_1000760961 265
558 3300006881 Ga0068865_100195530 Ga0068865_1001955302 265
559 3300006931 Ga0097620_100001470 Ga0097620_1000014705 265
560 3300009093 Ga0105240_10001136 Ga0105240_1000113612 265
561 3300009093 Ga0105240_10048926 Ga0105240_100489262 265
562 3300009101 Ga0105247_10031558 Ga0105247_100315583 265
563 3300009174 Ga0105241_10191479 Ga0105241_101914792 265
564 3300009174 Ga0105241_10326835 Ga0105241_103268351 265
565 3300009551 Ga0105238_10000203 Ga0105238_1000020338 265
566 3300013297 Ga0157378_10074140 Ga0157378_100741401 265
567 3300013307 Ga0157372_10004219 Ga0157372_100042193 265
568 3300014325 Ga0163163_10031354 Ga0163163_100313543 265
569 3300014497 Ga0182008_10056180 Ga0182008_100561801 265
570 3300014968 Ga0157379_10001798 Ga0157379_100017985 265
571 3300025321 Ga0207656_10077202 Ga0207656_100772022 265
572 3300025900 Ga0207710_10024820 Ga0207710_100248203 265
573 3300025901 Ga0207688_10211807 Ga0207688_102118071 265
574 3300025907 Ga0207645_10020661 Ga0207645_100206613 265
575 3300025909 Ga0207705_10123185 Ga0207705_101231852 265
576 3300025912 Ga0207707_10148398 Ga0207707_101483982 265
577 3300025913 Ga0207695_10042211 Ga0207695_100422116 265
578 3300025913 Ga0207695_10053153 Ga0207695_100531533 265
579 3300025914 Ga0207671_10190939 Ga0207671_101909392 265
580 3300025915 Ga0207693_10255815 Ga0207693_102558151 265
581 3300025916 Ga0207663_10020999 Ga0207663_100209996 265
582 3300025918 Ga0207662_10233157 Ga0207662_102331571 265
583 3300025921 Ga0207652_10021349 Ga0207652_100213493 265
584 3300025923 Ga0207681_10067542 Ga0207681_100675422 265
585 3300025925 Ga0207650_10003970 Ga0207650_100039706 265
586 3300025929 Ga0207664_10011875 Ga0207664_100118752 265
587 3300025929 Ga0207664_10019166 Ga0207664_100191663 265
588 3300025942 Ga0207689_10002122 Ga0207689_100021228 265
589 3300025944 Ga0207661_10062617 Ga0207661_100626171 265
590 3300025949 Ga0207667_10276358 Ga0207667_102763582 265
591 3300025972 Ga0207668_10029406 Ga0207668_100294062 265
592 3300025981 Ga0207640_10030353 Ga0207640_100303532 265
593 3300025986 Ga0207658_10021671 Ga0207658_100216714 265
594 3300026035 Ga0207703_10000942 Ga0207703_100009425 265
595 3300026041 Ga0207639_10005827 Ga0207639_100058274 265
596 3300026078 Ga0207702_10050328 Ga0207702_100503282 265
597 3300026088 Ga0207641_10061930 Ga0207641_100619301 265
598 3300026116 Ga0207674_10006739 Ga0207674_100067394 265
599 3300026118 Ga0207675_100003477 Ga0207675_1000034778 265
600 3300026118 Ga0207675_100279452 Ga0207675_1002794522 265
601 3300026142 Ga0207698_10094591 Ga0207698_100945912 265
602 3300028380 Ga0268265_10004946 Ga0268265_100049461 265
603 3300028381 Ga0268264_10002492 Ga0268264_1000249212 265
604 3300028381 Ga0268264_10711753 Ga0268264_107117532 265
605 3300048905 Ga0496102_0046330 Ga0496102_0046330_1705_2577 265
606 3300048911 Ga0496108_0034123 Ga0496108_0034123_621_1493 265
607 3300048912 Ga0496109_0037699 Ga0496109_0037699_2370_3242 265
608 3300048922 Ga0496119_0016001 Ga0496119_0016001_2172_3089 265
609 3300049571 Ga0501034_0024597 Ga0501034_0024597_2549_3433 265
610 3300049574 Ga0501038_0471173 Ga0501038_0471173_69_953 265
611 3300049575 Ga0501039_0095895 Ga0501039_0095895_792_1676 265
612 3300049579 Ga0501043_0051968 Ga0501043_0051968_716_1600 265
613 3300049580 Ga0501046_0004878 Ga0501046_0004878_7441_8325 265
614 3300049581 Ga0501047_0048945 Ga0501047_0048945_192_1076 265
615 3300049742 Ga0501080_0101510 Ga0501080_0101510_162_1046 265
616 3300049823 Ga0501044_0470233 Ga0501044_0470233_161_1045 265
617 3300025937 Ga0207669_10330695 Ga0207669_103306951 266
618 3300035725 Ga0373947_0015558 Ga0373947_0015558_1629_2504 266
619 3300042876 Ga0451577_0099606 Ga0451577_0099606_1430_2377 266
620 3300045051 Ga0451576_0265319 Ga0451576_0265319_244_1191 266
621 3300005365 Ga0070688_100236304 Ga0070688_1002363042 267
622 3300006844 Ga0075428_100002197 Ga0075428_10000219711 267
623 3300009094 Ga0111539_10002089 Ga0111539_1000208912 267
624 3300025936 Ga0207670_10156552 Ga0207670_101565521 267
625 3300025936 Ga0207670_10399836 Ga0207670_103998361 267
626 3300025949 Ga0207667_10052223 Ga0207667_100522233 267
627 3300027907 Ga0207428_10029949 Ga0207428_100299494 267
628 3300050508 nmdc:mga09592_233661_c1 nmdc:mga09592_233661_c1_379_1257 267
629 3300050511 nmdc:mga08y16_5051_c1 nmdc:mga08y16_5051_c1_2874_3752 267
630 3300036401 Ga0373937_0240721 Ga0373937_0240721_716_1597 268
631 3300013307 Ga0157372_10518955 Ga0157372_105189552 269
632 3300006914 Ga0075436_100010808 Ga0075436_1000108082 275
633 3300050515 nmdc:mga0a205_12231_c1 nmdc:mga0a205_12231_c1_6878_7774 275
634 3300003203 JGI25406J46586_10003260 JGI25406J46586_100032606 276
635 3300005985 Ga0081539_10000259 Ga0081539_1000025918 276
636 3300037312 Ga0395899_0281454 Ga0395899_0281454_64_963 276
637 3300037418 Ga0395900_0017926 Ga0395900_0017926_3722_4621 276
638 3300050507 nmdc:mga05p37_587852_c1 nmdc:mga05p37_587852_c1_109_1008 276

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

131

314

0.98

PF12911

OppC_N

N-terminal TM domain of oligopeptide transport permease C

38

90

0.94

Feature Viewer

pLDDT pTM Quality
71.64 0.43 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map