F471498
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 638 | 320 | 625 | 268 |
Family's Representative Sequence
| Representative Sequence | 3300005617|Ga0068859_100080768|Ga0068859_1000807685 |
| Length | 314 |
| Sequence | MTSVTKPRAATPTPDQITPATGFAGVAETALLEPAGRKPWRRALLKLWKRRGAMVGLAFVVFFVVLAVFAPWLSPQDPVATSWSAVRKAPSAAHWFGTDEIGRDVLSRVIWGARASLLAGLVSVGISLSVGVPLGLFAGYTGRWPDLLISRLTDALLACPFLILAIALAAFLGPSLTNAMVAIGVAATPIFIRLTRAQVLAVKLEDYVEAARAVGNSHVRIALRHVLPNVXXPIIVQATLAIAAAVIAEASLSFLGLGQQPPAPSWGSMLNTAKNYIENAPWMAVWPGLSIFLLVLSFNLLGDGLRDALDPRQG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 2 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 3 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 4 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 5 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 6 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 7 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 8 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 9 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 10 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 11 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 12 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 76 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 82 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 86 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 87 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 94 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 119 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 123 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 182 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 185 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 186 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 187 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 188 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 189 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 190 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 191 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 192 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 193 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 194 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 195 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 196 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 197 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 198 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 199 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 200 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 201 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 202 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 203 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 206 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 207 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 208 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 210 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 211 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 212 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 213 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 214 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 217 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 218 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 219 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 222 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 223 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 224 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 225 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 226 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 227 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 228 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 229 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 230 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 231 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 232 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 233 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 234 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 235 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 278 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 279 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 280 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 283 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 284 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 285 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 286 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 287 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 313 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 314 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 315 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 316 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 317 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 318 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 319 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 320 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.96 |
| Metatranscriptomes | 0 |
| Isolates | 2.04 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.57 |
| Nodule | 0.16 |
| Rhizoplane | 2.66 |
| Rhizosphere | 93.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.72 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10003260 | 3300003203 | Bacteria | 7641 |
| 2 | Ga0065165_1001592 | 3300005262 | Bacteria | 23308 |
| 3 | Ga0070658_10031175 | 3300005327 | Bacteria | 4281 |
| 4 | Ga0070658_10096029 | 3300005327 | Bacteria | 2447 |
| 5 | Ga0070676_10002360 | 3300005328 | Bacteria | 9667 |
| 6 | Ga0070683_100010121 | 3300005329 | Bacteria | 8092 |
| 7 | Ga0070683_100205102 | 3300005329 | Bacteria | 1872 |
| 8 | Ga0070690_100000758 | 3300005330 | Bacteria | 16523 |
| 9 | Ga0070670_100005773 | 3300005331 | Bacteria | 10459 |
| 10 | Ga0070670_100048071 | 3300005331 | Bacteria | 3672 |
| 11 | Ga0070677_10162312 | 3300005333 | Bacteria | 1049 |
| 12 | Ga0068869_100001116 | 3300005334 | Bacteria | 15641 |
| 13 | Ga0068869_100001795 | 3300005334 | Bacteria | 12871 |
| 14 | Ga0068869_100092721 | 3300005334 | Bacteria | 2274 |
| 15 | Ga0070666_10017112 | 3300005335 | Bacteria | 4645 |
| 16 | Ga0070680_100007592 | 3300005336 | Bacteria | 8272 |
| 17 | Ga0070680_100466360 | 3300005336 | Bacteria | 1079 |
| 18 | Ga0070682_100013702 | 3300005337 | Bacteria | 4673 |
| 19 | Ga0068868_100042239 | 3300005338 | Bacteria | 3557 |
| 20 | Ga0068868_100059252 | 3300005338 | Bacteria | 3028 |
| 21 | Ga0070660_100005190 | 3300005339 | Bacteria | 9000 |
| 22 | Ga0070660_100086433 | 3300005339 | Bacteria | 2467 |
| 23 | Ga0070689_100002598 | 3300005340 | Bacteria | 11834 |
| 24 | Ga0070689_100095961 | 3300005340 | Bacteria | 2343 |
| 25 | Ga0070689_100168138 | 3300005340 | Bacteria | 1776 |
| 26 | Ga0070691_10000694 | 3300005341 | Bacteria | 13130 |
| 27 | Ga0070687_100007779 | 3300005343 | Bacteria | 4496 |
| 28 | Ga0070661_100000659 | 3300005344 | Bacteria | 25350 |
| 29 | Ga0070661_100072171 | 3300005344 | Bacteria | 2540 |
| 30 | Ga0070661_100155182 | 3300005344 | Bacteria | 1732 |
| 31 | Ga0070668_100049546 | 3300005347 | Bacteria | 3232 |
| 32 | Ga0070669_100017827 | 3300005353 | Bacteria | 5068 |
| 33 | Ga0070669_100443612 | 3300005353 | Bacteria | 1069 |
| 34 | Ga0070671_100006686 | 3300005355 | Bacteria | 9221 |
| 35 | Ga0070671_100057316 | 3300005355 | Bacteria | 3241 |
| 36 | Ga0070671_100274570 | 3300005355 | Bacteria | 1433 |
| 37 | Ga0070673_100020993 | 3300005364 | Bacteria | 4723 |
| 38 | Ga0070673_100189630 | 3300005364 | Bacteria | 1765 |
| 39 | Ga0070688_100002144 | 3300005365 | Bacteria | 9936 |
| 40 | Ga0070688_100166294 | 3300005365 | Bacteria | 1519 |
| 41 | Ga0070688_100236304 | 3300005365 | Bacteria | 1295 |
| 42 | Ga0070659_100112321 | 3300005366 | Bacteria | 2200 |
| 43 | Ga0070659_100228776 | 3300005366 | Bacteria | 1536 |
| 44 | Ga0070667_100001779 | 3300005367 | Bacteria | 19196 |
| 45 | Ga0070667_100210859 | 3300005367 | Bacteria | 1726 |
| 46 | Ga0070709_10052822 | 3300005434 | Bacteria | 2556 |
| 47 | Ga0070709_10072947 | 3300005434 | Bacteria | 2221 |
| 48 | Ga0070709_10092584 | 3300005434 | Bacteria | 1997 |
| 49 | Ga0070714_100003517 | 3300005435 | Bacteria | 11697 |
| 50 | Ga0070714_100009908 | 3300005435 | Bacteria | 7515 |
| 51 | Ga0070713_100000245 | 3300005436 | Bacteria | 35800 |
| 52 | Ga0070713_100016747 | 3300005436 | Bacteria | 5519 |
| 53 | Ga0070713_100025557 | 3300005436 | Bacteria | 4618 |
| 54 | Ga0070713_100149844 | 3300005436 | Bacteria | 2074 |
| 55 | Ga0070710_10043325 | 3300005437 | Bacteria | 2492 |
| 56 | Ga0070701_10003369 | 3300005438 | Bacteria | 6315 |
| 57 | Ga0070711_100027797 | 3300005439 | Bacteria | 3716 |
| 58 | Ga0070705_100002078 | 3300005440 | Bacteria | 10221 |
| 59 | Ga0070705_100005843 | 3300005440 | Bacteria | 6019 |
| 60 | Ga0070705_100113820 | 3300005440 | Bacteria | 1734 |
| 61 | Ga0070700_100004325 | 3300005441 | Bacteria | 7411 |
| 62 | Ga0070700_100087074 | 3300005441 | Bacteria | 2030 |
| 63 | Ga0070694_100001894 | 3300005444 | Bacteria | 12395 |
| 64 | Ga0070694_100097568 | 3300005444 | Bacteria | 2073 |
| 65 | Ga0070708_100028650 | 3300005445 | Bacteria | 4795 |
| 66 | Ga0070708_100149757 | 3300005445 | Bacteria | 2169 |
| 67 | Ga0070678_100007972 | 3300005456 | Bacteria | 6314 |
| 68 | Ga0070678_100172493 | 3300005456 | Bacteria | 1763 |
| 69 | Ga0070662_100005485 | 3300005457 | Bacteria | 8108 |
| 70 | Ga0070681_10145961 | 3300005458 | Bacteria | 2295 |
| 71 | Ga0068867_100005732 | 3300005459 | Bacteria | 8810 |
| 72 | Ga0068867_100028185 | 3300005459 | Bacteria | 4042 |
| 73 | Ga0070685_10000448 | 3300005466 | Bacteria | 23992 |
| 74 | Ga0070706_100037877 | 3300005467 | Bacteria | 4452 |
| 75 | Ga0070707_100367534 | 3300005468 | Bacteria | 1397 |
| 76 | Ga0070699_100044652 | 3300005518 | Bacteria | 3836 |
| 77 | Ga0070679_100027662 | 3300005530 | Bacteria | 5582 |
| 78 | Ga0070679_100045246 | 3300005530 | Bacteria | 4387 |
| 79 | Ga0070679_100052746 | 3300005530 | Bacteria | 4049 |
| 80 | Ga0070679_100530988 | 3300005530 | Bacteria | 1120 |
| 81 | Ga0070684_100016572 | 3300005535 | Bacteria | 6026 |
| 82 | Ga0070697_100157407 | 3300005536 | Bacteria | 1918 |
| 83 | Ga0068853_100013146 | 3300005539 | Bacteria | 6756 |
| 84 | Ga0068853_100042965 | 3300005539 | Bacteria | 3866 |
| 85 | Ga0068853_100195839 | 3300005539 | Bacteria | 1838 |
| 86 | Ga0070672_100070832 | 3300005543 | Bacteria | 2772 |
| 87 | Ga0070686_100002471 | 3300005544 | Bacteria | 10187 |
| 88 | Ga0070686_100054878 | 3300005544 | Bacteria | 2550 |
| 89 | Ga0070695_100003461 | 3300005545 | Bacteria | 9223 |
| 90 | Ga0070695_100107440 | 3300005545 | Bacteria | 1888 |
| 91 | Ga0070696_100002305 | 3300005546 | Bacteria | 12593 |
| 92 | Ga0070696_100003044 | 3300005546 | Bacteria | 11138 |
| 93 | Ga0070693_100001109 | 3300005547 | Bacteria | 12086 |
| 94 | Ga0070693_100001266 | 3300005547 | Bacteria | 11435 |
| 95 | Ga0070704_100003882 | 3300005549 | Bacteria | 8604 |
| 96 | Ga0070704_100179606 | 3300005549 | Bacteria | 1691 |
| 97 | Ga0068855_100006508 | 3300005563 | Bacteria | 14206 |
| 98 | Ga0068855_100016235 | 3300005563 | Bacteria | 8954 |
| 99 | Ga0068855_100017636 | 3300005563 | Bacteria | 8584 |
| 100 | Ga0068855_100051761 | 3300005563 | Bacteria | 4837 |
| 101 | Ga0068855_100073398 | 3300005563 | Bacteria | 3975 |
| 102 | Ga0070664_100000157 | 3300005564 | Bacteria | 47128 |
| 103 | Ga0070664_100211943 | 3300005564 | Bacteria | 1731 |
| 104 | Ga0068857_100003114 | 3300005577 | Bacteria | 13726 |
| 105 | Ga0068854_100001475 | 3300005578 | Bacteria | 14240 |
| 106 | Ga0068854_100003215 | 3300005578 | Bacteria | 10192 |
| 107 | Ga0068854_100022691 | 3300005578 | Bacteria | 4282 |
| 108 | Ga0068856_100002108 | 3300005614 | Bacteria | 20635 |
| 109 | Ga0068856_100379201 | 3300005614 | Bacteria | 1433 |
| 110 | Ga0070702_100003013 | 3300005615 | Bacteria | 7447 |
| 111 | Ga0070702_100190369 | 3300005615 | Bacteria | 1350 |
| 112 | Ga0070702_100193765 | 3300005615 | Bacteria | 1339 |
| 113 | Ga0068852_100001236 | 3300005616 | Bacteria | 17018 |
| 114 | Ga0068852_100018602 | 3300005616 | Bacteria | 5475 |
| 115 | Ga0068852_100024227 | 3300005616 | Bacteria | 4901 |
| 116 | Ga0068852_100099422 | 3300005616 | Bacteria | 2622 |
| 117 | Ga0068852_100166378 | 3300005616 | Bacteria | 2063 |
| 118 | Ga0068852_100335603 | 3300005616 | Bacteria | 1472 |
| 119 | Ga0068859_100001470 | 3300005617 | Bacteria | 24006 |
| 120 | Ga0068859_100006424 | 3300005617 | Bacteria | 11926 |
| 121 | Ga0068859_100046798 | 3300005617 | Bacteria | 4344 |
| 122 | Ga0068859_100080768 | 3300005617 | Bacteria | 3293 |
| 123 | Ga0068864_100000854 | 3300005618 | Bacteria | 25707 |
| 124 | Ga0068864_100004243 | 3300005618 | Bacteria | 11795 |
| 125 | Ga0068864_100022813 | 3300005618 | Bacteria | 5250 |
| 126 | Ga0068866_10000959 | 3300005718 | Bacteria | 12686 |
| 127 | Ga0068866_10068561 | 3300005718 | Bacteria | 1866 |
| 128 | Ga0068861_100001299 | 3300005719 | Bacteria | 15627 |
| 129 | Ga0068861_100001821 | 3300005719 | Bacteria | 13736 |
| 130 | Ga0068861_100005158 | 3300005719 | Bacteria | 8814 |
| 131 | Ga0068851_10026978 | 3300005834 | Bacteria | 2827 |
| 132 | Ga0068851_10056578 | 3300005834 | Bacteria | 2001 |
| 133 | Ga0068851_10145535 | 3300005834 | Bacteria | 1292 |
| 134 | Ga0068870_10016278 | 3300005840 | Bacteria | 3549 |
| 135 | Ga0068870_10122531 | 3300005840 | Bacteria | 1500 |
| 136 | Ga0068863_100010525 | 3300005841 | Bacteria | 8981 |
| 137 | Ga0068863_100010697 | 3300005841 | Bacteria | 8911 |
| 138 | Ga0068863_100083294 | 3300005841 | Bacteria | 3031 |
| 139 | Ga0068863_100104969 | 3300005841 | Bacteria | 2688 |
| 140 | Ga0068858_100003231 | 3300005842 | Bacteria | 16256 |
| 141 | Ga0068858_100004095 | 3300005842 | Bacteria | 14365 |
| 142 | Ga0068858_100016904 | 3300005842 | Bacteria | 6850 |
| 143 | Ga0068858_100022830 | 3300005842 | Bacteria | 5835 |
| 144 | Ga0068860_100004201 | 3300005843 | Bacteria | 14760 |
| 145 | Ga0068860_100005275 | 3300005843 | Bacteria | 13119 |
| 146 | Ga0068860_100014167 | 3300005843 | Bacteria | 7820 |
| 147 | Ga0068860_100155685 | 3300005843 | Bacteria | 2202 |
| 148 | Ga0068862_100002444 | 3300005844 | Bacteria | 16490 |
| 149 | Ga0068862_100076096 | 3300005844 | Bacteria | 2904 |
| 150 | Ga0081539_10000259 | 3300005985 | Bacteria | 121997 |
| 151 | Ga0070712_100006268 | 3300006175 | Bacteria | 7368 |
| 152 | Ga0070712_100346605 | 3300006175 | Bacteria | 1214 |
| 153 | Ga0075367_10190991 | 3300006178 | Bacteria | 1278 |
| 154 | Ga0097621_100023572 | 3300006237 | Bacteria | 4793 |
| 155 | Ga0097621_100026853 | 3300006237 | Bacteria | 4522 |
| 156 | Ga0097621_100030851 | 3300006237 | Bacteria | 4247 |
| 157 | Ga0097621_100152468 | 3300006237 | Bacteria | 1982 |
| 158 | Ga0068871_100006330 | 3300006358 | Bacteria | 8365 |
| 159 | Ga0068871_100053039 | 3300006358 | Bacteria | 3286 |
| 160 | Ga0068871_100218732 | 3300006358 | Bacteria | 1649 |
| 161 | Ga0068871_100336341 | 3300006358 | Bacteria | 1332 |
| 162 | Ga0075428_100002197 | 3300006844 | Bacteria | 21099 |
| 163 | Ga0075428_100004095 | 3300006844 | Bacteria | 16048 |
| 164 | Ga0075433_10001178 | 3300006852 | Bacteria | 18995 |
| 165 | Ga0075434_100000065 | 3300006871 | Bacteria | 54115 |
| 166 | Ga0075434_100001217 | 3300006871 | Bacteria | 21379 |
| 167 | Ga0075429_100004896 | 3300006880 | Bacteria | 11538 |
| 168 | Ga0068865_100003091 | 3300006881 | Bacteria | 9960 |
| 169 | Ga0068865_100004151 | 3300006881 | Bacteria | 8711 |
| 170 | Ga0068865_100092953 | 3300006881 | Bacteria | 2192 |
| 171 | Ga0068865_100195530 | 3300006881 | Bacteria | 1567 |
| 172 | Ga0075436_100000205 | 3300006914 | Bacteria | 36621 |
| 173 | Ga0075436_100003082 | 3300006914 | Bacteria | 11419 |
| 174 | Ga0075436_100004957 | 3300006914 | Bacteria | 9151 |
| 175 | Ga0075436_100010808 | 3300006914 | Bacteria | 6263 |
| 176 | Ga0075436_100268977 | 3300006914 | Bacteria | 1217 |
| 177 | Ga0097620_100001470 | 3300006931 | Bacteria | 24006 |
| 178 | Ga0097620_100006424 | 3300006931 | Bacteria | 11926 |
| 179 | Ga0097620_100046798 | 3300006931 | Bacteria | 4344 |
| 180 | Ga0097620_100080769 | 3300006931 | Bacteria | 3293 |
| 181 | Ga0075435_100000549 | 3300007076 | Bacteria | 23038 |
| 182 | Ga0075435_100040049 | 3300007076 | Bacteria | 3741 |
| 183 | Ga0099794_10235953 | 3300007265 | Bacteria | 942 |
| 184 | Ga0105240_10001136 | 3300009093 | Bacteria | 46645 |
| 185 | Ga0105240_10009467 | 3300009093 | Bacteria | 13793 |
| 186 | Ga0105240_10015704 | 3300009093 | Bacteria | 10276 |
| 187 | Ga0105240_10048926 | 3300009093 | Bacteria | 5341 |
| 188 | Ga0105240_10113094 | 3300009093 | Bacteria | 3281 |
| 189 | Ga0111539_10002089 | 3300009094 | Bacteria | 26701 |
| 190 | Ga0105245_10000259 | 3300009098 | Bacteria | 50388 |
| 191 | Ga0105245_10058242 | 3300009098 | Bacteria | 3477 |
| 192 | Ga0105245_10067338 | 3300009098 | Bacteria | 3243 |
| 193 | Ga0105245_10108480 | 3300009098 | Bacteria | 2578 |
| 194 | Ga0105245_10189223 | 3300009098 | Bacteria | 1971 |
| 195 | Ga0105245_10198774 | 3300009098 | Bacteria | 1924 |
| 196 | Ga0105245_10404843 | 3300009098 | Bacteria | 1364 |
| 197 | Ga0105247_10014150 | 3300009101 | Bacteria | 4786 |
| 198 | Ga0105247_10031558 | 3300009101 | Bacteria | 3215 |
| 199 | Ga0114129_10320646 | 3300009147 | Bacteria | 2060 |
| 200 | Ga0105243_10004311 | 3300009148 | Bacteria | 11260 |
| 201 | Ga0105243_10042561 | 3300009148 | Bacteria | 3556 |
| 202 | Ga0105243_10046246 | 3300009148 | Bacteria | 3423 |
| 203 | Ga0105243_10121867 | 3300009148 | Bacteria | 2200 |
| 204 | Ga0105243_10350316 | 3300009148 | Bacteria | 1356 |
| 205 | Ga0105241_10004693 | 3300009174 | Bacteria | 10089 |
| 206 | Ga0105241_10055443 | 3300009174 | Bacteria | 3037 |
| 207 | Ga0105241_10191479 | 3300009174 | Bacteria | 1703 |
| 208 | Ga0105241_10326835 | 3300009174 | Bacteria | 1324 |
| 209 | Ga0105242_10003634 | 3300009176 | Bacteria | 12007 |
| 210 | Ga0105242_10012888 | 3300009176 | Bacteria | 6444 |
| 211 | Ga0105248_10006620 | 3300009177 | Bacteria | 12697 |
| 212 | Ga0105248_10247854 | 3300009177 | Bacteria | 2005 |
| 213 | Ga0105248_10327962 | 3300009177 | Bacteria | 1724 |
| 214 | Ga0105237_10041719 | 3300009545 | Bacteria | 4627 |
| 215 | Ga0105238_10000203 | 3300009551 | Bacteria | 65825 |
| 216 | Ga0105238_10056938 | 3300009551 | Bacteria | 3921 |
| 217 | Ga0105238_10299634 | 3300009551 | Bacteria | 1591 |
| 218 | Ga0105238_10328759 | 3300009551 | Bacteria | 1515 |
| 219 | Ga0105249_10003563 | 3300009553 | Bacteria | 13472 |
| 220 | Ga0105239_10331299 | 3300010375 | Bacteria | 1717 |
| 221 | Ga0105239_10607546 | 3300010375 | Bacteria | 1248 |
| 222 | Ga0105239_10610787 | 3300010375 | Bacteria | 1244 |
| 223 | Ga0157371_10090273 | 3300013102 | Bacteria | 2171 |
| 224 | Ga0157370_10057443 | 3300013104 | Bacteria | 3700 |
| 225 | Ga0157369_10005296 | 3300013105 | Bacteria | 15032 |
| 226 | Ga0157369_10102335 | 3300013105 | Bacteria | 3052 |
| 227 | Ga0157374_10000569 | 3300013296 | Bacteria | 32720 |
| 228 | Ga0157374_10260731 | 3300013296 | Bacteria | 1707 |
| 229 | Ga0157374_10479420 | 3300013296 | Bacteria | 1247 |
| 230 | Ga0157378_10002071 | 3300013297 | Bacteria | 17952 |
| 231 | Ga0157378_10007333 | 3300013297 | Bacteria | 9633 |
| 232 | Ga0157378_10074140 | 3300013297 | Bacteria | 3062 |
| 233 | Ga0157378_10293819 | 3300013297 | Bacteria | 1570 |
| 234 | Ga0163162_10150317 | 3300013306 | Bacteria | 2446 |
| 235 | Ga0163162_10205008 | 3300013306 | Bacteria | 2101 |
| 236 | Ga0163162_10396723 | 3300013306 | Bacteria | 1512 |
| 237 | Ga0157372_10003769 | 3300013307 | Bacteria | 16282 |
| 238 | Ga0157372_10004219 | 3300013307 | Bacteria | 15376 |
| 239 | Ga0157372_10518955 | 3300013307 | Bacteria | 1389 |
| 240 | Ga0157375_10042896 | 3300013308 | Bacteria | 4382 |
| 241 | Ga0163163_10031354 | 3300014325 | Bacteria | 5130 |
| 242 | Ga0163163_10206317 | 3300014325 | Bacteria | 2014 |
| 243 | Ga0163163_10391932 | 3300014325 | Bacteria | 1447 |
| 244 | Ga0157380_10091197 | 3300014326 | Bacteria | 2515 |
| 245 | Ga0157380_10141298 | 3300014326 | Bacteria | 2069 |
| 246 | Ga0182008_10056180 | 3300014497 | Bacteria | 1946 |
| 247 | Ga0157379_10001798 | 3300014968 | Bacteria | 17673 |
| 248 | Ga0157379_10010180 | 3300014968 | Bacteria | 8192 |
| 249 | Ga0157379_10041206 | 3300014968 | Bacteria | 4123 |
| 250 | Ga0157379_10172794 | 3300014968 | Bacteria | 1950 |
| 251 | Ga0157376_10007668 | 3300014969 | Bacteria | 7728 |
| 252 | Ga0157376_10139434 | 3300014969 | Bacteria | 2173 |
| 253 | Ga0157376_10256005 | 3300014969 | Bacteria | 1637 |
| 254 | Ga0163161_10078847 | 3300017792 | Bacteria | 2421 |
| 255 | Ga0163161_10215238 | 3300017792 | Bacteria | 1486 |
| 256 | Ga0213871_10013985 | 3300021441 | Bacteria | 1896 |
| 257 | Ga0209673_1004167 | 3300025273 | Bacteria | 7905 |
| 258 | Ga0209130_1022409 | 3300025284 | Bacteria | 1410 |
| 259 | Ga0207656_10077202 | 3300025321 | Bacteria | 1491 |
| 260 | Ga0207692_10005600 | 3300025898 | Bacteria | 5042 |
| 261 | Ga0207710_10024820 | 3300025900 | Bacteria | 2584 |
| 262 | Ga0207688_10040709 | 3300025901 | Bacteria | 2583 |
| 263 | Ga0207688_10211807 | 3300025901 | Bacteria | 1164 |
| 264 | Ga0207680_10077051 | 3300025903 | Bacteria | 2084 |
| 265 | Ga0207699_10042304 | 3300025906 | Bacteria | 2638 |
| 266 | Ga0207699_10059978 | 3300025906 | Bacteria | 2282 |
| 267 | Ga0207645_10020661 | 3300025907 | Bacteria | 4306 |
| 268 | Ga0207705_10123185 | 3300025909 | Bacteria | 1925 |
| 269 | Ga0207684_10171613 | 3300025910 | Bacteria | 1869 |
| 270 | Ga0207654_10058906 | 3300025911 | Bacteria | 2238 |
| 271 | Ga0207707_10069557 | 3300025912 | Bacteria | 3068 |
| 272 | Ga0207707_10148398 | 3300025912 | Bacteria | 2050 |
| 273 | Ga0207695_10024731 | 3300025913 | Bacteria | 6745 |
| 274 | Ga0207695_10034455 | 3300025913 | Bacteria | 5506 |
| 275 | Ga0207695_10042211 | 3300025913 | Bacteria | 4875 |
| 276 | Ga0207695_10053153 | 3300025913 | Bacteria | 4238 |
| 277 | Ga0207671_10190939 | 3300025914 | Bacteria | 1597 |
| 278 | Ga0207693_10000075 | 3300025915 | Bacteria | 88428 |
| 279 | Ga0207693_10001554 | 3300025915 | Bacteria | 20275 |
| 280 | Ga0207693_10255815 | 3300025915 | Bacteria | 1374 |
| 281 | Ga0207663_10002965 | 3300025916 | Bacteria | 8209 |
| 282 | Ga0207663_10020999 | 3300025916 | Bacteria | 3709 |
| 283 | Ga0207663_10071494 | 3300025916 | Bacteria | 2239 |
| 284 | Ga0207660_10005344 | 3300025917 | Bacteria | 8344 |
| 285 | Ga0207662_10000106 | 3300025918 | Bacteria | 40137 |
| 286 | Ga0207662_10233157 | 3300025918 | Bacteria | 1203 |
| 287 | Ga0207657_10010554 | 3300025919 | Bacteria | 9210 |
| 288 | Ga0207652_10021349 | 3300025921 | Bacteria | 5345 |
| 289 | Ga0207652_10024991 | 3300025921 | Bacteria | 4961 |
| 290 | Ga0207652_10198398 | 3300025921 | Bacteria | 1806 |
| 291 | Ga0207646_10325852 | 3300025922 | Bacteria | 1388 |
| 292 | Ga0207681_10046892 | 3300025923 | Bacteria | 2908 |
| 293 | Ga0207681_10067542 | 3300025923 | Bacteria | 2479 |
| 294 | Ga0207681_10096479 | 3300025923 | Bacteria | 2123 |
| 295 | Ga0207694_10010215 | 3300025924 | Bacteria | 7078 |
| 296 | Ga0207694_10080531 | 3300025924 | Bacteria | 2556 |
| 297 | Ga0207694_10292142 | 3300025924 | Bacteria | 1341 |
| 298 | Ga0207650_10002704 | 3300025925 | Bacteria | 12244 |
| 299 | Ga0207650_10003970 | 3300025925 | Bacteria | 10126 |
| 300 | Ga0207650_10017333 | 3300025925 | Bacteria | 5041 |
| 301 | Ga0207659_10004187 | 3300025926 | Bacteria | 8711 |
| 302 | Ga0207659_10110902 | 3300025926 | Bacteria | 2085 |
| 303 | Ga0207659_10183670 | 3300025926 | Bacteria | 1659 |
| 304 | Ga0207687_10013013 | 3300025927 | Bacteria | 5435 |
| 305 | Ga0207687_10013670 | 3300025927 | Bacteria | 5300 |
| 306 | Ga0207687_10028354 | 3300025927 | Bacteria | 3762 |
| 307 | Ga0207687_10060485 | 3300025927 | Bacteria | 2672 |
| 308 | Ga0207687_10071198 | 3300025927 | Bacteria | 2484 |
| 309 | Ga0207700_10000182 | 3300025928 | Bacteria | 37846 |
| 310 | Ga0207700_10207399 | 3300025928 | Bacteria | 1655 |
| 311 | Ga0207664_10011875 | 3300025929 | Bacteria | 6213 |
| 312 | Ga0207664_10019166 | 3300025929 | Bacteria | 5052 |
| 313 | Ga0207644_10032208 | 3300025931 | Bacteria | 3655 |
| 314 | Ga0207706_10017469 | 3300025933 | Bacteria | 6465 |
| 315 | Ga0207686_10000195 | 3300025934 | Bacteria | 47027 |
| 316 | Ga0207686_10005506 | 3300025934 | Bacteria | 6796 |
| 317 | Ga0207686_10124526 | 3300025934 | Bacteria | 1759 |
| 318 | Ga0207709_10002789 | 3300025935 | Bacteria | 10758 |
| 319 | Ga0207709_10078074 | 3300025935 | Bacteria | 2124 |
| 320 | Ga0207709_10125493 | 3300025935 | Bacteria | 1740 |
| 321 | Ga0207670_10007642 | 3300025936 | Bacteria | 6051 |
| 322 | Ga0207670_10023793 | 3300025936 | Bacteria | 3818 |
| 323 | Ga0207670_10057827 | 3300025936 | Bacteria | 2632 |
| 324 | Ga0207670_10156552 | 3300025936 | Bacteria | 1697 |
| 325 | Ga0207670_10399836 | 3300025936 | Bacteria | 1098 |
| 326 | Ga0207669_10330695 | 3300025937 | Bacteria | 1170 |
| 327 | Ga0207704_10002100 | 3300025938 | Bacteria | 8926 |
| 328 | Ga0207704_10007178 | 3300025938 | Bacteria | 5245 |
| 329 | Ga0207691_10062120 | 3300025940 | Bacteria | 3391 |
| 330 | Ga0207691_10076321 | 3300025940 | Bacteria | 3020 |
| 331 | Ga0207711_10000092 | 3300025941 | Bacteria | 95507 |
| 332 | Ga0207711_10151572 | 3300025941 | Bacteria | 2092 |
| 333 | Ga0207689_10002122 | 3300025942 | Bacteria | 18651 |
| 334 | Ga0207689_10004637 | 3300025942 | Bacteria | 12436 |
| 335 | Ga0207689_10014709 | 3300025942 | Bacteria | 6645 |
| 336 | Ga0207689_10148350 | 3300025942 | Bacteria | 1933 |
| 337 | Ga0207689_10202626 | 3300025942 | Bacteria | 1638 |
| 338 | Ga0207661_10062617 | 3300025944 | Bacteria | 3010 |
| 339 | Ga0207667_10008844 | 3300025949 | Bacteria | 11919 |
| 340 | Ga0207667_10023786 | 3300025949 | Bacteria | 6742 |
| 341 | Ga0207667_10052223 | 3300025949 | Bacteria | 4306 |
| 342 | Ga0207667_10077282 | 3300025949 | Bacteria | 3453 |
| 343 | Ga0207667_10276358 | 3300025949 | Bacteria | 1717 |
| 344 | Ga0207651_10064128 | 3300025960 | Bacteria | 2569 |
| 345 | Ga0207712_10006365 | 3300025961 | Bacteria | 7452 |
| 346 | Ga0207712_10023826 | 3300025961 | Bacteria | 4045 |
| 347 | Ga0207668_10029406 | 3300025972 | Bacteria | 3601 |
| 348 | Ga0207640_10004437 | 3300025981 | Bacteria | 7612 |
| 349 | Ga0207640_10030353 | 3300025981 | Bacteria | 3327 |
| 350 | Ga0207640_10558986 | 3300025981 | Bacteria | 963 |
| 351 | Ga0207658_10021671 | 3300025986 | Bacteria | 4464 |
| 352 | Ga0207677_10000477 | 3300026023 | Bacteria | 26249 |
| 353 | Ga0207677_10001868 | 3300026023 | Bacteria | 11132 |
| 354 | Ga0207677_10013156 | 3300026023 | Bacteria | 4784 |
| 355 | Ga0207703_10000942 | 3300026035 | Bacteria | 28226 |
| 356 | Ga0207703_10001714 | 3300026035 | Bacteria | 19689 |
| 357 | Ga0207703_10003689 | 3300026035 | Bacteria | 12755 |
| 358 | Ga0207703_10030057 | 3300026035 | Bacteria | 4291 |
| 359 | Ga0207703_10048497 | 3300026035 | Bacteria | 3429 |
| 360 | Ga0207703_10654143 | 3300026035 | Bacteria | 997 |
| 361 | Ga0207639_10005827 | 3300026041 | Bacteria | 8345 |
| 362 | Ga0207639_10095143 | 3300026041 | Bacteria | 2393 |
| 363 | Ga0207708_10022592 | 3300026075 | Bacteria | 4750 |
| 364 | Ga0207708_10134783 | 3300026075 | Bacteria | 1933 |
| 365 | Ga0207702_10022972 | 3300026078 | Bacteria | 5174 |
| 366 | Ga0207702_10050328 | 3300026078 | Bacteria | 3518 |
| 367 | Ga0207702_10086936 | 3300026078 | Bacteria | 2727 |
| 368 | Ga0207641_10006778 | 3300026088 | Bacteria | 9598 |
| 369 | Ga0207641_10061930 | 3300026088 | Bacteria | 3191 |
| 370 | Ga0207641_10191461 | 3300026088 | Bacteria | 1880 |
| 371 | Ga0207648_10000432 | 3300026089 | Bacteria | 46265 |
| 372 | Ga0207648_10005290 | 3300026089 | Bacteria | 13022 |
| 373 | Ga0207676_10000097 | 3300026095 | Bacteria | 78464 |
| 374 | Ga0207674_10006739 | 3300026116 | Bacteria | 13485 |
| 375 | Ga0207674_10007170 | 3300026116 | Bacteria | 13019 |
| 376 | Ga0207675_100003477 | 3300026118 | Bacteria | 15386 |
| 377 | Ga0207675_100010235 | 3300026118 | Bacteria | 8789 |
| 378 | Ga0207675_100012122 | 3300026118 | Bacteria | 8054 |
| 379 | Ga0207675_100279452 | 3300026118 | Bacteria | 1622 |
| 380 | Ga0207683_10004473 | 3300026121 | Bacteria | 12066 |
| 381 | Ga0207683_10181180 | 3300026121 | Bacteria | 1910 |
| 382 | Ga0207698_10000342 | 3300026142 | Bacteria | 27548 |
| 383 | Ga0207698_10010169 | 3300026142 | Bacteria | 6029 |
| 384 | Ga0207698_10031190 | 3300026142 | Bacteria | 3844 |
| 385 | Ga0207698_10062549 | 3300026142 | Bacteria | 2907 |
| 386 | Ga0207698_10065985 | 3300026142 | Bacteria | 2846 |
| 387 | Ga0207698_10094591 | 3300026142 | Bacteria | 2457 |
| 388 | Ga0207428_10005555 | 3300027907 | Bacteria | 11742 |
| 389 | Ga0207428_10029949 | 3300027907 | Bacteria | 4502 |
| 390 | Ga0268265_10003603 | 3300028380 | Bacteria | 11062 |
| 391 | Ga0268265_10004946 | 3300028380 | Bacteria | 9159 |
| 392 | Ga0268264_10002492 | 3300028381 | Bacteria | 16186 |
| 393 | Ga0268264_10003797 | 3300028381 | Bacteria | 12956 |
| 394 | Ga0268264_10005206 | 3300028381 | Bacteria | 11019 |
| 395 | Ga0268264_10204893 | 3300028381 | Bacteria | 1807 |
| 396 | Ga0268264_10711753 | 3300028381 | Bacteria | 998 |
| 397 | Ga0307517_10173379 | 3300028786 | Bacteria | 1412 |
| 398 | Ga0265327_10008541 | 3300031251 | Bacteria | 7605 |
| 399 | Ga0307408_100153285 | 3300031548 | Bacteria | 1821 |
| 400 | Ga0307405_10016367 | 3300031731 | Bacteria | 4043 |
| 401 | Ga0307413_10025208 | 3300031824 | Bacteria | 3256 |
| 402 | Ga0307410_10031132 | 3300031852 | Bacteria | 3419 |
| 403 | Ga0307406_10011423 | 3300031901 | Bacteria | 5040 |
| 404 | Ga0307407_10007454 | 3300031903 | Bacteria | 4957 |
| 405 | Ga0307412_10009165 | 3300031911 | Bacteria | 5672 |
| 406 | Ga0307416_100002319 | 3300032002 | Bacteria | 10879 |
| 407 | Ga0307411_10124259 | 3300032005 | Bacteria | 1873 |
| 408 | Ga0307415_100014674 | 3300032126 | Bacteria | 4615 |
| 409 | Ga0307507_10032398 | 3300033179 | Bacteria | 5457 |
| 410 | Ga0307507_10185535 | 3300033179 | Bacteria | 1476 |
| 411 | Ga0307510_10017493 | 3300033180 | Bacteria | 8449 |
| 412 | Ga0373938_0005198 | 3300034957 | Bacteria | 2206 |
| 413 | Ga0373934_0012796 | 3300035086 | Bacteria | 3169 |
| 414 | Ga0373940_0007438 | 3300035088 | Bacteria | 2473 |
| 415 | Ga0373949_0015930 | 3300035090 | Bacteria | 1683 |
| 416 | Ga0373952_0031600 | 3300035092 | Bacteria | 1178 |
| 417 | Ga0373923_0001271 | 3300035111 | Bacteria | 7103 |
| 418 | Ga0373923_0018240 | 3300035111 | Bacteria | 2698 |
| 419 | Ga0373932_0003337 | 3300035112 | Bacteria | 3873 |
| 420 | Ga0373936_0004217 | 3300035113 | Bacteria | 5422 |
| 421 | Ga0373939_0006886 | 3300035114 | Bacteria | 2749 |
| 422 | Ga0373941_0047079 | 3300035115 | Bacteria | 1357 |
| 423 | Ga0373945_0058444 | 3300035116 | Bacteria | 1434 |
| 424 | Ga0373953_0017685 | 3300035117 | Bacteria | 2625 |
| 425 | Ga0373953_0031907 | 3300035117 | Bacteria | 2051 |
| 426 | Ga0373954_0001687 | 3300035118 | Bacteria | 9061 |
| 427 | Ga0373956_0057199 | 3300035119 | Bacteria | 1762 |
| 428 | Ga0373957_0005960 | 3300035120 | Bacteria | 3813 |
| 429 | Ga0373924_0002698 | 3300035410 | Bacteria | 5986 |
| 430 | Ga0373924_0103964 | 3300035410 | Bacteria | 1223 |
| 431 | Ga0373924_0118282 | 3300035410 | Bacteria | 1149 |
| 432 | Ga0373931_0006196 | 3300035691 | Bacteria | 5579 |
| 433 | Ga0373935_0015015 | 3300035692 | Bacteria | 4676 |
| 434 | Ga0373935_0075107 | 3300035692 | Bacteria | 2186 |
| 435 | Ga0373927_0004898 | 3300035695 | Bacteria | 9305 |
| 436 | Ga0373927_0032587 | 3300035695 | Bacteria | 3394 |
| 437 | Ga0373927_0043499 | 3300035695 | Bacteria | 2908 |
| 438 | Ga0373927_0143418 | 3300035695 | Bacteria | 1563 |
| 439 | Ga0373927_0210790 | 3300035695 | Bacteria | 1276 |
| 440 | Ga0373933_0009864 | 3300035724 | Bacteria | 5228 |
| 441 | Ga0373933_0068353 | 3300035724 | Bacteria | 2158 |
| 442 | Ga0373933_0147412 | 3300035724 | Bacteria | 1489 |
| 443 | Ga0373947_0015558 | 3300035725 | Bacteria | 4370 |
| 444 | Ga0373937_0000617 | 3300036401 | Bacteria | 31286 |
| 445 | Ga0373937_0009900 | 3300036401 | Bacteria | 8311 |
| 446 | Ga0373937_0010116 | 3300036401 | Bacteria | 8227 |
| 447 | Ga0373937_0026358 | 3300036401 | Bacteria | 5253 |
| 448 | Ga0373937_0137954 | 3300036401 | Bacteria | 2281 |
| 449 | Ga0373937_0174679 | 3300036401 | Bacteria | 2016 |
| 450 | Ga0373937_0196366 | 3300036401 | Bacteria | 1897 |
| 451 | Ga0373937_0203694 | 3300036401 | Bacteria | 1860 |
| 452 | Ga0373937_0240721 | 3300036401 | Bacteria | 1705 |
| 453 | Ga0373925_0001443 | 3300037068 | Bacteria | 20590 |
| 454 | Ga0373925_0013522 | 3300037068 | Bacteria | 5908 |
| 455 | Ga0373925_0019542 | 3300037068 | Bacteria | 4928 |
| 456 | Ga0373925_0144755 | 3300037068 | Bacteria | 1862 |
| 457 | Ga0373925_0152530 | 3300037068 | Bacteria | 1815 |
| 458 | Ga0373925_0186762 | 3300037068 | Bacteria | 1643 |
| 459 | Ga0373925_0228869 | 3300037068 | Bacteria | 1486 |
| 460 | Ga0395899_0006274 | 3300037312 | Bacteria | 9203 |
| 461 | Ga0395899_0281454 | 3300037312 | Bacteria | 1131 |
| 462 | Ga0395900_0017926 | 3300037418 | Bacteria | 7227 |
| 463 | Ga0395900_0032576 | 3300037418 | Bacteria | 5360 |
| 464 | Ga0395900_0069470 | 3300037418 | Bacteria | 3620 |
| 465 | Ga0395900_0367240 | 3300037418 | Bacteria | 1409 |
| 466 | Ga0395898_0009885 | 3300037466 | Bacteria | 10002 |
| 467 | Ga0395905_0013205 | 3300037471 | Bacteria | 7926 |
| 468 | Ga0395905_0373351 | 3300037471 | Bacteria | 1320 |
| 469 | Ga0395901_0157927 | 3300038443 | Bacteria | 2381 |
| 470 | Ga0436365_1126210 | 3300039437 | Bacteria | 3397 |
| 471 | Ga0436360_0943536 | 3300039438 | Bacteria | 1901 |
| 472 | Ga0451789_1198229 | 3300041443 | Bacteria | 1085 |
| 473 | Ga0439460_0031819 | 3300042461 | Bacteria | 1507 |
| 474 | Ga0451577_0062496 | 3300042876 | Bacteria | 3321 |
| 475 | Ga0451577_0099606 | 3300042876 | Bacteria | 2596 |
| 476 | Ga0466972_0127299 | 3300044658 | Bacteria | 1200 |
| 477 | Ga0453683_0002535 | 3300044673 | Bacteria | 14099 |
| 478 | Ga0466965_0250933 | 3300044683 | Bacteria | 949 |
| 479 | Ga0451576_0005623 | 3300045051 | Bacteria | 15652 |
| 480 | Ga0451576_0265319 | 3300045051 | Bacteria | 1795 |
| 481 | Ga0451576_0320252 | 3300045051 | Bacteria | 1622 |
| 482 | Ga0495629_0111044 | 3300046459 | Bacteria | 1911 |
| 483 | Ga0495629_0370319 | 3300046459 | Bacteria | 976 |
| 484 | Ga0495651_0214143 | 3300046462 | Bacteria | 1338 |
| 485 | Ga0495653_0041235 | 3300046463 | Bacteria | 3604 |
| 486 | Ga0495653_0212882 | 3300046463 | Bacteria | 1304 |
| 487 | Ga0495580_0022959 | 3300046472 | Bacteria | 4587 |
| 488 | Ga0495580_0045319 | 3300046472 | Bacteria | 3124 |
| 489 | Ga0495582_0007568 | 3300046473 | Bacteria | 6005 |
| 490 | Ga0495582_0016966 | 3300046473 | Bacteria | 3987 |
| 491 | Ga0495582_0071100 | 3300046473 | Bacteria | 1925 |
| 492 | Ga0495639_0092210 | 3300046475 | Bacteria | 1422 |
| 493 | Ga0495664_0003053 | 3300046477 | Bacteria | 9068 |
| 494 | Ga0495664_0007319 | 3300046477 | Bacteria | 6126 |
| 495 | Ga0495664_0101414 | 3300046477 | Bacteria | 1734 |
| 496 | Ga0495608_0018027 | 3300046511 | Bacteria | 4877 |
| 497 | Ga0495608_0024516 | 3300046511 | Bacteria | 4123 |
| 498 | Ga0495608_0060111 | 3300046511 | Bacteria | 2501 |
| 499 | Ga0495608_0164152 | 3300046511 | Bacteria | 1411 |
| 500 | Ga0495618_0110079 | 3300046514 | Bacteria | 1764 |
| 501 | Ga0495618_0186227 | 3300046514 | Bacteria | 1318 |
| 502 | Ga0495618_0262736 | 3300046514 | Bacteria | 1081 |
| 503 | Ga0495628_0071714 | 3300046516 | Bacteria | 2699 |
| 504 | Ga0495628_0096061 | 3300046516 | Bacteria | 2290 |
| 505 | Ga0495628_0228026 | 3300046516 | Bacteria | 1397 |
| 506 | Ga0495628_0290812 | 3300046516 | Bacteria | 1211 |
| 507 | Ga0495666_0013392 | 3300046526 | Bacteria | 4090 |
| 508 | Ga0495652_0062389 | 3300046529 | Bacteria | 3143 |
| 509 | Ga0495652_0137533 | 3300046529 | Bacteria | 1925 |
| 510 | Ga0495652_0266012 | 3300046529 | Bacteria | 1263 |
| 511 | Ga0495665_0008093 | 3300046531 | Bacteria | 5702 |
| 512 | Ga0495640_0170817 | 3300046533 | Bacteria | 1389 |
| 513 | Ga0495586_0009428 | 3300046535 | Bacteria | 5196 |
| 514 | Ga0495587_0003341 | 3300046536 | Bacteria | 10703 |
| 515 | Ga0495621_0004002 | 3300046539 | Bacteria | 4100 |
| 516 | Ga0495645_0001840 | 3300046543 | Bacteria | 14412 |
| 517 | Ga0495645_0002129 | 3300046543 | Bacteria | 13443 |
| 518 | Ga0495667_0005117 | 3300046559 | Bacteria | 8859 |
| 519 | Ga0495667_0266350 | 3300046559 | Bacteria | 1089 |
| 520 | Ga0495634_0224160 | 3300046642 | Bacteria | 1159 |
| 521 | Ga0495634_0233051 | 3300046642 | Bacteria | 1132 |
| 522 | Ga0495635_0007041 | 3300046663 | Bacteria | 7858 |
| 523 | Ga0495635_0047336 | 3300046663 | Bacteria | 2966 |
| 524 | Ga0495659_0023080 | 3300046664 | Bacteria | 2111 |
| 525 | Ga0495588_0052636 | 3300046674 | Bacteria | 2099 |
| 526 | Ga0495657_0030305 | 3300046675 | Bacteria | 3791 |
| 527 | Ga0495657_0182231 | 3300046675 | Bacteria | 1288 |
| 528 | Ga0495599_0008663 | 3300046678 | Bacteria | 6190 |
| 529 | Ga0495599_0036601 | 3300046678 | Bacteria | 3083 |
| 530 | Ga0495623_0006686 | 3300046679 | Bacteria | 7503 |
| 531 | Ga0495623_0019336 | 3300046679 | Bacteria | 4404 |
| 532 | Ga0495623_0145446 | 3300046679 | Bacteria | 1406 |
| 533 | Ga0495646_0007881 | 3300046680 | Bacteria | 6763 |
| 534 | Ga0495646_0193073 | 3300046680 | Bacteria | 1112 |
| 535 | Ga0495647_0000090 | 3300046681 | Bacteria | 22381 |
| 536 | Ga0495647_0001373 | 3300046681 | Bacteria | 7513 |
| 537 | Ga0495647_0065975 | 3300046681 | Bacteria | 1438 |
| 538 | Ga0495658_0034842 | 3300046683 | Bacteria | 2764 |
| 539 | Ga0495658_0042701 | 3300046683 | Bacteria | 2532 |
| 540 | Ga0495613_0210490 | 3300046689 | Bacteria | 1368 |
| 541 | Ga0495581_0083140 | 3300047315 | Bacteria | 1854 |
| 542 | Ga0495604_0021483 | 3300047317 | Bacteria | 5153 |
| 543 | Ga0495674_0258116 | 3300047319 | Bacteria | 1432 |
| 544 | Ga0495676_0116064 | 3300047321 | Bacteria | 1956 |
| 545 | Ga0495680_0146658 | 3300047322 | Bacteria | 1723 |
| 546 | Ga0495680_0197139 | 3300047322 | Bacteria | 1446 |
| 547 | Ga0495680_0240673 | 3300047322 | Bacteria | 1285 |
| 548 | Ga0495675_0001066 | 3300047444 | Bacteria | 16664 |
| 549 | Ga0495675_0076048 | 3300047444 | Bacteria | 2116 |
| 550 | Ga0495675_0121505 | 3300047444 | Bacteria | 1626 |
| 551 | Ga0495675_0131935 | 3300047444 | Bacteria | 1552 |
| 552 | Ga0495681_0029983 | 3300047470 | Bacteria | 2777 |
| 553 | Ga0495684_0022823 | 3300047471 | Bacteria | 4813 |
| 554 | Ga0495684_0041179 | 3300047471 | Bacteria | 3540 |
| 555 | Ga0495684_0057820 | 3300047471 | Bacteria | 2955 |
| 556 | Ga0495593_0114237 | 3300047673 | Bacteria | 1377 |
| 557 | Ga0495602_0000223 | 3300048088 | Bacteria | 52927 |
| 558 | Ga0495602_0029198 | 3300048088 | Bacteria | 5260 |
| 559 | Ga0495602_0073820 | 3300048088 | Bacteria | 2902 |
| 560 | Ga0495602_0190070 | 3300048088 | Bacteria | 1575 |
| 561 | Ga0496100_0012926 | 3300048903 | Bacteria | 4800 |
| 562 | Ga0496101_0101900 | 3300048904 | Bacteria | 2150 |
| 563 | Ga0496102_0046330 | 3300048905 | Bacteria | 3949 |
| 564 | Ga0496104_0531076 | 3300048907 | Bacteria | 1087 |
| 565 | Ga0496105_0013888 | 3300048908 | Bacteria | 6399 |
| 566 | Ga0496105_0032134 | 3300048908 | Bacteria | 4306 |
| 567 | Ga0496108_0034123 | 3300048911 | Bacteria | 4228 |
| 568 | Ga0496108_0317920 | 3300048911 | Bacteria | 1357 |
| 569 | Ga0496109_0037699 | 3300048912 | Bacteria | 4368 |
| 570 | Ga0496109_0260485 | 3300048912 | Bacteria | 1633 |
| 571 | Ga0496110_0169794 | 3300048913 | Bacteria | 1979 |
| 572 | Ga0496111_0111208 | 3300048914 | Bacteria | 2018 |
| 573 | Ga0496112_0001692 | 3300048915 | Bacteria | 17195 |
| 574 | Ga0496112_0103601 | 3300048915 | Bacteria | 2816 |
| 575 | Ga0496115_0007448 | 3300048918 | Bacteria | 8055 |
| 576 | Ga0496115_0104555 | 3300048918 | Bacteria | 2324 |
| 577 | Ga0496119_0016001 | 3300048922 | Bacteria | 5733 |
| 578 | Ga0501034_0024597 | 3300049571 | Bacteria | 6126 |
| 579 | Ga0501036_0212590 | 3300049572 | Bacteria | 1625 |
| 580 | Ga0501038_0471173 | 3300049574 | Bacteria | 963 |
| 581 | Ga0501039_0095895 | 3300049575 | Bacteria | 2313 |
| 582 | Ga0501039_0362219 | 3300049575 | Bacteria | 1139 |
| 583 | Ga0501041_0014368 | 3300049577 | Bacteria | 4701 |
| 584 | Ga0501043_0051968 | 3300049579 | Bacteria | 3220 |
| 585 | Ga0501046_0004878 | 3300049580 | Bacteria | 12085 |
| 586 | Ga0501047_0048945 | 3300049581 | Bacteria | 4081 |
| 587 | Ga0501047_0093104 | 3300049581 | Bacteria | 2893 |
| 588 | Ga0501072_0003747 | 3300049588 | Bacteria | 11471 |
| 589 | Ga0501072_0018302 | 3300049588 | Bacteria | 5392 |
| 590 | Ga0501074_0138669 | 3300049590 | Bacteria | 1740 |
| 591 | Ga0501075_0031987 | 3300049591 | Bacteria | 3908 |
| 592 | Ga0501076_0000393 | 3300049592 | Bacteria | 27377 |
| 593 | Ga0501080_0101510 | 3300049742 | Bacteria | 2669 |
| 594 | Ga0501044_0245593 | 3300049823 | Bacteria | 1733 |
| 595 | Ga0501044_0470233 | 3300049823 | Bacteria | 1161 |
| 596 | Ga0501045_0002454 | 3300049824 | Bacteria | 12609 |
| 597 | nmdc:mga05p37_5610_c1 | 3300050507 | Bacteria | 14749 |
| 598 | nmdc:mga05p37_587852_c1 | 3300050507 | Unclassified | 1259 |
| 599 | nmdc:mga09592_233661_c1 | 3300050508 | Bacteria | 1593 |
| 600 | nmdc:mga09592_4157_c1 | 3300050508 | Bacteria | 11694 |
| 601 | nmdc:mga08y16_5051_c1 | 3300050511 | Bacteria | 13793 |
| 602 | nmdc:mga08y16_9559_c1 | 3300050511 | Bacteria | 10179 |
| 603 | nmdc:mga0n895_193932_c1 | 3300050512 | Bacteria | 2062 |
| 604 | nmdc:mga0n895_310158_c1 | 3300050512 | Bacteria | 1599 |
| 605 | nmdc:mga0n895_84_c1 | 3300050512 | Bacteria | 54345 |
| 606 | nmdc:mga0rr50_31298_c1 | 3300050513 | Bacteria | 3777 |
| 607 | nmdc:mga0rr50_3216_c1 | 3300050513 | Bacteria | 9354 |
| 608 | nmdc:mga08x19_2051_c1 | 3300050514 | Bacteria | 12350 |
| 609 | nmdc:mga08x19_2433_c1 | 3300050514 | Bacteria | 11304 |
| 610 | nmdc:mga08x19_2749_c1 | 3300050514 | Bacteria | 10627 |
| 611 | nmdc:mga0a205_12231_c1 | 3300050515 | Bacteria | 7936 |
| 612 | nmdc:mga0a205_1704_c1 | 3300050515 | Bacteria | 18985 |
| 613 | nmdc:mga0a205_450508_c1 | 3300050515 | Bacteria | 1147 |
| 614 | Ga0495601_0000430 | 3300053077 | Bacteria | 21991 |
| 615 | Ga0495601_0021336 | 3300053077 | Bacteria | 3966 |
| 616 | Ga0495612_0000708 | 3300053078 | Bacteria | 13528 |
| 617 | Ga0495619_0012600 | 3300053085 | Bacteria | 5323 |
| 618 | Ga0495619_0147561 | 3300053085 | Bacteria | 1622 |
| 619 | Ga0500578_0000311 | 3300053086 | Bacteria | 59919 |
| 620 | Ga0500566_0170858 | 3300053094 | Bacteria | 1124 |
| 621 | Ga0500566_0182489 | 3300053094 | Bacteria | 1075 |
| 622 | Ga0500593_000131 | 3300053117 | Bacteria | 29789 |
| 623 | Ga0500645_000397 | 3300053730 | Bacteria | 30509 |
| 624 | Ga0500661_000702 | 3300055283 | Bacteria | 6241 |
| 625 | Ga0530510_0000048 | 3300061734 | Bacteria | 56268 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005334 | Ga0068869_100092721 | Ga0068869_1000927212 | 219 |
| 2 | 3300013308 | Ga0157375_10042896 | Ga0157375_100428963 | 220 |
| 3 | 3300044683 | Ga0466965_0250933 | Ga0466965_0250933_107_889 | 231 |
| 4 | 3300005331 | Ga0070670_100048071 | Ga0070670_1000480714 | 235 |
| 5 | 3300050512 | nmdc:mga0n895_193932_c1 | nmdc:mga0n895_193932_c1_987_1865 | 236 |
| 6 | 3300005355 | Ga0070671_100057316 | Ga0070671_1000573162 | 241 |
| 7 | 3300053094 | Ga0500566_0182489 | Ga0500566_0182489_128_1000 | 242 |
| 8 | 3300050515 | nmdc:mga0a205_450508_c1 | nmdc:mga0a205_450508_c1_48_854 | 243 |
| 9 | 3300053730 | Ga0500645_000397 | Ga0500645_000397_18244_19116 | 243 |
| 10 | 3300035088 | Ga0373940_0007438 | Ga0373940_0007438_1319_2128 | 244 |
| 11 | 3300035090 | Ga0373949_0015930 | Ga0373949_0015930_493_1302 | 244 |
| 12 | 3300035092 | Ga0373952_0031600 | Ga0373952_0031600_136_945 | 244 |
| 13 | 3300035112 | Ga0373932_0003337 | Ga0373932_0003337_572_1381 | 244 |
| 14 | 3300035115 | Ga0373941_0047079 | Ga0373941_0047079_505_1314 | 244 |
| 15 | 3300045051 | Ga0451576_0320252 | Ga0451576_0320252_441_1250 | 244 |
| 16 | 3300050513 | nmdc:mga0rr50_3216_c1 | nmdc:mga0rr50_3216_c1_8071_8880 | 244 |
| 17 | 3300050514 | nmdc:mga08x19_2749_c1 | nmdc:mga08x19_2749_c1_8851_9660 | 244 |
| 18 | 3300050515 | nmdc:mga0a205_1704_c1 | nmdc:mga0a205_1704_c1_4643_5452 | 244 |
| 19 | 3300025926 | Ga0207659_10183670 | Ga0207659_101836701 | 246 |
| 20 | 3300028786 | Ga0307517_10173379 | Ga0307517_101733792 | 246 |
| 21 | 3300010375 | Ga0105239_10607546 | Ga0105239_106075462 | 247 |
| 22 | 3300025916 | Ga0207663_10071494 | Ga0207663_100714942 | 247 |
| 23 | 3300035111 | Ga0373923_0018240 | Ga0373923_0018240_469_1311 | 247 |
| 24 | 3300036401 | Ga0373937_0026358 | Ga0373937_0026358_3993_4835 | 247 |
| 25 | 3300037068 | Ga0373925_0228869 | Ga0373925_0228869_623_1465 | 247 |
| 26 | 3300046462 | Ga0495651_0214143 | Ga0495651_0214143_119_961 | 247 |
| 27 | 3300046477 | Ga0495664_0003053 | Ga0495664_0003053_3854_4696 | 247 |
| 28 | 3300046511 | Ga0495608_0060111 | Ga0495608_0060111_354_1196 | 247 |
| 29 | 3300046529 | Ga0495652_0062389 | Ga0495652_0062389_732_1574 | 247 |
| 30 | 3300046533 | Ga0495640_0170817 | Ga0495640_0170817_305_1147 | 247 |
| 31 | 3300046536 | Ga0495587_0003341 | Ga0495587_0003341_9378_10220 | 247 |
| 32 | 3300046543 | Ga0495645_0001840 | Ga0495645_0001840_5305_6147 | 247 |
| 33 | 3300046663 | Ga0495635_0047336 | Ga0495635_0047336_1988_2830 | 247 |
| 34 | 3300046678 | Ga0495599_0008663 | Ga0495599_0008663_1031_1873 | 247 |
| 35 | 3300046679 | Ga0495623_0145446 | Ga0495623_0145446_393_1235 | 247 |
| 36 | 3300046680 | Ga0495646_0007881 | Ga0495646_0007881_2365_3207 | 247 |
| 37 | 3300047444 | Ga0495675_0001066 | Ga0495675_0001066_13611_14453 | 247 |
| 38 | 3300047471 | Ga0495684_0057820 | Ga0495684_0057820_10_852 | 247 |
| 39 | 3300048088 | Ga0495602_0000223 | Ga0495602_0000223_28952_29794 | 247 |
| 40 | 3300048088 | Ga0495602_0190070 | Ga0495602_0190070_719_1561 | 247 |
| 41 | 3300053077 | Ga0495601_0000430 | Ga0495601_0000430_8283_9125 | 247 |
| 42 | 3300053078 | Ga0495612_0000708 | Ga0495612_0000708_11819_12661 | 247 |
| 43 | 3300053085 | Ga0495619_0147561 | Ga0495619_0147561_160_1002 | 247 |
| 44 | 3300042876 | Ga0451577_0062496 | Ga0451577_0062496_1914_2768 | 248 |
| 45 | 3300005327 | Ga0070658_10031175 | Ga0070658_100311753 | 249 |
| 46 | 3300005563 | Ga0068855_100017636 | Ga0068855_1000176367 | 249 |
| 47 | 3300005616 | Ga0068852_100018602 | Ga0068852_1000186026 | 249 |
| 48 | 3300006178 | Ga0075367_10190991 | Ga0075367_101909911 | 249 |
| 49 | 3300009551 | Ga0105238_10056938 | Ga0105238_100569382 | 249 |
| 50 | 3300013105 | Ga0157369_10005296 | Ga0157369_100052966 | 249 |
| 51 | 3300013307 | Ga0157372_10003769 | Ga0157372_100037696 | 249 |
| 52 | 3300025924 | Ga0207694_10010215 | Ga0207694_100102153 | 249 |
| 53 | 3300025949 | Ga0207667_10077282 | Ga0207667_100772822 | 249 |
| 54 | 3300026035 | Ga0207703_10654143 | Ga0207703_106541431 | 249 |
| 55 | 3300026142 | Ga0207698_10010169 | Ga0207698_100101694 | 249 |
| 56 | 3300035692 | Ga0373935_0075107 | Ga0373935_0075107_1034_1858 | 249 |
| 57 | 3300035695 | Ga0373927_0143418 | Ga0373927_0143418_95_919 | 249 |
| 58 | 3300039437 | Ga0436365_1126210 | Ga0436365_1126210_2173_2997 | 249 |
| 59 | 3300005364 | Ga0070673_100189630 | Ga0070673_1001896302 | 250 |
| 60 | 3300009098 | Ga0105245_10189223 | Ga0105245_101892232 | 250 |
| 61 | 3300025942 | Ga0207689_10202626 | Ga0207689_102026262 | 250 |
| 62 | 3300031548 | Ga0307408_100153285 | Ga0307408_1001532852 | 250 |
| 63 | 3300031731 | Ga0307405_10016367 | Ga0307405_100163672 | 250 |
| 64 | 3300031824 | Ga0307413_10025208 | Ga0307413_100252081 | 250 |
| 65 | 3300031852 | Ga0307410_10031132 | Ga0307410_100311322 | 250 |
| 66 | 3300031901 | Ga0307406_10011423 | Ga0307406_100114231 | 250 |
| 67 | 3300031903 | Ga0307407_10007454 | Ga0307407_100074543 | 250 |
| 68 | 3300031911 | Ga0307412_10009165 | Ga0307412_100091658 | 250 |
| 69 | 3300032002 | Ga0307416_100002319 | Ga0307416_1000023191 | 250 |
| 70 | 3300032005 | Ga0307411_10124259 | Ga0307411_101242592 | 250 |
| 71 | 3300032126 | Ga0307415_100014674 | Ga0307415_1000146744 | 250 |
| 72 | 3300053086 | Ga0500578_0000311 | Ga0500578_0000311_34784_35662 | 250 |
| 73 | 3300053117 | Ga0500593_000131 | Ga0500593_000131_7284_8156 | 250 |
| 74 | 3300005262 | Ga0065165_1001592 | Ga0065165_100159223 | 251 |
| 75 | 3300006237 | Ga0097621_100026853 | Ga0097621_1000268532 | 251 |
| 76 | 3300006358 | Ga0068871_100336341 | Ga0068871_1003363412 | 251 |
| 77 | 3300009098 | Ga0105245_10058242 | Ga0105245_100582422 | 251 |
| 78 | 3300009098 | Ga0105245_10404843 | Ga0105245_104048432 | 251 |
| 79 | 3300009148 | Ga0105243_10350316 | Ga0105243_103503162 | 251 |
| 80 | 3300009176 | Ga0105242_10012888 | Ga0105242_100128883 | 251 |
| 81 | 3300009177 | Ga0105248_10247854 | Ga0105248_102478542 | 251 |
| 82 | 3300013296 | Ga0157374_10260731 | Ga0157374_102607312 | 251 |
| 83 | 3300013306 | Ga0163162_10396723 | Ga0163162_103967232 | 251 |
| 84 | 3300014325 | Ga0163163_10391932 | Ga0163163_103919322 | 251 |
| 85 | 3300014969 | Ga0157376_10139434 | Ga0157376_101394342 | 251 |
| 86 | 3300025273 | Ga0209673_1004167 | Ga0209673_10041678 | 251 |
| 87 | 3300025927 | Ga0207687_10060485 | Ga0207687_100604852 | 251 |
| 88 | 3300025934 | Ga0207686_10124526 | Ga0207686_101245262 | 251 |
| 89 | 3300035119 | Ga0373956_0057199 | Ga0373956_0057199_67_945 | 251 |
| 90 | 3300035724 | Ga0373933_0068353 | Ga0373933_0068353_368_1246 | 251 |
| 91 | 3300036401 | Ga0373937_0010116 | Ga0373937_0010116_4430_5308 | 251 |
| 92 | 3300046463 | Ga0495653_0041235 | Ga0495653_0041235_86_964 | 251 |
| 93 | 3300046477 | Ga0495664_0101414 | Ga0495664_0101414_630_1508 | 251 |
| 94 | 3300046511 | Ga0495608_0018027 | Ga0495608_0018027_3635_4513 | 251 |
| 95 | 3300046516 | Ga0495628_0071714 | Ga0495628_0071714_586_1464 | 251 |
| 96 | 3300046529 | Ga0495652_0137533 | Ga0495652_0137533_502_1380 | 251 |
| 97 | 3300046543 | Ga0495645_0002129 | Ga0495645_0002129_7225_8103 | 251 |
| 98 | 3300046642 | Ga0495634_0224160 | Ga0495634_0224160_47_925 | 251 |
| 99 | 3300046675 | Ga0495657_0030305 | Ga0495657_0030305_275_1153 | 251 |
| 100 | 3300046678 | Ga0495599_0036601 | Ga0495599_0036601_367_1245 | 251 |
| 101 | 3300046679 | Ga0495623_0006686 | Ga0495623_0006686_561_1439 | 251 |
| 102 | 3300046680 | Ga0495646_0193073 | Ga0495646_0193073_219_1097 | 251 |
| 103 | 3300047322 | Ga0495680_0146658 | Ga0495680_0146658_774_1652 | 251 |
| 104 | 3300047444 | Ga0495675_0131935 | Ga0495675_0131935_425_1303 | 251 |
| 105 | 3300047471 | Ga0495684_0022823 | Ga0495684_0022823_1162_2040 | 251 |
| 106 | 3300048088 | Ga0495602_0029198 | Ga0495602_0029198_2654_3532 | 251 |
| 107 | 3300053077 | Ga0495601_0021336 | Ga0495601_0021336_351_1229 | 251 |
| 108 | 3300053085 | Ga0495619_0012600 | Ga0495619_0012600_511_1389 | 251 |
| 109 | 3300005336 | Ga0070680_100466360 | Ga0070680_1004663601 | 252 |
| 110 | 3300005344 | Ga0070661_100155182 | Ga0070661_1001551822 | 252 |
| 111 | 3300025284 | Ga0209130_1022409 | Ga0209130_10224092 | 252 |
| 112 | 3300025928 | Ga0207700_10207399 | Ga0207700_102073992 | 252 |
| 113 | 3300041443 | Ga0451789_1198229 | Ga0451789_1198229_15_893 | 252 |
| 114 | 3300005333 | Ga0070677_10162312 | Ga0070677_101623121 | 253 |
| 115 | 3300013102 | Ga0157371_10090273 | Ga0157371_100902732 | 253 |
| 116 | 3300035695 | Ga0373927_0032587 | Ga0373927_0032587_933_1811 | 253 |
| 117 | 3300035695 | Ga0373927_0043499 | Ga0373927_0043499_731_1624 | 253 |
| 118 | 3300035724 | Ga0373933_0147412 | Ga0373933_0147412_64_951 | 253 |
| 119 | 3300036401 | Ga0373937_0137954 | Ga0373937_0137954_866_1753 | 253 |
| 120 | 3300037068 | Ga0373925_0152530 | Ga0373925_0152530_870_1748 | 253 |
| 121 | 3300005366 | Ga0070659_100228776 | Ga0070659_1002287762 | 255 |
| 122 | 3300005441 | Ga0070700_100087074 | Ga0070700_1000870742 | 255 |
| 123 | 3300005445 | Ga0070708_100028650 | Ga0070708_1000286501 | 255 |
| 124 | 3300005456 | Ga0070678_100172493 | Ga0070678_1001724932 | 255 |
| 125 | 3300005457 | Ga0070662_100005485 | Ga0070662_1000054858 | 255 |
| 126 | 3300005459 | Ga0068867_100028185 | Ga0068867_1000281854 | 255 |
| 127 | 3300005563 | Ga0068855_100051761 | Ga0068855_1000517612 | 255 |
| 128 | 3300005616 | Ga0068852_100335603 | Ga0068852_1003356032 | 255 |
| 129 | 3300005718 | Ga0068866_10068561 | Ga0068866_100685612 | 255 |
| 130 | 3300005719 | Ga0068861_100005158 | Ga0068861_10000515810 | 255 |
| 131 | 3300005842 | Ga0068858_100022830 | Ga0068858_10002283010 | 255 |
| 132 | 3300005843 | Ga0068860_100004201 | Ga0068860_10000420110 | 255 |
| 133 | 3300006881 | Ga0068865_100003091 | Ga0068865_10000309112 | 255 |
| 134 | 3300009093 | Ga0105240_10009467 | Ga0105240_100094672 | 255 |
| 135 | 3300009148 | Ga0105243_10046246 | Ga0105243_100462464 | 255 |
| 136 | 3300013297 | Ga0157378_10002071 | Ga0157378_1000207115 | 255 |
| 137 | 3300014326 | Ga0157380_10091197 | Ga0157380_100911972 | 255 |
| 138 | 3300014968 | Ga0157379_10172794 | Ga0157379_101727943 | 255 |
| 139 | 3300017792 | Ga0163161_10215238 | Ga0163161_102152382 | 255 |
| 140 | 3300025913 | Ga0207695_10024731 | Ga0207695_100247312 | 255 |
| 141 | 3300025923 | Ga0207681_10046892 | Ga0207681_100468924 | 255 |
| 142 | 3300025935 | Ga0207709_10078074 | Ga0207709_100780741 | 255 |
| 143 | 3300025938 | Ga0207704_10007178 | Ga0207704_100071788 | 255 |
| 144 | 3300025940 | Ga0207691_10076321 | Ga0207691_100763212 | 255 |
| 145 | 3300025949 | Ga0207667_10008844 | Ga0207667_100088448 | 255 |
| 146 | 3300025961 | Ga0207712_10023826 | Ga0207712_100238264 | 255 |
| 147 | 3300026035 | Ga0207703_10030057 | Ga0207703_100300576 | 255 |
| 148 | 3300026075 | Ga0207708_10134783 | Ga0207708_101347832 | 255 |
| 149 | 3300026089 | Ga0207648_10000432 | Ga0207648_100004324 | 255 |
| 150 | 3300026118 | Ga0207675_100012122 | Ga0207675_10001212210 | 255 |
| 151 | 3300026121 | Ga0207683_10181180 | Ga0207683_101811802 | 255 |
| 152 | 3300028381 | Ga0268264_10204893 | Ga0268264_102048932 | 255 |
| 153 | 3300035410 | Ga0373924_0118282 | Ga0373924_0118282_24_866 | 255 |
| 154 | 3300044673 | Ga0453683_0002535 | Ga0453683_0002535_1730_2611 | 255 |
| 155 | 3300045051 | Ga0451576_0005623 | Ga0451576_0005623_2508_3389 | 255 |
| 156 | 3300046689 | Ga0495613_0210490 | Ga0495613_0210490_68_946 | 255 |
| 157 | 3300033180 | Ga0307510_10017493 | Ga0307510_100174932 | 256 |
| 158 | 3300035117 | Ga0373953_0031907 | Ga0373953_0031907_66_953 | 256 |
| 159 | 3300035120 | Ga0373957_0005960 | Ga0373957_0005960_391_1278 | 256 |
| 160 | 3300035410 | Ga0373924_0103964 | Ga0373924_0103964_114_1001 | 256 |
| 161 | 3300035724 | Ga0373933_0009864 | Ga0373933_0009864_2333_3220 | 256 |
| 162 | 3300036401 | Ga0373937_0000617 | Ga0373937_0000617_12715_13602 | 256 |
| 163 | 3300046511 | Ga0495608_0024516 | Ga0495608_0024516_2815_3702 | 256 |
| 164 | 3300046514 | Ga0495618_0110079 | Ga0495618_0110079_854_1741 | 256 |
| 165 | 3300046559 | Ga0495667_0005117 | Ga0495667_0005117_1018_1905 | 256 |
| 166 | 3300047319 | Ga0495674_0258116 | Ga0495674_0258116_303_1190 | 256 |
| 167 | 3300047322 | Ga0495680_0197139 | Ga0495680_0197139_532_1419 | 256 |
| 168 | 3300047444 | Ga0495675_0121505 | Ga0495675_0121505_24_911 | 256 |
| 169 | 3300049581 | Ga0501047_0093104 | Ga0501047_0093104_339_1232 | 256 |
| 170 | 3300049590 | Ga0501074_0138669 | Ga0501074_0138669_792_1676 | 256 |
| 171 | 3300049823 | Ga0501044_0245593 | Ga0501044_0245593_72_965 | 256 |
| 172 | 3300009174 | Ga0105241_10055443 | Ga0105241_100554432 | 257 |
| 173 | 3300014325 | Ga0163163_10206317 | Ga0163163_102063172 | 257 |
| 174 | 3300025911 | Ga0207654_10058906 | Ga0207654_100589062 | 257 |
| 175 | 3300025925 | Ga0207650_10002704 | Ga0207650_100027043 | 257 |
| 176 | 3300025926 | Ga0207659_10004187 | Ga0207659_100041872 | 257 |
| 177 | 3300036401 | Ga0373937_0203694 | Ga0373937_0203694_409_1284 | 257 |
| 178 | 3300046516 | Ga0495628_0096061 | Ga0495628_0096061_737_1630 | 257 |
| 179 | 3300048088 | Ga0495602_0073820 | Ga0495602_0073820_1958_2833 | 257 |
| 180 | 3300005616 | Ga0068852_100099422 | Ga0068852_1000994223 | 258 |
| 181 | 3300026142 | Ga0207698_10065985 | Ga0207698_100659853 | 258 |
| 182 | 3300037418 | Ga0395900_0032576 | Ga0395900_0032576_1571_2446 | 258 |
| 183 | 3300037471 | Ga0395905_0013205 | Ga0395905_0013205_6445_7320 | 258 |
| 184 | 3300047470 | Ga0495681_0029983 | Ga0495681_0029983_486_1394 | 258 |
| 185 | 3300048918 | Ga0496115_0104555 | Ga0496115_0104555_666_1541 | 258 |
| 186 | 3300005436 | Ga0070713_100000245 | Ga0070713_10000024522 | 259 |
| 187 | 3300009551 | Ga0105238_10328759 | Ga0105238_103287592 | 259 |
| 188 | 3300025924 | Ga0207694_10292142 | Ga0207694_102921421 | 259 |
| 189 | 3300025928 | Ga0207700_10000182 | Ga0207700_1000018226 | 259 |
| 190 | 3300037068 | Ga0373925_0144755 | Ga0373925_0144755_346_1233 | 259 |
| 191 | iso_pu_bacteria | 8046767195 | 8046770677 | 259 |
| 192 | iso_pu_bacteria | 8057575449 | 8057579948 | 259 |
| 193 | 3300005335 | Ga0070666_10017112 | Ga0070666_100171124 | 260 |
| 194 | 3300005338 | Ga0068868_100059252 | Ga0068868_1000592523 | 260 |
| 195 | 3300005340 | Ga0070689_100095961 | Ga0070689_1000959612 | 260 |
| 196 | 3300005353 | Ga0070669_100443612 | Ga0070669_1004436122 | 260 |
| 197 | 3300005355 | Ga0070671_100006686 | Ga0070671_1000066868 | 260 |
| 198 | 3300005364 | Ga0070673_100020993 | Ga0070673_1000209932 | 260 |
| 199 | 3300005365 | Ga0070688_100002144 | Ga0070688_1000021448 | 260 |
| 200 | 3300005367 | Ga0070667_100210859 | Ga0070667_1002108592 | 260 |
| 201 | 3300005434 | Ga0070709_10072947 | Ga0070709_100729472 | 260 |
| 202 | 3300005436 | Ga0070713_100016747 | Ga0070713_1000167474 | 260 |
| 203 | 3300005437 | Ga0070710_10043325 | Ga0070710_100433254 | 260 |
| 204 | 3300005439 | Ga0070711_100027797 | Ga0070711_1000277974 | 260 |
| 205 | 3300005456 | Ga0070678_100007972 | Ga0070678_1000079723 | 260 |
| 206 | 3300005466 | Ga0070685_10000448 | Ga0070685_1000044827 | 260 |
| 207 | 3300005543 | Ga0070672_100070832 | Ga0070672_1000708322 | 260 |
| 208 | 3300005544 | Ga0070686_100054878 | Ga0070686_1000548783 | 260 |
| 209 | 3300005547 | Ga0070693_100001109 | Ga0070693_1000011095 | 260 |
| 210 | 3300005578 | Ga0068854_100001475 | Ga0068854_1000014758 | 260 |
| 211 | 3300005614 | Ga0068856_100379201 | Ga0068856_1003792012 | 260 |
| 212 | 3300005615 | Ga0070702_100193765 | Ga0070702_1001937652 | 260 |
| 213 | 3300005616 | Ga0068852_100166378 | Ga0068852_1001663782 | 260 |
| 214 | 3300005618 | Ga0068864_100000854 | Ga0068864_1000008544 | 260 |
| 215 | 3300005841 | Ga0068863_100010697 | Ga0068863_1000106979 | 260 |
| 216 | 3300005842 | Ga0068858_100004095 | Ga0068858_10000409515 | 260 |
| 217 | 3300005843 | Ga0068860_100155685 | Ga0068860_1001556852 | 260 |
| 218 | 3300006175 | Ga0070712_100006268 | Ga0070712_1000062688 | 260 |
| 219 | 3300006237 | Ga0097621_100152468 | Ga0097621_1001524683 | 260 |
| 220 | 3300006358 | Ga0068871_100218732 | Ga0068871_1002187322 | 260 |
| 221 | 3300006881 | Ga0068865_100092953 | Ga0068865_1000929532 | 260 |
| 222 | 3300007265 | Ga0099794_10235953 | Ga0099794_102359531 | 260 |
| 223 | 3300009098 | Ga0105245_10067338 | Ga0105245_100673383 | 260 |
| 224 | 3300009098 | Ga0105245_10108480 | Ga0105245_101084802 | 260 |
| 225 | 3300009101 | Ga0105247_10014150 | Ga0105247_100141503 | 260 |
| 226 | 3300009148 | Ga0105243_10121867 | Ga0105243_101218672 | 260 |
| 227 | 3300009177 | Ga0105248_10006620 | Ga0105248_1000662012 | 260 |
| 228 | 3300009551 | Ga0105238_10299634 | Ga0105238_102996343 | 260 |
| 229 | 3300010375 | Ga0105239_10331299 | Ga0105239_103312992 | 260 |
| 230 | 3300013296 | Ga0157374_10000569 | Ga0157374_1000056934 | 260 |
| 231 | 3300013297 | Ga0157378_10293819 | Ga0157378_102938192 | 260 |
| 232 | 3300013306 | Ga0163162_10150317 | Ga0163162_101503172 | 260 |
| 233 | 3300013306 | Ga0163162_10205008 | Ga0163162_102050082 | 260 |
| 234 | 3300014968 | Ga0157379_10010180 | Ga0157379_100101808 | 260 |
| 235 | 3300014969 | Ga0157376_10256005 | Ga0157376_102560052 | 260 |
| 236 | 3300017792 | Ga0163161_10078847 | Ga0163161_100788472 | 260 |
| 237 | 3300021441 | Ga0213871_10013985 | Ga0213871_100139852 | 260 |
| 238 | 3300025898 | Ga0207692_10005600 | Ga0207692_100056007 | 260 |
| 239 | 3300025903 | Ga0207680_10077051 | Ga0207680_100770512 | 260 |
| 240 | 3300025906 | Ga0207699_10059978 | Ga0207699_100599782 | 260 |
| 241 | 3300025915 | Ga0207693_10000075 | Ga0207693_1000007556 | 260 |
| 242 | 3300025916 | Ga0207663_10002965 | Ga0207663_100029656 | 260 |
| 243 | 3300025922 | Ga0207646_10325852 | Ga0207646_103258521 | 260 |
| 244 | 3300025923 | Ga0207681_10096479 | Ga0207681_100964793 | 260 |
| 245 | 3300025924 | Ga0207694_10080531 | Ga0207694_100805312 | 260 |
| 246 | 3300025925 | Ga0207650_10017333 | Ga0207650_100173336 | 260 |
| 247 | 3300025927 | Ga0207687_10013670 | Ga0207687_100136702 | 260 |
| 248 | 3300025927 | Ga0207687_10028354 | Ga0207687_100283543 | 260 |
| 249 | 3300025931 | Ga0207644_10032208 | Ga0207644_100322084 | 260 |
| 250 | 3300025933 | Ga0207706_10017469 | Ga0207706_100174699 | 260 |
| 251 | 3300025934 | Ga0207686_10000195 | Ga0207686_1000019517 | 260 |
| 252 | 3300025936 | Ga0207670_10023793 | Ga0207670_100237933 | 260 |
| 253 | 3300025940 | Ga0207691_10062120 | Ga0207691_100621204 | 260 |
| 254 | 3300025941 | Ga0207711_10000092 | Ga0207711_1000009236 | 260 |
| 255 | 3300025942 | Ga0207689_10014709 | Ga0207689_100147095 | 260 |
| 256 | 3300025960 | Ga0207651_10064128 | Ga0207651_100641283 | 260 |
| 257 | 3300026023 | Ga0207677_10000477 | Ga0207677_100004776 | 260 |
| 258 | 3300026035 | Ga0207703_10001714 | Ga0207703_1000171421 | 260 |
| 259 | 3300026078 | Ga0207702_10086936 | Ga0207702_100869364 | 260 |
| 260 | 3300026088 | Ga0207641_10006778 | Ga0207641_100067785 | 260 |
| 261 | 3300026095 | Ga0207676_10000097 | Ga0207676_1000009764 | 260 |
| 262 | 3300026121 | Ga0207683_10004473 | Ga0207683_1000447310 | 260 |
| 263 | 3300026142 | Ga0207698_10062549 | Ga0207698_100625494 | 260 |
| 264 | 3300028381 | Ga0268264_10003797 | Ga0268264_100037972 | 260 |
| 265 | 3300033179 | Ga0307507_10032398 | Ga0307507_100323984 | 260 |
| 266 | 3300033179 | Ga0307507_10185535 | Ga0307507_101855352 | 260 |
| 267 | 3300035086 | Ga0373934_0012796 | Ga0373934_0012796_2079_2954 | 260 |
| 268 | 3300035111 | Ga0373923_0001271 | Ga0373923_0001271_3317_4192 | 260 |
| 269 | 3300035117 | Ga0373953_0017685 | Ga0373953_0017685_562_1437 | 260 |
| 270 | 3300035118 | Ga0373954_0001687 | Ga0373954_0001687_2264_3139 | 260 |
| 271 | 3300036401 | Ga0373937_0009900 | Ga0373937_0009900_6014_6889 | 260 |
| 272 | 3300037068 | Ga0373925_0001443 | Ga0373925_0001443_11984_12859 | 260 |
| 273 | 3300037068 | Ga0373925_0019542 | Ga0373925_0019542_898_1773 | 260 |
| 274 | 3300037312 | Ga0395899_0006274 | Ga0395899_0006274_598_1485 | 260 |
| 275 | 3300037418 | Ga0395900_0069470 | Ga0395900_0069470_379_1266 | 260 |
| 276 | 3300037418 | Ga0395900_0367240 | Ga0395900_0367240_144_1031 | 260 |
| 277 | 3300037466 | Ga0395898_0009885 | Ga0395898_0009885_2393_3280 | 260 |
| 278 | 3300037471 | Ga0395905_0373351 | Ga0395905_0373351_414_1301 | 260 |
| 279 | 3300038443 | Ga0395901_0157927 | Ga0395901_0157927_16_903 | 260 |
| 280 | 3300039438 | Ga0436360_0943536 | Ga0436360_0943536_608_1477 | 260 |
| 281 | 3300044658 | Ga0466972_0127299 | Ga0466972_0127299_248_1132 | 260 |
| 282 | 3300046459 | Ga0495629_0111044 | Ga0495629_0111044_462_1337 | 260 |
| 283 | 3300046463 | Ga0495653_0212882 | Ga0495653_0212882_240_1115 | 260 |
| 284 | 3300046472 | Ga0495580_0022959 | Ga0495580_0022959_362_1237 | 260 |
| 285 | 3300046472 | Ga0495580_0045319 | Ga0495580_0045319_1634_2509 | 260 |
| 286 | 3300046473 | Ga0495582_0007568 | Ga0495582_0007568_2652_3527 | 260 |
| 287 | 3300046473 | Ga0495582_0016966 | Ga0495582_0016966_608_1483 | 260 |
| 288 | 3300046475 | Ga0495639_0092210 | Ga0495639_0092210_215_1090 | 260 |
| 289 | 3300046477 | Ga0495664_0007319 | Ga0495664_0007319_4385_5260 | 260 |
| 290 | 3300046511 | Ga0495608_0164152 | Ga0495608_0164152_509_1384 | 260 |
| 291 | 3300046514 | Ga0495618_0262736 | Ga0495618_0262736_23_898 | 260 |
| 292 | 3300046516 | Ga0495628_0228026 | Ga0495628_0228026_459_1334 | 260 |
| 293 | 3300046516 | Ga0495628_0290812 | Ga0495628_0290812_49_924 | 260 |
| 294 | 3300046531 | Ga0495665_0008093 | Ga0495665_0008093_2029_2904 | 260 |
| 295 | 3300046539 | Ga0495621_0004002 | Ga0495621_0004002_546_1421 | 260 |
| 296 | 3300046642 | Ga0495634_0233051 | Ga0495634_0233051_230_1105 | 260 |
| 297 | 3300046663 | Ga0495635_0007041 | Ga0495635_0007041_1946_2821 | 260 |
| 298 | 3300046664 | Ga0495659_0023080 | Ga0495659_0023080_542_1417 | 260 |
| 299 | 3300046674 | Ga0495588_0052636 | Ga0495588_0052636_366_1241 | 260 |
| 300 | 3300046675 | Ga0495657_0182231 | Ga0495657_0182231_229_1104 | 260 |
| 301 | 3300046679 | Ga0495623_0019336 | Ga0495623_0019336_1930_2805 | 260 |
| 302 | 3300046681 | Ga0495647_0001373 | Ga0495647_0001373_2355_3230 | 260 |
| 303 | 3300046681 | Ga0495647_0065975 | Ga0495647_0065975_157_1032 | 260 |
| 304 | 3300046683 | Ga0495658_0034842 | Ga0495658_0034842_1112_1987 | 260 |
| 305 | 3300047315 | Ga0495581_0083140 | Ga0495581_0083140_573_1448 | 260 |
| 306 | 3300047317 | Ga0495604_0021483 | Ga0495604_0021483_1751_2626 | 260 |
| 307 | 3300047322 | Ga0495680_0240673 | Ga0495680_0240673_162_1037 | 260 |
| 308 | 3300047444 | Ga0495675_0076048 | Ga0495675_0076048_295_1170 | 260 |
| 309 | 3300047471 | Ga0495684_0041179 | Ga0495684_0041179_212_1087 | 260 |
| 310 | 3300047673 | Ga0495593_0114237 | Ga0495593_0114237_358_1233 | 260 |
| 311 | 3300048903 | Ga0496100_0012926 | Ga0496100_0012926_79_954 | 260 |
| 312 | 3300048904 | Ga0496101_0101900 | Ga0496101_0101900_1261_2136 | 260 |
| 313 | 3300048907 | Ga0496104_0531076 | Ga0496104_0531076_127_1002 | 260 |
| 314 | 3300048908 | Ga0496105_0013888 | Ga0496105_0013888_4568_5443 | 260 |
| 315 | 3300048911 | Ga0496108_0317920 | Ga0496108_0317920_230_1105 | 260 |
| 316 | 3300048912 | Ga0496109_0260485 | Ga0496109_0260485_57_932 | 260 |
| 317 | 3300048913 | Ga0496110_0169794 | Ga0496110_0169794_70_945 | 260 |
| 318 | 3300048915 | Ga0496112_0001692 | Ga0496112_0001692_16096_16971 | 260 |
| 319 | 3300048918 | Ga0496115_0007448 | Ga0496115_0007448_1614_2489 | 260 |
| 320 | 3300049572 | Ga0501036_0212590 | Ga0501036_0212590_125_991 | 260 |
| 321 | 3300049577 | Ga0501041_0014368 | Ga0501041_0014368_3316_4182 | 260 |
| 322 | 3300049588 | Ga0501072_0003747 | Ga0501072_0003747_2570_3436 | 260 |
| 323 | 3300049591 | Ga0501075_0031987 | Ga0501075_0031987_295_1161 | 260 |
| 324 | 3300049592 | Ga0501076_0000393 | Ga0501076_0000393_2707_3573 | 260 |
| 325 | 3300049824 | Ga0501045_0002454 | Ga0501045_0002454_2864_3730 | 260 |
| 326 | 3300053094 | Ga0500566_0170858 | Ga0500566_0170858_82_954 | 260 |
| 327 | 3300055283 | Ga0500661_000702 | Ga0500661_000702_730_1602 | 260 |
| 328 | 3300061734 | Ga0530510_0000048 | Ga0530510_0000048_21493_22359 | 260 |
| 329 | iso_pu_bacteria | 2585427608 | 2585901854 | 260 |
| 330 | iso_pu_bacteria | 2852387548 | 2852394641 | 260 |
| 331 | iso_pu_bacteria | 3005416602 | 3005416810 | 260 |
| 332 | iso_pu_bacteria | 8005314921 | 8005320543 | 260 |
| 333 | 3300005329 | Ga0070683_100205102 | Ga0070683_1002051021 | 261 |
| 334 | 3300005339 | Ga0070660_100086433 | Ga0070660_1000864333 | 261 |
| 335 | 3300005344 | Ga0070661_100072171 | Ga0070661_1000721713 | 261 |
| 336 | 3300005366 | Ga0070659_100112321 | Ga0070659_1001123212 | 261 |
| 337 | 3300005434 | Ga0070709_10052822 | Ga0070709_100528222 | 261 |
| 338 | 3300005436 | Ga0070713_100149844 | Ga0070713_1001498442 | 261 |
| 339 | 3300005440 | Ga0070705_100005843 | Ga0070705_1000058432 | 261 |
| 340 | 3300005444 | Ga0070694_100097568 | Ga0070694_1000975682 | 261 |
| 341 | 3300005445 | Ga0070708_100149757 | Ga0070708_1001497572 | 261 |
| 342 | 3300005467 | Ga0070706_100037877 | Ga0070706_1000378772 | 261 |
| 343 | 3300005468 | Ga0070707_100367534 | Ga0070707_1003675342 | 261 |
| 344 | 3300005518 | Ga0070699_100044652 | Ga0070699_1000446523 | 261 |
| 345 | 3300005530 | Ga0070679_100530988 | Ga0070679_1005309882 | 261 |
| 346 | 3300005536 | Ga0070697_100157407 | Ga0070697_1001574071 | 261 |
| 347 | 3300005545 | Ga0070695_100107440 | Ga0070695_1001074402 | 261 |
| 348 | 3300005549 | Ga0070704_100179606 | Ga0070704_1001796062 | 261 |
| 349 | 3300005564 | Ga0070664_100211943 | Ga0070664_1002119432 | 261 |
| 350 | 3300005834 | Ga0068851_10056578 | Ga0068851_100565782 | 261 |
| 351 | 3300006175 | Ga0070712_100346605 | Ga0070712_1003466052 | 261 |
| 352 | 3300006914 | Ga0075436_100268977 | Ga0075436_1002689771 | 261 |
| 353 | 3300009093 | Ga0105240_10113094 | Ga0105240_101130943 | 261 |
| 354 | 3300009098 | Ga0105245_10198774 | Ga0105245_101987742 | 261 |
| 355 | 3300009545 | Ga0105237_10041719 | Ga0105237_100417192 | 261 |
| 356 | 3300010375 | Ga0105239_10610787 | Ga0105239_106107871 | 261 |
| 357 | 3300013104 | Ga0157370_10057443 | Ga0157370_100574432 | 261 |
| 358 | 3300025906 | Ga0207699_10042304 | Ga0207699_100423044 | 261 |
| 359 | 3300025910 | Ga0207684_10171613 | Ga0207684_101716132 | 261 |
| 360 | 3300025915 | Ga0207693_10001554 | Ga0207693_100015544 | 261 |
| 361 | 3300025919 | Ga0207657_10010554 | Ga0207657_100105549 | 261 |
| 362 | 3300025927 | Ga0207687_10071198 | Ga0207687_100711983 | 261 |
| 363 | 3300025941 | Ga0207711_10151572 | Ga0207711_101515721 | 261 |
| 364 | 3300025942 | Ga0207689_10148350 | Ga0207689_101483502 | 261 |
| 365 | 3300026116 | Ga0207674_10007170 | Ga0207674_1000717011 | 261 |
| 366 | 3300035410 | Ga0373924_0002698 | Ga0373924_0002698_2936_3817 | 261 |
| 367 | 3300036401 | Ga0373937_0174679 | Ga0373937_0174679_737_1624 | 261 |
| 368 | 3300037068 | Ga0373925_0186762 | Ga0373925_0186762_540_1427 | 261 |
| 369 | 3300046514 | Ga0495618_0186227 | Ga0495618_0186227_197_1084 | 261 |
| 370 | 3300046529 | Ga0495652_0266012 | Ga0495652_0266012_250_1137 | 261 |
| 371 | 3300046559 | Ga0495667_0266350 | Ga0495667_0266350_88_975 | 261 |
| 372 | 3300048915 | Ga0496112_0103601 | Ga0496112_0103601_684_1559 | 261 |
| 373 | iso_pu_bacteria | 2511231002 | 2511247214 | 261 |
| 374 | iso_pu_bacteria | 2585428057 | 2587727368 | 261 |
| 375 | iso_pu_bacteria | 2585428058 | 2587735274 | 261 |
| 376 | iso_pu_bacteria | 2588253510 | 2588294790 | 261 |
| 377 | iso_pu_bacteria | 2643221592 | 2643967856 | 261 |
| 378 | iso_pu_bacteria | 2643221625 | 2644143244 | 261 |
| 379 | iso_pu_bacteria | 2643221648 | 2644271668 | 261 |
| 380 | 3300005338 | Ga0068868_100042239 | Ga0068868_1000422392 | 262 |
| 381 | 3300005530 | Ga0070679_100045246 | Ga0070679_1000452462 | 262 |
| 382 | 3300005616 | Ga0068852_100001236 | Ga0068852_10000123618 | 262 |
| 383 | 3300005834 | Ga0068851_10026978 | Ga0068851_100269783 | 262 |
| 384 | 3300006237 | Ga0097621_100030851 | Ga0097621_1000308515 | 262 |
| 385 | 3300006358 | Ga0068871_100053039 | Ga0068871_1000530393 | 262 |
| 386 | 3300006871 | Ga0075434_100000065 | Ga0075434_10000006559 | 262 |
| 387 | 3300006914 | Ga0075436_100000205 | Ga0075436_10000020544 | 262 |
| 388 | 3300006914 | Ga0075436_100004957 | Ga0075436_1000049576 | 262 |
| 389 | 3300007076 | Ga0075435_100040049 | Ga0075435_1000400495 | 262 |
| 390 | 3300009093 | Ga0105240_10015704 | Ga0105240_100157047 | 262 |
| 391 | 3300025913 | Ga0207695_10034455 | Ga0207695_100344556 | 262 |
| 392 | 3300025981 | Ga0207640_10558986 | Ga0207640_105589861 | 262 |
| 393 | 3300026023 | Ga0207677_10013156 | Ga0207677_100131563 | 262 |
| 394 | 3300026142 | Ga0207698_10000342 | Ga0207698_100003427 | 262 |
| 395 | 3300048908 | Ga0496105_0032134 | Ga0496105_0032134_192_1067 | 262 |
| 396 | 3300048914 | Ga0496111_0111208 | Ga0496111_0111208_1091_1966 | 262 |
| 397 | 3300050512 | nmdc:mga0n895_310158_c1 | nmdc:mga0n895_310158_c1_58_939 | 262 |
| 398 | 3300050512 | nmdc:mga0n895_84_c1 | nmdc:mga0n895_84_c1_36248_37117 | 262 |
| 399 | 3300050513 | nmdc:mga0rr50_31298_c1 | nmdc:mga0rr50_31298_c1_148_1017 | 262 |
| 400 | 3300050514 | nmdc:mga08x19_2051_c1 | nmdc:mga08x19_2051_c1_4064_4945 | 262 |
| 401 | 3300050514 | nmdc:mga08x19_2433_c1 | nmdc:mga08x19_2433_c1_5533_6399 | 262 |
| 402 | 3300005434 | Ga0070709_10092584 | Ga0070709_100925841 | 263 |
| 403 | 3300005617 | Ga0068859_100080768 | Ga0068859_1000807685 | 263 |
| 404 | 3300006844 | Ga0075428_100004095 | Ga0075428_10000409514 | 263 |
| 405 | 3300006880 | Ga0075429_100004896 | Ga0075429_1000048963 | 263 |
| 406 | 3300006931 | Ga0097620_100080769 | Ga0097620_1000807695 | 263 |
| 407 | 3300009147 | Ga0114129_10320646 | Ga0114129_103206462 | 263 |
| 408 | 3300013105 | Ga0157369_10102335 | Ga0157369_101023353 | 263 |
| 409 | 3300013296 | Ga0157374_10479420 | Ga0157374_104794202 | 263 |
| 410 | 3300027907 | Ga0207428_10005555 | Ga0207428_1000555512 | 263 |
| 411 | 3300031251 | Ga0265327_10008541 | Ga0265327_100085417 | 263 |
| 412 | 3300042461 | Ga0439460_0031819 | Ga0439460_0031819_18_884 | 263 |
| 413 | 3300049575 | Ga0501039_0362219 | Ga0501039_0362219_133_999 | 263 |
| 414 | 3300049588 | Ga0501072_0018302 | Ga0501072_0018302_1746_2612 | 263 |
| 415 | 3300050507 | nmdc:mga05p37_5610_c1 | nmdc:mga05p37_5610_c1_12553_13419 | 263 |
| 416 | 3300050508 | nmdc:mga09592_4157_c1 | nmdc:mga09592_4157_c1_1393_2259 | 263 |
| 417 | 3300050511 | nmdc:mga08y16_9559_c1 | nmdc:mga08y16_9559_c1_8179_9045 | 263 |
| 418 | 3300005330 | Ga0070690_100000758 | Ga0070690_10000075813 | 264 |
| 419 | 3300005334 | Ga0068869_100001795 | Ga0068869_10000179510 | 264 |
| 420 | 3300005336 | Ga0070680_100007592 | Ga0070680_1000075924 | 264 |
| 421 | 3300005337 | Ga0070682_100013702 | Ga0070682_1000137022 | 264 |
| 422 | 3300005340 | Ga0070689_100002598 | Ga0070689_1000025987 | 264 |
| 423 | 3300005340 | Ga0070689_100168138 | Ga0070689_1001681381 | 264 |
| 424 | 3300005341 | Ga0070691_10000694 | Ga0070691_100006948 | 264 |
| 425 | 3300005343 | Ga0070687_100007779 | Ga0070687_1000077792 | 264 |
| 426 | 3300005365 | Ga0070688_100166294 | Ga0070688_1001662942 | 264 |
| 427 | 3300005438 | Ga0070701_10003369 | Ga0070701_100033695 | 264 |
| 428 | 3300005440 | Ga0070705_100002078 | Ga0070705_1000020787 | 264 |
| 429 | 3300005441 | Ga0070700_100004325 | Ga0070700_1000043257 | 264 |
| 430 | 3300005444 | Ga0070694_100001894 | Ga0070694_1000018948 | 264 |
| 431 | 3300005458 | Ga0070681_10145961 | Ga0070681_101459613 | 264 |
| 432 | 3300005459 | Ga0068867_100005732 | Ga0068867_1000057322 | 264 |
| 433 | 3300005530 | Ga0070679_100052746 | Ga0070679_1000527463 | 264 |
| 434 | 3300005539 | Ga0068853_100042965 | Ga0068853_1000429655 | 264 |
| 435 | 3300005544 | Ga0070686_100002471 | Ga0070686_1000024717 | 264 |
| 436 | 3300005545 | Ga0070695_100003461 | Ga0070695_1000034619 | 264 |
| 437 | 3300005546 | Ga0070696_100002305 | Ga0070696_1000023058 | 264 |
| 438 | 3300005546 | Ga0070696_100003044 | Ga0070696_10000304412 | 264 |
| 439 | 3300005547 | Ga0070693_100001266 | Ga0070693_1000012667 | 264 |
| 440 | 3300005549 | Ga0070704_100003882 | Ga0070704_1000038828 | 264 |
| 441 | 3300005563 | Ga0068855_100016235 | Ga0068855_1000162353 | 264 |
| 442 | 3300005578 | Ga0068854_100003215 | Ga0068854_1000032152 | 264 |
| 443 | 3300005615 | Ga0070702_100003013 | Ga0070702_1000030133 | 264 |
| 444 | 3300005615 | Ga0070702_100190369 | Ga0070702_1001903692 | 264 |
| 445 | 3300005617 | Ga0068859_100006424 | Ga0068859_1000064247 | 264 |
| 446 | 3300005617 | Ga0068859_100046798 | Ga0068859_1000467983 | 264 |
| 447 | 3300005618 | Ga0068864_100022813 | Ga0068864_1000228133 | 264 |
| 448 | 3300005718 | Ga0068866_10000959 | Ga0068866_100009598 | 264 |
| 449 | 3300005719 | Ga0068861_100001299 | Ga0068861_1000012996 | 264 |
| 450 | 3300005840 | Ga0068870_10122531 | Ga0068870_101225312 | 264 |
| 451 | 3300005841 | Ga0068863_100104969 | Ga0068863_1001049692 | 264 |
| 452 | 3300005842 | Ga0068858_100016904 | Ga0068858_1000169044 | 264 |
| 453 | 3300005843 | Ga0068860_100005275 | Ga0068860_1000052759 | 264 |
| 454 | 3300005844 | Ga0068862_100002444 | Ga0068862_1000024448 | 264 |
| 455 | 3300006237 | Ga0097621_100023572 | Ga0097621_1000235722 | 264 |
| 456 | 3300006358 | Ga0068871_100006330 | Ga0068871_1000063307 | 264 |
| 457 | 3300006852 | Ga0075433_10001178 | Ga0075433_100011787 | 264 |
| 458 | 3300006871 | Ga0075434_100001217 | Ga0075434_10000121715 | 264 |
| 459 | 3300006881 | Ga0068865_100004151 | Ga0068865_1000041517 | 264 |
| 460 | 3300006914 | Ga0075436_100003082 | Ga0075436_10000308211 | 264 |
| 461 | 3300006931 | Ga0097620_100006424 | Ga0097620_1000064247 | 264 |
| 462 | 3300006931 | Ga0097620_100046798 | Ga0097620_1000467983 | 264 |
| 463 | 3300007076 | Ga0075435_100000549 | Ga0075435_10000054917 | 264 |
| 464 | 3300009098 | Ga0105245_10000259 | Ga0105245_1000025962 | 264 |
| 465 | 3300009148 | Ga0105243_10004311 | Ga0105243_100043118 | 264 |
| 466 | 3300009148 | Ga0105243_10042561 | Ga0105243_100425613 | 264 |
| 467 | 3300009174 | Ga0105241_10004693 | Ga0105241_100046939 | 264 |
| 468 | 3300009176 | Ga0105242_10003634 | Ga0105242_100036348 | 264 |
| 469 | 3300009177 | Ga0105248_10327962 | Ga0105248_103279621 | 264 |
| 470 | 3300009553 | Ga0105249_10003563 | Ga0105249_1000356310 | 264 |
| 471 | 3300013297 | Ga0157378_10007333 | Ga0157378_100073338 | 264 |
| 472 | 3300014326 | Ga0157380_10141298 | Ga0157380_101412982 | 264 |
| 473 | 3300014968 | Ga0157379_10041206 | Ga0157379_100412062 | 264 |
| 474 | 3300014969 | Ga0157376_10007668 | Ga0157376_100076684 | 264 |
| 475 | 3300025901 | Ga0207688_10040709 | Ga0207688_100407092 | 264 |
| 476 | 3300025912 | Ga0207707_10069557 | Ga0207707_100695572 | 264 |
| 477 | 3300025917 | Ga0207660_10005344 | Ga0207660_100053447 | 264 |
| 478 | 3300025918 | Ga0207662_10000106 | Ga0207662_100001069 | 264 |
| 479 | 3300025921 | Ga0207652_10024991 | Ga0207652_100249912 | 264 |
| 480 | 3300025921 | Ga0207652_10198398 | Ga0207652_101983981 | 264 |
| 481 | 3300025926 | Ga0207659_10110902 | Ga0207659_101109022 | 264 |
| 482 | 3300025927 | Ga0207687_10013013 | Ga0207687_100130134 | 264 |
| 483 | 3300025934 | Ga0207686_10005506 | Ga0207686_100055063 | 264 |
| 484 | 3300025935 | Ga0207709_10002789 | Ga0207709_100027898 | 264 |
| 485 | 3300025935 | Ga0207709_10125493 | Ga0207709_101254932 | 264 |
| 486 | 3300025936 | Ga0207670_10007642 | Ga0207670_100076424 | 264 |
| 487 | 3300025936 | Ga0207670_10057827 | Ga0207670_100578272 | 264 |
| 488 | 3300025938 | Ga0207704_10002100 | Ga0207704_100021005 | 264 |
| 489 | 3300025942 | Ga0207689_10004637 | Ga0207689_100046378 | 264 |
| 490 | 3300025949 | Ga0207667_10023786 | Ga0207667_100237863 | 264 |
| 491 | 3300025961 | Ga0207712_10006365 | Ga0207712_100063654 | 264 |
| 492 | 3300025981 | Ga0207640_10004437 | Ga0207640_100044378 | 264 |
| 493 | 3300026023 | Ga0207677_10001868 | Ga0207677_100018687 | 264 |
| 494 | 3300026035 | Ga0207703_10003689 | Ga0207703_1000368912 | 264 |
| 495 | 3300026035 | Ga0207703_10048497 | Ga0207703_100484973 | 264 |
| 496 | 3300026041 | Ga0207639_10095143 | Ga0207639_100951432 | 264 |
| 497 | 3300026075 | Ga0207708_10022592 | Ga0207708_100225927 | 264 |
| 498 | 3300026078 | Ga0207702_10022972 | Ga0207702_100229722 | 264 |
| 499 | 3300026088 | Ga0207641_10191461 | Ga0207641_101914612 | 264 |
| 500 | 3300026089 | Ga0207648_10005290 | Ga0207648_100052907 | 264 |
| 501 | 3300026118 | Ga0207675_100010235 | Ga0207675_1000102352 | 264 |
| 502 | 3300026142 | Ga0207698_10031190 | Ga0207698_100311903 | 264 |
| 503 | 3300028380 | Ga0268265_10003603 | Ga0268265_100036037 | 264 |
| 504 | 3300028381 | Ga0268264_10005206 | Ga0268264_100052067 | 264 |
| 505 | 3300034957 | Ga0373938_0005198 | Ga0373938_0005198_435_1304 | 264 |
| 506 | 3300035113 | Ga0373936_0004217 | Ga0373936_0004217_4538_5407 | 264 |
| 507 | 3300035114 | Ga0373939_0006886 | Ga0373939_0006886_1487_2356 | 264 |
| 508 | 3300035116 | Ga0373945_0058444 | Ga0373945_0058444_398_1267 | 264 |
| 509 | 3300035691 | Ga0373931_0006196 | Ga0373931_0006196_4197_5066 | 264 |
| 510 | 3300035692 | Ga0373935_0015015 | Ga0373935_0015015_1042_1911 | 264 |
| 511 | 3300035695 | Ga0373927_0004898 | Ga0373927_0004898_398_1267 | 264 |
| 512 | 3300035695 | Ga0373927_0210790 | Ga0373927_0210790_36_923 | 264 |
| 513 | 3300036401 | Ga0373937_0196366 | Ga0373937_0196366_743_1630 | 264 |
| 514 | 3300037068 | Ga0373925_0013522 | Ga0373925_0013522_3883_4752 | 264 |
| 515 | 3300046459 | Ga0495629_0370319 | Ga0495629_0370319_74_961 | 264 |
| 516 | 3300046473 | Ga0495582_0071100 | Ga0495582_0071100_342_1211 | 264 |
| 517 | 3300046526 | Ga0495666_0013392 | Ga0495666_0013392_1213_2082 | 264 |
| 518 | 3300046535 | Ga0495586_0009428 | Ga0495586_0009428_3960_4829 | 264 |
| 519 | 3300046681 | Ga0495647_0000090 | Ga0495647_0000090_9656_10525 | 264 |
| 520 | 3300046683 | Ga0495658_0042701 | Ga0495658_0042701_390_1259 | 264 |
| 521 | 3300047321 | Ga0495676_0116064 | Ga0495676_0116064_193_1062 | 264 |
| 522 | 3300005327 | Ga0070658_10096029 | Ga0070658_100960293 | 265 |
| 523 | 3300005328 | Ga0070676_10002360 | Ga0070676_100023607 | 265 |
| 524 | 3300005329 | Ga0070683_100010121 | Ga0070683_1000101213 | 265 |
| 525 | 3300005331 | Ga0070670_100005773 | Ga0070670_1000057738 | 265 |
| 526 | 3300005334 | Ga0068869_100001116 | Ga0068869_1000011165 | 265 |
| 527 | 3300005339 | Ga0070660_100005190 | Ga0070660_1000051902 | 265 |
| 528 | 3300005344 | Ga0070661_100000659 | Ga0070661_10000065922 | 265 |
| 529 | 3300005347 | Ga0070668_100049546 | Ga0070668_1000495463 | 265 |
| 530 | 3300005353 | Ga0070669_100017827 | Ga0070669_1000178274 | 265 |
| 531 | 3300005355 | Ga0070671_100274570 | Ga0070671_1002745701 | 265 |
| 532 | 3300005367 | Ga0070667_100001779 | Ga0070667_1000017792 | 265 |
| 533 | 3300005435 | Ga0070714_100003517 | Ga0070714_10000351710 | 265 |
| 534 | 3300005435 | Ga0070714_100009908 | Ga0070714_1000099087 | 265 |
| 535 | 3300005436 | Ga0070713_100025557 | Ga0070713_1000255576 | 265 |
| 536 | 3300005440 | Ga0070705_100113820 | Ga0070705_1001138202 | 265 |
| 537 | 3300005530 | Ga0070679_100027662 | Ga0070679_1000276623 | 265 |
| 538 | 3300005535 | Ga0070684_100016572 | Ga0070684_1000165723 | 265 |
| 539 | 3300005539 | Ga0068853_100013146 | Ga0068853_1000131467 | 265 |
| 540 | 3300005539 | Ga0068853_100195839 | Ga0068853_1001958392 | 265 |
| 541 | 3300005563 | Ga0068855_100006508 | Ga0068855_1000065083 | 265 |
| 542 | 3300005563 | Ga0068855_100073398 | Ga0068855_1000733984 | 265 |
| 543 | 3300005564 | Ga0070664_100000157 | Ga0070664_10000015731 | 265 |
| 544 | 3300005577 | Ga0068857_100003114 | Ga0068857_1000031142 | 265 |
| 545 | 3300005578 | Ga0068854_100022691 | Ga0068854_1000226914 | 265 |
| 546 | 3300005614 | Ga0068856_100002108 | Ga0068856_1000021089 | 265 |
| 547 | 3300005616 | Ga0068852_100024227 | Ga0068852_1000242273 | 265 |
| 548 | 3300005617 | Ga0068859_100001470 | Ga0068859_1000014705 | 265 |
| 549 | 3300005618 | Ga0068864_100004243 | Ga0068864_1000042435 | 265 |
| 550 | 3300005719 | Ga0068861_100001821 | Ga0068861_1000018215 | 265 |
| 551 | 3300005834 | Ga0068851_10145535 | Ga0068851_101455352 | 265 |
| 552 | 3300005840 | Ga0068870_10016278 | Ga0068870_100162783 | 265 |
| 553 | 3300005841 | Ga0068863_100010525 | Ga0068863_1000105253 | 265 |
| 554 | 3300005841 | Ga0068863_100083294 | Ga0068863_1000832943 | 265 |
| 555 | 3300005842 | Ga0068858_100003231 | Ga0068858_10000323118 | 265 |
| 556 | 3300005843 | Ga0068860_100014167 | Ga0068860_1000141678 | 265 |
| 557 | 3300005844 | Ga0068862_100076096 | Ga0068862_1000760961 | 265 |
| 558 | 3300006881 | Ga0068865_100195530 | Ga0068865_1001955302 | 265 |
| 559 | 3300006931 | Ga0097620_100001470 | Ga0097620_1000014705 | 265 |
| 560 | 3300009093 | Ga0105240_10001136 | Ga0105240_1000113612 | 265 |
| 561 | 3300009093 | Ga0105240_10048926 | Ga0105240_100489262 | 265 |
| 562 | 3300009101 | Ga0105247_10031558 | Ga0105247_100315583 | 265 |
| 563 | 3300009174 | Ga0105241_10191479 | Ga0105241_101914792 | 265 |
| 564 | 3300009174 | Ga0105241_10326835 | Ga0105241_103268351 | 265 |
| 565 | 3300009551 | Ga0105238_10000203 | Ga0105238_1000020338 | 265 |
| 566 | 3300013297 | Ga0157378_10074140 | Ga0157378_100741401 | 265 |
| 567 | 3300013307 | Ga0157372_10004219 | Ga0157372_100042193 | 265 |
| 568 | 3300014325 | Ga0163163_10031354 | Ga0163163_100313543 | 265 |
| 569 | 3300014497 | Ga0182008_10056180 | Ga0182008_100561801 | 265 |
| 570 | 3300014968 | Ga0157379_10001798 | Ga0157379_100017985 | 265 |
| 571 | 3300025321 | Ga0207656_10077202 | Ga0207656_100772022 | 265 |
| 572 | 3300025900 | Ga0207710_10024820 | Ga0207710_100248203 | 265 |
| 573 | 3300025901 | Ga0207688_10211807 | Ga0207688_102118071 | 265 |
| 574 | 3300025907 | Ga0207645_10020661 | Ga0207645_100206613 | 265 |
| 575 | 3300025909 | Ga0207705_10123185 | Ga0207705_101231852 | 265 |
| 576 | 3300025912 | Ga0207707_10148398 | Ga0207707_101483982 | 265 |
| 577 | 3300025913 | Ga0207695_10042211 | Ga0207695_100422116 | 265 |
| 578 | 3300025913 | Ga0207695_10053153 | Ga0207695_100531533 | 265 |
| 579 | 3300025914 | Ga0207671_10190939 | Ga0207671_101909392 | 265 |
| 580 | 3300025915 | Ga0207693_10255815 | Ga0207693_102558151 | 265 |
| 581 | 3300025916 | Ga0207663_10020999 | Ga0207663_100209996 | 265 |
| 582 | 3300025918 | Ga0207662_10233157 | Ga0207662_102331571 | 265 |
| 583 | 3300025921 | Ga0207652_10021349 | Ga0207652_100213493 | 265 |
| 584 | 3300025923 | Ga0207681_10067542 | Ga0207681_100675422 | 265 |
| 585 | 3300025925 | Ga0207650_10003970 | Ga0207650_100039706 | 265 |
| 586 | 3300025929 | Ga0207664_10011875 | Ga0207664_100118752 | 265 |
| 587 | 3300025929 | Ga0207664_10019166 | Ga0207664_100191663 | 265 |
| 588 | 3300025942 | Ga0207689_10002122 | Ga0207689_100021228 | 265 |
| 589 | 3300025944 | Ga0207661_10062617 | Ga0207661_100626171 | 265 |
| 590 | 3300025949 | Ga0207667_10276358 | Ga0207667_102763582 | 265 |
| 591 | 3300025972 | Ga0207668_10029406 | Ga0207668_100294062 | 265 |
| 592 | 3300025981 | Ga0207640_10030353 | Ga0207640_100303532 | 265 |
| 593 | 3300025986 | Ga0207658_10021671 | Ga0207658_100216714 | 265 |
| 594 | 3300026035 | Ga0207703_10000942 | Ga0207703_100009425 | 265 |
| 595 | 3300026041 | Ga0207639_10005827 | Ga0207639_100058274 | 265 |
| 596 | 3300026078 | Ga0207702_10050328 | Ga0207702_100503282 | 265 |
| 597 | 3300026088 | Ga0207641_10061930 | Ga0207641_100619301 | 265 |
| 598 | 3300026116 | Ga0207674_10006739 | Ga0207674_100067394 | 265 |
| 599 | 3300026118 | Ga0207675_100003477 | Ga0207675_1000034778 | 265 |
| 600 | 3300026118 | Ga0207675_100279452 | Ga0207675_1002794522 | 265 |
| 601 | 3300026142 | Ga0207698_10094591 | Ga0207698_100945912 | 265 |
| 602 | 3300028380 | Ga0268265_10004946 | Ga0268265_100049461 | 265 |
| 603 | 3300028381 | Ga0268264_10002492 | Ga0268264_1000249212 | 265 |
| 604 | 3300028381 | Ga0268264_10711753 | Ga0268264_107117532 | 265 |
| 605 | 3300048905 | Ga0496102_0046330 | Ga0496102_0046330_1705_2577 | 265 |
| 606 | 3300048911 | Ga0496108_0034123 | Ga0496108_0034123_621_1493 | 265 |
| 607 | 3300048912 | Ga0496109_0037699 | Ga0496109_0037699_2370_3242 | 265 |
| 608 | 3300048922 | Ga0496119_0016001 | Ga0496119_0016001_2172_3089 | 265 |
| 609 | 3300049571 | Ga0501034_0024597 | Ga0501034_0024597_2549_3433 | 265 |
| 610 | 3300049574 | Ga0501038_0471173 | Ga0501038_0471173_69_953 | 265 |
| 611 | 3300049575 | Ga0501039_0095895 | Ga0501039_0095895_792_1676 | 265 |
| 612 | 3300049579 | Ga0501043_0051968 | Ga0501043_0051968_716_1600 | 265 |
| 613 | 3300049580 | Ga0501046_0004878 | Ga0501046_0004878_7441_8325 | 265 |
| 614 | 3300049581 | Ga0501047_0048945 | Ga0501047_0048945_192_1076 | 265 |
| 615 | 3300049742 | Ga0501080_0101510 | Ga0501080_0101510_162_1046 | 265 |
| 616 | 3300049823 | Ga0501044_0470233 | Ga0501044_0470233_161_1045 | 265 |
| 617 | 3300025937 | Ga0207669_10330695 | Ga0207669_103306951 | 266 |
| 618 | 3300035725 | Ga0373947_0015558 | Ga0373947_0015558_1629_2504 | 266 |
| 619 | 3300042876 | Ga0451577_0099606 | Ga0451577_0099606_1430_2377 | 266 |
| 620 | 3300045051 | Ga0451576_0265319 | Ga0451576_0265319_244_1191 | 266 |
| 621 | 3300005365 | Ga0070688_100236304 | Ga0070688_1002363042 | 267 |
| 622 | 3300006844 | Ga0075428_100002197 | Ga0075428_10000219711 | 267 |
| 623 | 3300009094 | Ga0111539_10002089 | Ga0111539_1000208912 | 267 |
| 624 | 3300025936 | Ga0207670_10156552 | Ga0207670_101565521 | 267 |
| 625 | 3300025936 | Ga0207670_10399836 | Ga0207670_103998361 | 267 |
| 626 | 3300025949 | Ga0207667_10052223 | Ga0207667_100522233 | 267 |
| 627 | 3300027907 | Ga0207428_10029949 | Ga0207428_100299494 | 267 |
| 628 | 3300050508 | nmdc:mga09592_233661_c1 | nmdc:mga09592_233661_c1_379_1257 | 267 |
| 629 | 3300050511 | nmdc:mga08y16_5051_c1 | nmdc:mga08y16_5051_c1_2874_3752 | 267 |
| 630 | 3300036401 | Ga0373937_0240721 | Ga0373937_0240721_716_1597 | 268 |
| 631 | 3300013307 | Ga0157372_10518955 | Ga0157372_105189552 | 269 |
| 632 | 3300006914 | Ga0075436_100010808 | Ga0075436_1000108082 | 275 |
| 633 | 3300050515 | nmdc:mga0a205_12231_c1 | nmdc:mga0a205_12231_c1_6878_7774 | 275 |
| 634 | 3300003203 | JGI25406J46586_10003260 | JGI25406J46586_100032606 | 276 |
| 635 | 3300005985 | Ga0081539_10000259 | Ga0081539_1000025918 | 276 |
| 636 | 3300037312 | Ga0395899_0281454 | Ga0395899_0281454_64_963 | 276 |
| 637 | 3300037418 | Ga0395900_0017926 | Ga0395900_0017926_3722_4621 | 276 |
| 638 | 3300050507 | nmdc:mga05p37_587852_c1 | nmdc:mga05p37_587852_c1_109_1008 | 276 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
131
314
0.98
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar