F471454
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 637 | 301 | 637 | 182 |
Family's Representative Sequence
| Representative Sequence | 3300044694|Ga0466963_0055679|Ga0466963_0055679_33_653 |
| Length | 206 |
| Sequence | VSSLVVASSAGNVLVWIVWVVAGFSCLAAGVAVISFSNPFYSALALIGNLASLAVMYLLLSAEFVAAAQVLVYAGAVVVMFLFVIAYVGPRHETPWSGGPGWQTVCAVAAAGALLVEIVVAIGLQAGGSLSHTAKVGADFGTPAWIGRIFLVDHLLAFEVTSIVLLVAAVGGVILGAHTRRAEPPVLPDEQEPEAEPEREVAGWAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 2 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 57 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 62 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 68 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 69 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 70 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 71 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 74 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 148 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 152 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 153 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 154 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 155 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 156 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 157 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 158 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 159 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 160 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 161 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 162 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 163 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 164 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 165 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 166 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 167 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 168 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 169 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 170 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 171 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 172 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 173 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 174 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 175 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 176 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 177 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 178 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 179 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 180 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 181 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 182 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 183 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 184 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 185 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 186 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 187 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 188 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 189 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 190 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 191 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 192 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 193 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 194 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 195 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 196 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 197 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 198 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 199 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 252 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 253 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 254 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 255 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 256 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 257 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 260 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 261 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 262 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 263 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 264 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 265 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 286 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 299 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 301 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.84 |
| Metatranscriptomes | 0.16 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.47 |
| Nodule | 0 |
| Rhizoplane | 11.15 |
| Rhizosphere | 87.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.78 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10093368 | 3300001991 | Bacteria | 643 |
| 2 | JGI24744J21845_10000511 | 3300002077 | Bacteria | 6919 |
| 3 | Ga0070658_10153748 | 3300005327 | Bacteria | 1927 |
| 4 | Ga0070658_11046640 | 3300005327 | Bacteria | 710 |
| 5 | Ga0070676_10969579 | 3300005328 | Bacteria | 637 |
| 6 | Ga0070683_100487069 | 3300005329 | Bacteria | 1178 |
| 7 | Ga0068869_100598631 | 3300005334 | Bacteria | 931 |
| 8 | Ga0070680_100512746 | 3300005336 | Bacteria | 1026 |
| 9 | Ga0070682_100085799 | 3300005337 | Bacteria | 2049 |
| 10 | Ga0070682_100709408 | 3300005337 | Unclassified | 807 |
| 11 | Ga0068868_100177641 | 3300005338 | Bacteria | 1765 |
| 12 | Ga0068868_100398327 | 3300005338 | Bacteria | 1187 |
| 13 | Ga0070660_100031447 | 3300005339 | Bacteria | 3986 |
| 14 | Ga0070660_100138568 | 3300005339 | Bacteria | 1950 |
| 15 | Ga0070689_100016020 | 3300005340 | Bacteria | 5481 |
| 16 | Ga0070691_10406997 | 3300005341 | Bacteria | 768 |
| 17 | Ga0070661_100307403 | 3300005344 | Bacteria | 1235 |
| 18 | Ga0070692_10004479 | 3300005345 | Bacteria | 5845 |
| 19 | Ga0070669_100148325 | 3300005353 | Bacteria | 1814 |
| 20 | Ga0070675_100259737 | 3300005354 | Bacteria | 1522 |
| 21 | Ga0070671_100177071 | 3300005355 | Bacteria | 1805 |
| 22 | Ga0070674_100042239 | 3300005356 | Bacteria | 3096 |
| 23 | Ga0070688_100157051 | 3300005365 | Bacteria | 1560 |
| 24 | Ga0070659_100103061 | 3300005366 | Bacteria | 2298 |
| 25 | Ga0070709_10017185 | 3300005434 | Bacteria | 4143 |
| 26 | Ga0070709_10083598 | 3300005434 | Bacteria | 2088 |
| 27 | Ga0070709_10516438 | 3300005434 | Bacteria | 909 |
| 28 | Ga0070714_100048810 | 3300005435 | Bacteria | 3601 |
| 29 | Ga0070714_100056410 | 3300005435 | Bacteria | 3360 |
| 30 | Ga0070714_100284742 | 3300005435 | Bacteria | 1536 |
| 31 | Ga0070714_100287284 | 3300005435 | Bacteria | 1530 |
| 32 | Ga0070714_100412481 | 3300005435 | Bacteria | 1278 |
| 33 | Ga0070714_100457697 | 3300005435 | Unclassified | 1213 |
| 34 | Ga0070714_100478709 | 3300005435 | Bacteria | 1185 |
| 35 | Ga0070714_100499909 | 3300005435 | Bacteria | 1159 |
| 36 | Ga0070714_100686230 | 3300005435 | Bacteria | 987 |
| 37 | Ga0070713_100194877 | 3300005436 | Bacteria | 1827 |
| 38 | Ga0070713_100561668 | 3300005436 | Bacteria | 1081 |
| 39 | Ga0070710_10004053 | 3300005437 | Bacteria | 6956 |
| 40 | Ga0070710_10281210 | 3300005437 | Bacteria | 1080 |
| 41 | Ga0070710_10705229 | 3300005437 | Bacteria | 713 |
| 42 | Ga0070701_10002145 | 3300005438 | Bacteria | 7512 |
| 43 | Ga0070711_100002495 | 3300005439 | Bacteria | 10504 |
| 44 | Ga0070711_101033929 | 3300005439 | Bacteria | 706 |
| 45 | Ga0070705_100003265 | 3300005440 | Bacteria | 7976 |
| 46 | Ga0070705_100221036 | 3300005440 | Bacteria | 1312 |
| 47 | Ga0070705_100226176 | 3300005440 | Bacteria | 1298 |
| 48 | Ga0070700_100003239 | 3300005441 | Bacteria | 8374 |
| 49 | Ga0070708_100036016 | 3300005445 | Bacteria | 4314 |
| 50 | Ga0070708_101085514 | 3300005445 | Bacteria | 750 |
| 51 | Ga0070663_100858871 | 3300005455 | Bacteria | 781 |
| 52 | Ga0070678_100003173 | 3300005456 | Bacteria | 9108 |
| 53 | Ga0070678_100641501 | 3300005456 | Bacteria | 952 |
| 54 | Ga0070681_10033167 | 3300005458 | Bacteria | 5183 |
| 55 | Ga0068867_100000290 | 3300005459 | Bacteria | 32965 |
| 56 | Ga0068867_100325091 | 3300005459 | Bacteria | 1275 |
| 57 | Ga0070685_10004004 | 3300005466 | Bacteria | 7442 |
| 58 | Ga0070706_100104183 | 3300005467 | Bacteria | 2638 |
| 59 | Ga0070707_100001362 | 3300005468 | Bacteria | 23998 |
| 60 | Ga0070707_100763184 | 3300005468 | Bacteria | 930 |
| 61 | Ga0070698_100005957 | 3300005471 | Bacteria | 13293 |
| 62 | Ga0070698_100006514 | 3300005471 | Bacteria | 12660 |
| 63 | Ga0070698_100146609 | 3300005471 | Bacteria | 2309 |
| 64 | Ga0070698_100191412 | 3300005471 | Bacteria | 1983 |
| 65 | Ga0070698_100230638 | 3300005471 | Bacteria | 1784 |
| 66 | Ga0070699_100029009 | 3300005518 | Bacteria | 4770 |
| 67 | Ga0070699_100049107 | 3300005518 | Bacteria | 3652 |
| 68 | Ga0070699_100891540 | 3300005518 | Bacteria | 815 |
| 69 | Ga0070679_100058632 | 3300005530 | Bacteria | 3836 |
| 70 | Ga0070679_100123667 | 3300005530 | Bacteria | 2570 |
| 71 | Ga0070684_100272137 | 3300005535 | Bacteria | 1551 |
| 72 | Ga0070684_100563617 | 3300005535 | Bacteria | 1058 |
| 73 | Ga0070697_100704590 | 3300005536 | Bacteria | 891 |
| 74 | Ga0070697_100986152 | 3300005536 | Unclassified | 749 |
| 75 | Ga0068853_100022345 | 3300005539 | Bacteria | 5282 |
| 76 | Ga0068853_100291773 | 3300005539 | Bacteria | 1506 |
| 77 | Ga0070672_100020180 | 3300005543 | Bacteria | 4856 |
| 78 | Ga0070686_100003179 | 3300005544 | Bacteria | 8991 |
| 79 | Ga0070695_100912868 | 3300005545 | Unclassified | 710 |
| 80 | Ga0070696_100019107 | 3300005546 | Bacteria | 4639 |
| 81 | Ga0070693_100007413 | 3300005547 | Bacteria | 5362 |
| 82 | Ga0070665_100490541 | 3300005548 | Bacteria | 1239 |
| 83 | Ga0070704_100014360 | 3300005549 | Bacteria | 4945 |
| 84 | Ga0070704_100477060 | 3300005549 | Bacteria | 1079 |
| 85 | Ga0070704_100569729 | 3300005549 | Bacteria | 992 |
| 86 | Ga0068854_100372974 | 3300005578 | Bacteria | 1174 |
| 87 | Ga0068856_100002162 | 3300005614 | Bacteria | 20361 |
| 88 | Ga0068856_100722282 | 3300005614 | Bacteria | 1016 |
| 89 | Ga0068856_101108919 | 3300005614 | Unclassified | 809 |
| 90 | Ga0070702_100001183 | 3300005615 | Bacteria | 10515 |
| 91 | Ga0068852_101529243 | 3300005616 | Unclassified | 690 |
| 92 | Ga0068866_10000154 | 3300005718 | Bacteria | 31512 |
| 93 | Ga0068863_100788009 | 3300005841 | Bacteria | 948 |
| 94 | Ga0081455_10004771 | 3300005937 | Bacteria | 15060 |
| 95 | Ga0081455_10018484 | 3300005937 | Bacteria | 6637 |
| 96 | Ga0081455_10021779 | 3300005937 | Bacteria | 6004 |
| 97 | Ga0081538_10009502 | 3300005981 | Bacteria | 8105 |
| 98 | Ga0081538_10049856 | 3300005981 | Bacteria | 2535 |
| 99 | Ga0081538_10066728 | 3300005981 | Bacteria | 2014 |
| 100 | Ga0081540_1008816 | 3300005983 | Bacteria | 7005 |
| 101 | Ga0081539_10001480 | 3300005985 | Bacteria | 39812 |
| 102 | Ga0070717_10048830 | 3300006028 | Bacteria | 3472 |
| 103 | Ga0070717_10062703 | 3300006028 | Bacteria | 3083 |
| 104 | Ga0070717_10128751 | 3300006028 | Bacteria | 2175 |
| 105 | Ga0070717_10776215 | 3300006028 | Bacteria | 871 |
| 106 | Ga0075363_100151567 | 3300006048 | Bacteria | 1309 |
| 107 | Ga0070715_10005193 | 3300006163 | Bacteria | 4327 |
| 108 | Ga0070712_100017737 | 3300006175 | Bacteria | 4611 |
| 109 | Ga0075367_10252709 | 3300006178 | Bacteria | 1106 |
| 110 | Ga0097621_100071204 | 3300006237 | Bacteria | 2873 |
| 111 | Ga0068871_100028194 | 3300006358 | Bacteria | 4400 |
| 112 | Ga0068871_100309483 | 3300006358 | Bacteria | 1388 |
| 113 | Ga0068871_100448781 | 3300006358 | Bacteria | 1156 |
| 114 | Ga0075428_100766993 | 3300006844 | Bacteria | 1026 |
| 115 | Ga0075428_101248107 | 3300006844 | Bacteria | 782 |
| 116 | Ga0075431_100071651 | 3300006847 | Bacteria | 3576 |
| 117 | Ga0075431_100405111 | 3300006847 | Unclassified | 1365 |
| 118 | Ga0075431_100491245 | 3300006847 | Bacteria | 1219 |
| 119 | Ga0075433_10000356 | 3300006852 | Bacteria | 28714 |
| 120 | Ga0075433_10076646 | 3300006852 | Bacteria | 2944 |
| 121 | Ga0075433_10256523 | 3300006852 | Bacteria | 1551 |
| 122 | Ga0075434_100006317 | 3300006871 | Bacteria | 10861 |
| 123 | Ga0075434_100026435 | 3300006871 | Bacteria | 5685 |
| 124 | Ga0075434_100205336 | 3300006871 | Bacteria | 1990 |
| 125 | Ga0075434_100613660 | 3300006871 | Bacteria | 1107 |
| 126 | Ga0075429_100754254 | 3300006880 | Bacteria | 852 |
| 127 | Ga0068865_100004791 | 3300006881 | Bacteria | 8181 |
| 128 | Ga0075436_100018854 | 3300006914 | Bacteria | 4724 |
| 129 | Ga0075436_100073703 | 3300006914 | Bacteria | 2363 |
| 130 | Ga0075435_100021735 | 3300007076 | Bacteria | 4941 |
| 131 | Ga0075435_100046493 | 3300007076 | Bacteria | 3482 |
| 132 | Ga0075435_100714000 | 3300007076 | Bacteria | 871 |
| 133 | Ga0105240_10171175 | 3300009093 | Bacteria | 2572 |
| 134 | Ga0105240_10736098 | 3300009093 | Bacteria | 1073 |
| 135 | Ga0111539_10543509 | 3300009094 | Bacteria | 1353 |
| 136 | Ga0111539_11808581 | 3300009094 | Unclassified | 708 |
| 137 | Ga0105245_10079275 | 3300009098 | Bacteria | 2998 |
| 138 | Ga0105245_10118169 | 3300009098 | Bacteria | 2474 |
| 139 | Ga0105245_10454261 | 3300009098 | Bacteria | 1290 |
| 140 | Ga0105247_10039396 | 3300009101 | Bacteria | 2887 |
| 141 | Ga0105247_10216147 | 3300009101 | Bacteria | 1295 |
| 142 | Ga0114129_10005223 | 3300009147 | Bacteria | 18302 |
| 143 | Ga0114129_10018938 | 3300009147 | Bacteria | 9808 |
| 144 | Ga0114129_10096674 | 3300009147 | Bacteria | 4089 |
| 145 | Ga0114129_10206421 | 3300009147 | Bacteria | 2658 |
| 146 | Ga0114129_11269764 | 3300009147 | Bacteria | 914 |
| 147 | Ga0105243_10010311 | 3300009148 | Bacteria | 7098 |
| 148 | Ga0105243_10094679 | 3300009148 | Bacteria | 2467 |
| 149 | Ga0105241_10037245 | 3300009174 | Bacteria | 3664 |
| 150 | Ga0105242_10012830 | 3300009176 | Bacteria | 6456 |
| 151 | Ga0105248_10060688 | 3300009177 | Bacteria | 4245 |
| 152 | Ga0105248_12108253 | 3300009177 | Bacteria | 641 |
| 153 | Ga0105238_10527063 | 3300009551 | Bacteria | 1184 |
| 154 | Ga0105249_10004222 | 3300009553 | Bacteria | 12419 |
| 155 | Ga0105249_10359169 | 3300009553 | Bacteria | 1478 |
| 156 | Ga0105239_10001224 | 3300010375 | Bacteria | 34981 |
| 157 | Ga0105239_10382220 | 3300010375 | Bacteria | 1592 |
| 158 | Ga0157369_10060850 | 3300013105 | Bacteria | 4072 |
| 159 | Ga0157374_10007471 | 3300013296 | Bacteria | 9318 |
| 160 | Ga0157374_10036408 | 3300013296 | Bacteria | 4507 |
| 161 | Ga0157374_10252717 | 3300013296 | Bacteria | 1735 |
| 162 | Ga0157374_10638797 | 3300013296 | Bacteria | 1076 |
| 163 | Ga0157378_10010246 | 3300013297 | Bacteria | 8184 |
| 164 | Ga0163162_10073924 | 3300013306 | Bacteria | 3466 |
| 165 | Ga0157372_10184457 | 3300013307 | Bacteria | 2416 |
| 166 | Ga0157375_10123928 | 3300013308 | Bacteria | 2697 |
| 167 | Ga0157375_10210488 | 3300013308 | Bacteria | 2102 |
| 168 | Ga0157375_10452886 | 3300013308 | Bacteria | 1449 |
| 169 | Ga0163163_10480721 | 3300014325 | Bacteria | 1303 |
| 170 | Ga0163163_10969987 | 3300014325 | Bacteria | 913 |
| 171 | Ga0157377_10001363 | 3300014745 | Bacteria | 10498 |
| 172 | Ga0157379_10362449 | 3300014968 | Bacteria | 1328 |
| 173 | Ga0157379_10851134 | 3300014968 | Bacteria | 863 |
| 174 | Ga0157376_10043222 | 3300014969 | Bacteria | 3697 |
| 175 | Ga0157376_10295804 | 3300014969 | Bacteria | 1530 |
| 176 | Ga0157376_10357208 | 3300014969 | Bacteria | 1400 |
| 177 | Ga0157376_11971788 | 3300014969 | Bacteria | 621 |
| 178 | Ga0163161_10235473 | 3300017792 | Bacteria | 1422 |
| 179 | Ga0163161_10651930 | 3300017792 | Bacteria | 872 |
| 180 | Ga0197907_10087614 | 3300020069 | Bacteria | 708 |
| 181 | Ga0207692_10030726 | 3300025898 | Bacteria | 2565 |
| 182 | Ga0207642_10010716 | 3300025899 | Bacteria | 3244 |
| 183 | Ga0207710_10067612 | 3300025900 | Bacteria | 1632 |
| 184 | Ga0207688_10218706 | 3300025901 | Bacteria | 1147 |
| 185 | Ga0207680_10303086 | 3300025903 | Bacteria | 1114 |
| 186 | Ga0207685_10001868 | 3300025905 | Bacteria | 4625 |
| 187 | Ga0207699_10047193 | 3300025906 | Bacteria | 2524 |
| 188 | Ga0207699_11041069 | 3300025906 | Bacteria | 605 |
| 189 | Ga0207705_10602159 | 3300025909 | Bacteria | 854 |
| 190 | Ga0207684_10031251 | 3300025910 | Bacteria | 4530 |
| 191 | Ga0207684_10174070 | 3300025910 | Bacteria | 1855 |
| 192 | Ga0207684_10328060 | 3300025910 | Bacteria | 1319 |
| 193 | Ga0207684_10375045 | 3300025910 | Bacteria | 1224 |
| 194 | Ga0207684_10397006 | 3300025910 | Bacteria | 1186 |
| 195 | Ga0207654_10196745 | 3300025911 | Bacteria | 1325 |
| 196 | Ga0207707_10040613 | 3300025912 | Bacteria | 4063 |
| 197 | Ga0207693_10000499 | 3300025915 | Bacteria | 35458 |
| 198 | Ga0207693_10003417 | 3300025915 | Bacteria | 13556 |
| 199 | Ga0207693_10067027 | 3300025915 | Bacteria | 2811 |
| 200 | Ga0207663_10019197 | 3300025916 | Bacteria | 3845 |
| 201 | Ga0207663_10353975 | 3300025916 | Bacteria | 1112 |
| 202 | Ga0207660_10282331 | 3300025917 | Bacteria | 1318 |
| 203 | Ga0207660_10837354 | 3300025917 | Unclassified | 751 |
| 204 | Ga0207662_10008232 | 3300025918 | Bacteria | 5703 |
| 205 | Ga0207657_10003301 | 3300025919 | Bacteria | 17246 |
| 206 | Ga0207657_10019186 | 3300025919 | Bacteria | 6503 |
| 207 | Ga0207649_10079939 | 3300025920 | Bacteria | 2113 |
| 208 | Ga0207652_10067742 | 3300025921 | Bacteria | 3096 |
| 209 | Ga0207652_10267892 | 3300025921 | Bacteria | 1541 |
| 210 | Ga0207646_10001072 | 3300025922 | Bacteria | 34848 |
| 211 | Ga0207646_10532390 | 3300025922 | Bacteria | 1057 |
| 212 | Ga0207646_10972119 | 3300025922 | Bacteria | 751 |
| 213 | Ga0207681_10051957 | 3300025923 | Bacteria | 2778 |
| 214 | Ga0207694_10580544 | 3300025924 | Bacteria | 942 |
| 215 | Ga0207659_10094931 | 3300025926 | Bacteria | 2236 |
| 216 | Ga0207687_10043392 | 3300025927 | Bacteria | 3098 |
| 217 | Ga0207687_10061765 | 3300025927 | Bacteria | 2647 |
| 218 | Ga0207687_10913967 | 3300025927 | Bacteria | 751 |
| 219 | Ga0207700_10000039 | 3300025928 | Bacteria | 102496 |
| 220 | Ga0207700_10017213 | 3300025928 | Bacteria | 4823 |
| 221 | Ga0207700_10030611 | 3300025928 | Bacteria | 3813 |
| 222 | Ga0207700_10688804 | 3300025928 | Bacteria | 912 |
| 223 | Ga0207664_10023006 | 3300025929 | Bacteria | 4663 |
| 224 | Ga0207664_10031688 | 3300025929 | Bacteria | 4047 |
| 225 | Ga0207664_10111618 | 3300025929 | Bacteria | 2275 |
| 226 | Ga0207664_10113134 | 3300025929 | Bacteria | 2260 |
| 227 | Ga0207664_10142046 | 3300025929 | Bacteria | 2032 |
| 228 | Ga0207664_10145755 | 3300025929 | Bacteria | 2007 |
| 229 | Ga0207664_10240634 | 3300025929 | Bacteria | 1576 |
| 230 | Ga0207664_10551494 | 3300025929 | Bacteria | 1034 |
| 231 | Ga0207664_10659635 | 3300025929 | Bacteria | 940 |
| 232 | Ga0207644_10148432 | 3300025931 | Bacteria | 1812 |
| 233 | Ga0207690_10035842 | 3300025932 | Bacteria | 3208 |
| 234 | Ga0207690_10229136 | 3300025932 | Bacteria | 1425 |
| 235 | Ga0207706_10243375 | 3300025933 | Bacteria | 1572 |
| 236 | Ga0207686_10008930 | 3300025934 | Bacteria | 5423 |
| 237 | Ga0207686_10247284 | 3300025934 | Bacteria | 1301 |
| 238 | Ga0207709_10002593 | 3300025935 | Bacteria | 11265 |
| 239 | Ga0207709_10479288 | 3300025935 | Bacteria | 967 |
| 240 | Ga0207670_10053086 | 3300025936 | Bacteria | 2729 |
| 241 | Ga0207669_10017923 | 3300025937 | Bacteria | 3646 |
| 242 | Ga0207704_10002157 | 3300025938 | Bacteria | 8814 |
| 243 | Ga0207665_10000562 | 3300025939 | Bacteria | 25011 |
| 244 | Ga0207665_10200549 | 3300025939 | Bacteria | 1454 |
| 245 | Ga0207665_10216066 | 3300025939 | Bacteria | 1403 |
| 246 | Ga0207665_10230559 | 3300025939 | Bacteria | 1361 |
| 247 | Ga0207691_10023300 | 3300025940 | Bacteria | 5829 |
| 248 | Ga0207711_10184345 | 3300025941 | Bacteria | 1899 |
| 249 | Ga0207661_10443721 | 3300025944 | Bacteria | 1181 |
| 250 | Ga0207712_10004332 | 3300025961 | Bacteria | 8964 |
| 251 | Ga0207658_10381825 | 3300025986 | Bacteria | 1234 |
| 252 | Ga0207677_10019726 | 3300026023 | Bacteria | 4078 |
| 253 | Ga0207639_10045621 | 3300026041 | Bacteria | 3302 |
| 254 | Ga0207678_10297588 | 3300026067 | Bacteria | 1386 |
| 255 | Ga0207678_10813117 | 3300026067 | Bacteria | 825 |
| 256 | Ga0207708_10000434 | 3300026075 | Bacteria | 32516 |
| 257 | Ga0207702_10040757 | 3300026078 | Bacteria | 3893 |
| 258 | Ga0207702_10366288 | 3300026078 | Bacteria | 1382 |
| 259 | Ga0207702_10781942 | 3300026078 | Bacteria | 943 |
| 260 | Ga0207702_10994629 | 3300026078 | Bacteria | 832 |
| 261 | Ga0207641_10736814 | 3300026088 | Bacteria | 972 |
| 262 | Ga0207648_10002641 | 3300026089 | Bacteria | 19147 |
| 263 | Ga0207683_10006588 | 3300026121 | Bacteria | 9935 |
| 264 | Ga0207683_10305271 | 3300026121 | Bacteria | 1456 |
| 265 | Ga0207698_10022867 | 3300026142 | Bacteria | 4357 |
| 266 | Ga0207428_10905526 | 3300027907 | Bacteria | 623 |
| 267 | Ga0268266_10103613 | 3300028379 | Bacteria | 2511 |
| 268 | Ga0268265_10069817 | 3300028380 | Bacteria | 2730 |
| 269 | Ga0268264_10310941 | 3300028381 | Bacteria | 1487 |
| 270 | Ga0265338_10002048 | 3300028800 | Bacteria | 31167 |
| 271 | Ga0265338_10037077 | 3300028800 | Bacteria | 4648 |
| 272 | Ga0265338_10176004 | 3300028800 | Bacteria | 1635 |
| 273 | Ga0265330_10083666 | 3300031235 | Bacteria | 1373 |
| 274 | Ga0265325_10011700 | 3300031241 | Bacteria | 5036 |
| 275 | Ga0265327_10019983 | 3300031251 | Bacteria | 4099 |
| 276 | Ga0265327_10091882 | 3300031251 | Bacteria | 1478 |
| 277 | Ga0265316_10035575 | 3300031344 | Bacteria | 4034 |
| 278 | Ga0265316_10829776 | 3300031344 | Bacteria | 648 |
| 279 | Ga0307408_100428254 | 3300031548 | Bacteria | 1143 |
| 280 | Ga0265313_10039754 | 3300031595 | Bacteria | 2331 |
| 281 | Ga0265314_10032932 | 3300031711 | Bacteria | 3806 |
| 282 | Ga0307406_10684587 | 3300031901 | Bacteria | 855 |
| 283 | Ga0307409_100135212 | 3300031995 | Bacteria | 2114 |
| 284 | Ga0307409_101126912 | 3300031995 | Bacteria | 806 |
| 285 | Ga0307415_100226484 | 3300032126 | Bacteria | 1503 |
| 286 | Ga0307415_100776455 | 3300032126 | Bacteria | 872 |
| 287 | Ga0373932_0179749 | 3300035112 | Bacteria | 742 |
| 288 | Ga0373957_0021029 | 3300035120 | Bacteria | 2312 |
| 289 | Ga0373960_0077354 | 3300035121 | Bacteria | 1041 |
| 290 | Ga0373955_0103417 | 3300035172 | Bacteria | 1638 |
| 291 | Ga0373962_0019918 | 3300035242 | Bacteria | 1758 |
| 292 | Ga0373924_0230323 | 3300035410 | Bacteria | 819 |
| 293 | Ga0373933_0056345 | 3300035724 | Bacteria | 2359 |
| 294 | Ga0373937_0389745 | 3300036401 | Bacteria | 1321 |
| 295 | Ga0395899_0001247 | 3300037312 | Bacteria | 22094 |
| 296 | Ga0395899_0022282 | 3300037312 | Bacteria | 4804 |
| 297 | Ga0395899_0022398 | 3300037312 | Bacteria | 4791 |
| 298 | Ga0395899_0055815 | 3300037312 | Bacteria | 2921 |
| 299 | Ga0395900_0000528 | 3300037418 | Bacteria | 53945 |
| 300 | Ga0395900_0000929 | 3300037418 | Bacteria | 38304 |
| 301 | Ga0395900_0012327 | 3300037418 | Bacteria | 8745 |
| 302 | Ga0395900_0020618 | 3300037418 | Bacteria | 6734 |
| 303 | Ga0395900_0024631 | 3300037418 | Bacteria | 6159 |
| 304 | Ga0395900_0028435 | 3300037418 | Bacteria | 5726 |
| 305 | Ga0395900_0107562 | 3300037418 | Bacteria | 2865 |
| 306 | Ga0395900_0182550 | 3300037418 | Bacteria | 2131 |
| 307 | Ga0395900_0467714 | 3300037418 | Bacteria | 1215 |
| 308 | Ga0395900_0841562 | 3300037418 | Bacteria | 843 |
| 309 | Ga0395898_0002139 | 3300037466 | Bacteria | 24346 |
| 310 | Ga0395898_0003495 | 3300037466 | Bacteria | 17560 |
| 311 | Ga0395898_0008588 | 3300037466 | Bacteria | 10780 |
| 312 | Ga0395898_0009600 | 3300037466 | Bacteria | 10161 |
| 313 | Ga0395898_0010892 | 3300037466 | Bacteria | 9489 |
| 314 | Ga0395898_0017551 | 3300037466 | Bacteria | 7305 |
| 315 | Ga0395898_0018907 | 3300037466 | Bacteria | 7020 |
| 316 | Ga0395898_0031535 | 3300037466 | Bacteria | 5295 |
| 317 | Ga0395898_0264603 | 3300037466 | Bacteria | 1640 |
| 318 | Ga0395898_0318588 | 3300037466 | Bacteria | 1483 |
| 319 | Ga0395898_0502199 | 3300037466 | Bacteria | 1153 |
| 320 | Ga0395898_0599200 | 3300037466 | Bacteria | 1044 |
| 321 | Ga0395898_0712537 | 3300037466 | Bacteria | 945 |
| 322 | Ga0395905_0000661 | 3300037471 | Bacteria | 45819 |
| 323 | Ga0395905_0005716 | 3300037471 | Bacteria | 12642 |
| 324 | Ga0395905_0023587 | 3300037471 | Bacteria | 5812 |
| 325 | Ga0395905_0027711 | 3300037471 | Bacteria | 5342 |
| 326 | Ga0395905_0033887 | 3300037471 | Bacteria | 4797 |
| 327 | Ga0395905_0084950 | 3300037471 | Bacteria | 2966 |
| 328 | Ga0395905_0110005 | 3300037471 | Bacteria | 2587 |
| 329 | Ga0395905_0486647 | 3300037471 | Bacteria | 1133 |
| 330 | Ga0395905_0503503 | 3300037471 | Bacteria | 1111 |
| 331 | Ga0395905_0578817 | 3300037471 | Bacteria | 1024 |
| 332 | Ga0395901_0001602 | 3300038443 | Bacteria | 23437 |
| 333 | Ga0395901_0001739 | 3300038443 | Bacteria | 22507 |
| 334 | Ga0395901_0003765 | 3300038443 | Bacteria | 15289 |
| 335 | Ga0395901_0009363 | 3300038443 | Bacteria | 9934 |
| 336 | Ga0395901_0023866 | 3300038443 | Bacteria | 6273 |
| 337 | Ga0395901_0034145 | 3300038443 | Bacteria | 5253 |
| 338 | Ga0395901_0105320 | 3300038443 | Bacteria | 2960 |
| 339 | Ga0395901_0121071 | 3300038443 | Bacteria | 2750 |
| 340 | Ga0395901_0256914 | 3300038443 | Bacteria | 1819 |
| 341 | Ga0395901_0269205 | 3300038443 | Bacteria | 1772 |
| 342 | Ga0395901_0306684 | 3300038443 | Bacteria | 1645 |
| 343 | Ga0395901_0346615 | 3300038443 | Bacteria | 1533 |
| 344 | Ga0395901_0416957 | 3300038443 | Bacteria | 1377 |
| 345 | Ga0395901_0417481 | 3300038443 | Bacteria | 1376 |
| 346 | Ga0395901_0438974 | 3300038443 | Bacteria | 1336 |
| 347 | Ga0395901_0538128 | 3300038443 | Unclassified | 1185 |
| 348 | Ga0395901_0673512 | 3300038443 | Bacteria | 1035 |
| 349 | Ga0395901_1001733 | 3300038443 | Bacteria | 811 |
| 350 | Ga0395901_1170640 | 3300038443 | Bacteria | 736 |
| 351 | Ga0439453_0031552 | 3300041408 | Bacteria | 1006 |
| 352 | Ga0439466_0052194 | 3300041411 | Bacteria | 1337 |
| 353 | Ga0451791_1238341 | 3300041451 | Bacteria | 898 |
| 354 | Ga0451847_0957932 | 3300041503 | Unclassified | 648 |
| 355 | Ga0451843_1640951 | 3300041509 | Bacteria | 890 |
| 356 | Ga0451855_0177353 | 3300041511 | Bacteria | 2063 |
| 357 | Ga0451853_2407108 | 3300041512 | Bacteria | 1007 |
| 358 | Ga0451853_4101398 | 3300041512 | Bacteria | 1260 |
| 359 | Ga0439448_0004580 | 3300042005 | Bacteria | 3907 |
| 360 | Ga0439448_0017016 | 3300042005 | Bacteria | 2217 |
| 361 | Ga0439454_016454 | 3300042011 | Bacteria | 1046 |
| 362 | Ga0439455_0026431 | 3300042012 | Bacteria | 1417 |
| 363 | Ga0439455_0032572 | 3300042012 | Bacteria | 1304 |
| 364 | Ga0439455_0082263 | 3300042012 | Bacteria | 876 |
| 365 | Ga0439456_009130 | 3300042013 | Bacteria | 2048 |
| 366 | Ga0450914_000795 | 3300042118 | Bacteria | 1700 |
| 367 | Ga0450917_005151 | 3300042120 | Unclassified | 969 |
| 368 | Ga0450920_006368 | 3300042122 | Bacteria | 2123 |
| 369 | Ga0439460_0078707 | 3300042461 | Bacteria | 1032 |
| 370 | Ga0466961_0014162 | 3300044693 | Bacteria | 5117 |
| 371 | Ga0466963_0003495 | 3300044694 | Bacteria | 9015 |
| 372 | Ga0466963_0025770 | 3300044694 | Bacteria | 3753 |
| 373 | Ga0466963_0032633 | 3300044694 | Bacteria | 3374 |
| 374 | Ga0466963_0045512 | 3300044694 | Bacteria | 2890 |
| 375 | Ga0466963_0055679 | 3300044694 | Bacteria | 2630 |
| 376 | Ga0466963_0410885 | 3300044694 | Bacteria | 954 |
| 377 | Ga0466964_0005225 | 3300044706 | Bacteria | 4815 |
| 378 | Ga0466964_0182848 | 3300044706 | Bacteria | 995 |
| 379 | Ga0466964_0284676 | 3300044706 | Bacteria | 827 |
| 380 | Ga0466971_0005123 | 3300044719 | Bacteria | 5676 |
| 381 | Ga0466971_0032999 | 3300044719 | Bacteria | 2320 |
| 382 | Ga0466968_0036149 | 3300044735 | Bacteria | 2069 |
| 383 | Ga0466957_0136273 | 3300044842 | Bacteria | 1578 |
| 384 | Ga0466957_0160061 | 3300044842 | Bacteria | 1462 |
| 385 | Ga0466957_0174852 | 3300044842 | Bacteria | 1400 |
| 386 | Ga0466957_0398821 | 3300044842 | Bacteria | 940 |
| 387 | Ga0451576_0062862 | 3300045051 | Bacteria | 3870 |
| 388 | Ga0451576_0067477 | 3300045051 | Bacteria | 3724 |
| 389 | Ga0466958_0000555 | 3300045836 | Bacteria | 15880 |
| 390 | Ga0466958_0023339 | 3300045836 | Bacteria | 3630 |
| 391 | Ga0466967_0018104 | 3300045976 | Bacteria | 5620 |
| 392 | Ga0466967_0030284 | 3300045976 | Bacteria | 4540 |
| 393 | Ga0466967_0073452 | 3300045976 | Bacteria | 3069 |
| 394 | Ga0466967_0082042 | 3300045976 | Bacteria | 2913 |
| 395 | Ga0466967_0149725 | 3300045976 | Bacteria | 2180 |
| 396 | Ga0466967_0357779 | 3300045976 | Bacteria | 1414 |
| 397 | Ga0466967_0439012 | 3300045976 | Bacteria | 1274 |
| 398 | Ga0466967_1297551 | 3300045976 | Bacteria | 725 |
| 399 | Ga0495627_176234 | 3300046453 | Unclassified | 593 |
| 400 | Ga0495603_0077703 | 3300046455 | Bacteria | 1947 |
| 401 | Ga0495603_0127388 | 3300046455 | Bacteria | 1483 |
| 402 | Ga0495603_0157395 | 3300046455 | Bacteria | 1318 |
| 403 | Ga0495641_0036815 | 3300046461 | Bacteria | 2297 |
| 404 | Ga0495641_0134365 | 3300046461 | Unclassified | 1104 |
| 405 | Ga0495641_0228767 | 3300046461 | Bacteria | 834 |
| 406 | Ga0495651_0212426 | 3300046462 | Bacteria | 1345 |
| 407 | Ga0495653_0224620 | 3300046463 | Bacteria | 1260 |
| 408 | Ga0495653_0394720 | 3300046463 | Bacteria | 881 |
| 409 | Ga0495582_0017452 | 3300046473 | Bacteria | 3928 |
| 410 | Ga0495582_0382362 | 3300046473 | Unclassified | 811 |
| 411 | Ga0495639_0275647 | 3300046475 | Bacteria | 835 |
| 412 | Ga0495664_0294987 | 3300046477 | Unclassified | 979 |
| 413 | Ga0495585_0035552 | 3300046492 | Bacteria | 2814 |
| 414 | Ga0495585_0155960 | 3300046492 | Bacteria | 1188 |
| 415 | Ga0495585_0177735 | 3300046492 | Bacteria | 1096 |
| 416 | Ga0495594_0270128 | 3300046499 | Bacteria | 969 |
| 417 | Ga0495594_0297220 | 3300046499 | Bacteria | 920 |
| 418 | Ga0495596_0075480 | 3300046500 | Bacteria | 1309 |
| 419 | Ga0495596_0117323 | 3300046500 | Bacteria | 1034 |
| 420 | Ga0495596_0153004 | 3300046500 | Bacteria | 896 |
| 421 | Ga0495596_0245209 | 3300046500 | Unclassified | 695 |
| 422 | Ga0495607_0047833 | 3300046501 | Bacteria | 2503 |
| 423 | Ga0495607_0146158 | 3300046501 | Bacteria | 1215 |
| 424 | Ga0495608_0179834 | 3300046511 | Bacteria | 1338 |
| 425 | Ga0495618_0200261 | 3300046514 | Bacteria | 1264 |
| 426 | Ga0495628_0206062 | 3300046516 | Bacteria | 1480 |
| 427 | Ga0495628_0439861 | 3300046516 | Bacteria | 948 |
| 428 | Ga0495630_0413930 | 3300046517 | Bacteria | 1033 |
| 429 | Ga0495644_0002130 | 3300046523 | Bacteria | 7939 |
| 430 | Ga0495663_0039020 | 3300046525 | Bacteria | 1438 |
| 431 | Ga0495663_0134772 | 3300046525 | Bacteria | 835 |
| 432 | Ga0495642_0063768 | 3300046528 | Bacteria | 1532 |
| 433 | Ga0495642_0126155 | 3300046528 | Bacteria | 1100 |
| 434 | Ga0495642_0237858 | 3300046528 | Bacteria | 796 |
| 435 | Ga0495652_0131476 | 3300046529 | Bacteria | 1981 |
| 436 | Ga0495652_0483631 | 3300046529 | Bacteria | 861 |
| 437 | Ga0495586_0138047 | 3300046535 | Unclassified | 1367 |
| 438 | Ga0495587_0094499 | 3300046536 | Bacteria | 1726 |
| 439 | Ga0495621_0158474 | 3300046539 | Bacteria | 894 |
| 440 | Ga0495645_0110459 | 3300046543 | Bacteria | 1946 |
| 441 | Ga0495645_0374668 | 3300046543 | Bacteria | 912 |
| 442 | Ga0495667_0045869 | 3300046559 | Bacteria | 2891 |
| 443 | Ga0495667_0071671 | 3300046559 | Bacteria | 2259 |
| 444 | Ga0495667_0708842 | 3300046559 | Bacteria | 623 |
| 445 | Ga0495656_0010596 | 3300046615 | Bacteria | 3357 |
| 446 | Ga0495656_0067924 | 3300046615 | Bacteria | 1574 |
| 447 | Ga0495656_0379885 | 3300046615 | Bacteria | 736 |
| 448 | Ga0495634_0013364 | 3300046642 | Bacteria | 5933 |
| 449 | Ga0495611_0005390 | 3300046648 | Bacteria | 5475 |
| 450 | Ga0495611_0090748 | 3300046648 | Bacteria | 1412 |
| 451 | Ga0495659_0147664 | 3300046664 | Bacteria | 942 |
| 452 | Ga0495661_0036475 | 3300046665 | Bacteria | 3079 |
| 453 | Ga0495588_0028333 | 3300046674 | Bacteria | 2803 |
| 454 | Ga0495588_0348885 | 3300046674 | Bacteria | 778 |
| 455 | Ga0495657_0022704 | 3300046675 | Bacteria | 4490 |
| 456 | Ga0495599_0205320 | 3300046678 | Bacteria | 1210 |
| 457 | Ga0495646_0084834 | 3300046680 | Bacteria | 1839 |
| 458 | Ga0495647_0032089 | 3300046681 | Bacteria | 1956 |
| 459 | Ga0495647_0183023 | 3300046681 | Bacteria | 912 |
| 460 | Ga0495658_0123416 | 3300046683 | Bacteria | 1569 |
| 461 | Ga0495658_0160442 | 3300046683 | Unclassified | 1386 |
| 462 | Ga0495658_0269902 | 3300046683 | Bacteria | 1072 |
| 463 | Ga0495658_0346437 | 3300046683 | Bacteria | 944 |
| 464 | Ga0495613_0018523 | 3300046689 | Bacteria | 5191 |
| 465 | Ga0495613_0117890 | 3300046689 | Bacteria | 1909 |
| 466 | Ga0495624_0209441 | 3300046690 | Bacteria | 1183 |
| 467 | Ga0495670_0121638 | 3300046691 | Bacteria | 1356 |
| 468 | Ga0495670_0171972 | 3300046691 | Bacteria | 1141 |
| 469 | Ga0495589_0003474 | 3300046794 | Bacteria | 8524 |
| 470 | Ga0495600_0226585 | 3300046809 | Bacteria | 1194 |
| 471 | Ga0495581_0006841 | 3300047315 | Bacteria | 6613 |
| 472 | Ga0495604_0229981 | 3300047317 | Bacteria | 1272 |
| 473 | Ga0495604_0519229 | 3300047317 | Bacteria | 771 |
| 474 | Ga0495674_0142147 | 3300047319 | Bacteria | 2017 |
| 475 | Ga0495676_0015889 | 3300047321 | Bacteria | 6690 |
| 476 | Ga0495676_0274888 | 3300047321 | Bacteria | 1142 |
| 477 | Ga0495680_0124481 | 3300047322 | Bacteria | 1900 |
| 478 | Ga0495680_0262672 | 3300047322 | Bacteria | 1221 |
| 479 | Ga0495680_0472068 | 3300047322 | Bacteria | 855 |
| 480 | Ga0495679_041023 | 3300047446 | Bacteria | 1436 |
| 481 | Ga0495684_0085002 | 3300047471 | Bacteria | 2399 |
| 482 | Ga0495684_0098060 | 3300047471 | Bacteria | 2216 |
| 483 | Ga0495684_0308364 | 3300047471 | Bacteria | 1135 |
| 484 | Ga0495614_0186915 | 3300048089 | Unclassified | 934 |
| 485 | Ga0495614_0354557 | 3300048089 | Bacteria | 684 |
| 486 | Ga0495615_0066534 | 3300048090 | Bacteria | 963 |
| 487 | Ga0496100_0034400 | 3300048903 | Bacteria | 3179 |
| 488 | Ga0496100_0108463 | 3300048903 | Bacteria | 1925 |
| 489 | Ga0496101_0004691 | 3300048904 | Bacteria | 8654 |
| 490 | Ga0496101_0019494 | 3300048904 | Bacteria | 4630 |
| 491 | Ga0496101_0078019 | 3300048904 | Bacteria | 2442 |
| 492 | Ga0496102_0001550 | 3300048905 | Bacteria | 20301 |
| 493 | Ga0496102_0331755 | 3300048905 | Bacteria | 1433 |
| 494 | Ga0496102_0370947 | 3300048905 | Bacteria | 1347 |
| 495 | Ga0496103_0006198 | 3300048906 | Bacteria | 7145 |
| 496 | Ga0496104_0011510 | 3300048907 | Bacteria | 7927 |
| 497 | Ga0496104_0054094 | 3300048907 | Bacteria | 3794 |
| 498 | Ga0496104_0073268 | 3300048907 | Bacteria | 3258 |
| 499 | Ga0496104_0082424 | 3300048907 | Bacteria | 3067 |
| 500 | Ga0496104_0196231 | 3300048907 | Bacteria | 1931 |
| 501 | Ga0496104_0260432 | 3300048907 | Bacteria | 1647 |
| 502 | Ga0496105_0006331 | 3300048908 | Bacteria | 9093 |
| 503 | Ga0496105_0014915 | 3300048908 | Bacteria | 6185 |
| 504 | Ga0496105_0135698 | 3300048908 | Bacteria | 2027 |
| 505 | Ga0496105_0262801 | 3300048908 | Bacteria | 1395 |
| 506 | Ga0496106_0011574 | 3300048909 | Bacteria | 6520 |
| 507 | Ga0496106_0019910 | 3300048909 | Bacteria | 4976 |
| 508 | Ga0496107_0001749 | 3300048910 | Bacteria | 13668 |
| 509 | Ga0496107_0006312 | 3300048910 | Bacteria | 8147 |
| 510 | Ga0496107_0054304 | 3300048910 | Bacteria | 2891 |
| 511 | Ga0496107_0082299 | 3300048910 | Bacteria | 2348 |
| 512 | Ga0496108_0015170 | 3300048911 | Bacteria | 6285 |
| 513 | Ga0496108_0017772 | 3300048911 | Bacteria | 5816 |
| 514 | Ga0496108_0074145 | 3300048911 | Bacteria | 2873 |
| 515 | Ga0496108_0083422 | 3300048911 | Bacteria | 2711 |
| 516 | Ga0496108_0156093 | 3300048911 | Bacteria | 1971 |
| 517 | Ga0496108_0498443 | 3300048911 | Bacteria | 1064 |
| 518 | Ga0496108_0559729 | 3300048911 | Bacteria | 997 |
| 519 | Ga0496109_0002480 | 3300048912 | Bacteria | 15458 |
| 520 | Ga0496109_0044381 | 3300048912 | Bacteria | 4032 |
| 521 | Ga0496109_0259030 | 3300048912 | Bacteria | 1638 |
| 522 | Ga0496109_0263528 | 3300048912 | Bacteria | 1623 |
| 523 | Ga0496109_0791076 | 3300048912 | Unclassified | 886 |
| 524 | Ga0496110_0014207 | 3300048913 | Bacteria | 6606 |
| 525 | Ga0496110_0076371 | 3300048913 | Bacteria | 2979 |
| 526 | Ga0496110_0201306 | 3300048913 | Bacteria | 1809 |
| 527 | Ga0496110_0272531 | 3300048913 | Bacteria | 1541 |
| 528 | Ga0496110_0318439 | 3300048913 | Unclassified | 1417 |
| 529 | Ga0496110_1174103 | 3300048913 | Bacteria | 676 |
| 530 | Ga0496111_0001848 | 3300048914 | Bacteria | 12482 |
| 531 | Ga0496111_0018470 | 3300048914 | Bacteria | 4832 |
| 532 | Ga0496111_0161028 | 3300048914 | Bacteria | 1666 |
| 533 | Ga0496111_0313610 | 3300048914 | Bacteria | 1162 |
| 534 | Ga0496112_0017461 | 3300048915 | Bacteria | 6741 |
| 535 | Ga0496112_0056358 | 3300048915 | Bacteria | 3867 |
| 536 | Ga0496112_0062637 | 3300048915 | Bacteria | 3669 |
| 537 | Ga0496112_0702998 | 3300048915 | Bacteria | 939 |
| 538 | Ga0496112_0757818 | 3300048915 | Bacteria | 897 |
| 539 | Ga0496112_0797206 | 3300048915 | Bacteria | 869 |
| 540 | Ga0496112_0888855 | 3300048915 | Bacteria | 813 |
| 541 | Ga0496113_0231003 | 3300048916 | Bacteria | 1475 |
| 542 | Ga0496113_0352820 | 3300048916 | Bacteria | 1180 |
| 543 | Ga0496113_0364687 | 3300048916 | Bacteria | 1159 |
| 544 | Ga0496113_0884574 | 3300048916 | Bacteria | 707 |
| 545 | Ga0496114_0007714 | 3300048917 | Bacteria | 8512 |
| 546 | Ga0496114_0011850 | 3300048917 | Bacteria | 6976 |
| 547 | Ga0496114_0029172 | 3300048917 | Bacteria | 4532 |
| 548 | Ga0496114_0084964 | 3300048917 | Bacteria | 2680 |
| 549 | Ga0496114_0164022 | 3300048917 | Bacteria | 1934 |
| 550 | Ga0496114_0324283 | 3300048917 | Bacteria | 1361 |
| 551 | Ga0496114_0659600 | 3300048917 | Bacteria | 920 |
| 552 | Ga0496115_0001849 | 3300048918 | Bacteria | 15140 |
| 553 | Ga0496115_0031246 | 3300048918 | Bacteria | 4194 |
| 554 | Ga0496115_0034215 | 3300048918 | Bacteria | 4015 |
| 555 | Ga0496115_0294146 | 3300048918 | Bacteria | 1331 |
| 556 | Ga0496115_0609071 | 3300048918 | Bacteria | 867 |
| 557 | Ga0501031_0109728 | 3300049568 | Bacteria | 1802 |
| 558 | Ga0501039_0330282 | 3300049575 | Bacteria | 1198 |
| 559 | Ga0501040_0088997 | 3300049576 | Bacteria | 2145 |
| 560 | Ga0501040_0132496 | 3300049576 | Bacteria | 1753 |
| 561 | Ga0501040_0244757 | 3300049576 | Bacteria | 1279 |
| 562 | Ga0501040_0426173 | 3300049576 | Bacteria | 954 |
| 563 | Ga0501041_0209328 | 3300049577 | Bacteria | 1223 |
| 564 | Ga0501041_0715275 | 3300049577 | Bacteria | 641 |
| 565 | Ga0501042_0276372 | 3300049578 | Bacteria | 1213 |
| 566 | Ga0501047_0536099 | 3300049581 | Bacteria | 995 |
| 567 | Ga0501048_0662280 | 3300049582 | Bacteria | 750 |
| 568 | Ga0501067_0001839 | 3300049583 | Bacteria | 11670 |
| 569 | Ga0501067_0022660 | 3300049583 | Bacteria | 3476 |
| 570 | Ga0501067_0042956 | 3300049583 | Bacteria | 2510 |
| 571 | Ga0501067_0339271 | 3300049583 | Bacteria | 837 |
| 572 | Ga0501068_0035879 | 3300049584 | Bacteria | 2962 |
| 573 | Ga0501068_0269254 | 3300049584 | Bacteria | 1087 |
| 574 | Ga0501069_0005259 | 3300049585 | Bacteria | 6723 |
| 575 | Ga0501071_0091668 | 3300049587 | Bacteria | 2233 |
| 576 | Ga0501071_0103454 | 3300049587 | Bacteria | 2101 |
| 577 | Ga0501071_0192200 | 3300049587 | Bacteria | 1531 |
| 578 | Ga0501072_0182551 | 3300049588 | Bacteria | 1674 |
| 579 | Ga0501072_0257062 | 3300049588 | Bacteria | 1391 |
| 580 | Ga0501072_0288118 | 3300049588 | Unclassified | 1306 |
| 581 | Ga0501074_0187294 | 3300049590 | Bacteria | 1476 |
| 582 | Ga0501075_0136224 | 3300049591 | Bacteria | 1871 |
| 583 | Ga0501075_0944545 | 3300049591 | Bacteria | 655 |
| 584 | Ga0501077_0167938 | 3300049593 | Bacteria | 1394 |
| 585 | Ga0501079_0102540 | 3300049741 | Bacteria | 2219 |
| 586 | Ga0501079_0305742 | 3300049741 | Bacteria | 1244 |
| 587 | Ga0501081_0140264 | 3300049743 | Bacteria | 1732 |
| 588 | Ga0501081_0626381 | 3300049743 | Bacteria | 806 |
| 589 | Ga0501083_0395053 | 3300049744 | Bacteria | 900 |
| 590 | Ga0501083_0607682 | 3300049744 | Bacteria | 711 |
| 591 | Ga0501044_0382320 | 3300049823 | Bacteria | 1323 |
| 592 | Ga0501045_0056450 | 3300049824 | Bacteria | 2872 |
| 593 | Ga0501045_0142244 | 3300049824 | Bacteria | 1784 |
| 594 | Ga0501045_0299010 | 3300049824 | Bacteria | 1198 |
| 595 | nmdc:mga00v17_211740_c1 | 3300050491 | Bacteria | 1254 |
| 596 | nmdc:mga05p37_105493_c1 | 3300050507 | Bacteria | 3467 |
| 597 | nmdc:mga05p37_111967_c1 | 3300050507 | Bacteria | 3356 |
| 598 | nmdc:mga05p37_136458_c1 | 3300050507 | Bacteria | 3008 |
| 599 | nmdc:mga05p37_149619_c1 | 3300050507 | Bacteria | 2857 |
| 600 | nmdc:mga06r32_323513_c1 | 3300050510 | Bacteria | 1527 |
| 601 | nmdc:mga06r32_65761_c1 | 3300050510 | Bacteria | 3498 |
| 602 | nmdc:mga06r32_861657_c1 | 3300050510 | Bacteria | 864 |
| 603 | nmdc:mga08y16_237134_c1 | 3300050511 | Bacteria | 1886 |
| 604 | nmdc:mga08y16_315673_c1 | 3300050511 | Bacteria | 1609 |
| 605 | nmdc:mga08y16_976175_c1 | 3300050511 | Bacteria | 829 |
| 606 | nmdc:mga0n895_1015942_c1 | 3300050512 | Bacteria | 810 |
| 607 | nmdc:mga0n895_22984_c1 | 3300050512 | Bacteria | 5853 |
| 608 | nmdc:mga0n895_365647_c1 | 3300050512 | Bacteria | 1460 |
| 609 | nmdc:mga0n895_49545_c1 | 3300050512 | Bacteria | 4116 |
| 610 | nmdc:mga0n895_610042_c1 | 3300050512 | Bacteria | 1093 |
| 611 | nmdc:mga0n895_64234_c1 | 3300050512 | Bacteria | 3631 |
| 612 | nmdc:mga0n895_650154_c1 | 3300050512 | Bacteria | 1053 |
| 613 | nmdc:mga0rr50_175252_c1 | 3300050513 | Bacteria | 1750 |
| 614 | nmdc:mga0rr50_212011_c1 | 3300050513 | Bacteria | 1596 |
| 615 | nmdc:mga0rr50_25078_c1 | 3300050513 | Bacteria | 4142 |
| 616 | nmdc:mga0rr50_371358_c1 | 3300050513 | Bacteria | 1205 |
| 617 | nmdc:mga08x19_3167_c1 | 3300050514 | Bacteria | 9874 |
| 618 | nmdc:mga0a205_15536_c1 | 3300050515 | Bacteria | 7115 |
| 619 | nmdc:mga0a205_192468_c1 | 3300050515 | Bacteria | 1931 |
| 620 | Ga0495601_0089704 | 3300053077 | Bacteria | 1977 |
| 621 | Ga0495655_0150883 | 3300053083 | Bacteria | 731 |
| 622 | Ga0495595_0111604 | 3300053084 | Bacteria | 1326 |
| 623 | Ga0495595_0243151 | 3300053084 | Bacteria | 900 |
| 624 | Ga0495619_0110205 | 3300053085 | Bacteria | 1880 |
| 625 | Ga0495619_0133910 | 3300053085 | Bacteria | 1704 |
| 626 | Ga0495619_0394848 | 3300053085 | Unclassified | 955 |
| 627 | Ga0501084_0305330 | 3300054114 | Bacteria | 1344 |
| 628 | Ga0501084_0950722 | 3300054114 | Bacteria | 722 |
| 629 | Ga0590071_029440 | 3300059421 | Bacteria | 1305 |
| 630 | Ga0501082_1179501 | 3300060353 | Bacteria | 669 |
| 631 | Ga0466962_0004154 | 3300061719 | Bacteria | 6942 |
| 632 | Ga0466962_0065206 | 3300061719 | Bacteria | 1739 |
| 633 | Ga0466962_0341031 | 3300061719 | Bacteria | 745 |
| 634 | Ga0530510_0235480 | 3300061734 | Bacteria | 1362 |
| 635 | Ga0530510_0247340 | 3300061734 | Bacteria | 1328 |
| 636 | Ga0530510_0295871 | 3300061734 | Bacteria | 1211 |
| 637 | Ga0530510_0906747 | 3300061734 | Bacteria | 674 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048915 | Ga0496112_0757818 | Ga0496112_0757818_256_822 | 156 |
| 2 | 3300005435 | Ga0070714_100284742 | Ga0070714_1002847422 | 157 |
| 3 | 3300025929 | Ga0207664_10113134 | Ga0207664_101131342 | 157 |
| 4 | 3300041408 | Ga0439453_0031552 | Ga0439453_0031552_39_590 | 157 |
| 5 | 3300042012 | Ga0439455_0026431 | Ga0439455_0026431_231_782 | 157 |
| 6 | 3300042118 | Ga0450914_000795 | Ga0450914_000795_510_1061 | 157 |
| 7 | 3300042120 | Ga0450917_005151 | Ga0450917_005151_218_769 | 157 |
| 8 | 3300042122 | Ga0450920_006368 | Ga0450920_006368_401_952 | 157 |
| 9 | 3300005471 | Ga0070698_100146609 | Ga0070698_1001466093 | 158 |
| 10 | 3300005536 | Ga0070697_100704590 | Ga0070697_1007045902 | 158 |
| 11 | 3300046516 | Ga0495628_0206062 | Ga0495628_0206062_38_658 | 158 |
| 12 | 3300061734 | Ga0530510_0906747 | Ga0530510_0906747_62_619 | 158 |
| 13 | 3300005437 | Ga0070710_10281210 | Ga0070710_102812103 | 159 |
| 14 | 3300006844 | Ga0075428_100766993 | Ga0075428_1007669932 | 159 |
| 15 | 3300009093 | Ga0105240_10736098 | Ga0105240_107360982 | 159 |
| 16 | 3300009094 | Ga0111539_10543509 | Ga0111539_105435091 | 159 |
| 17 | 3300050511 | nmdc:mga08y16_315673_c1 | nmdc:mga08y16_315673_c1_936_1502 | 159 |
| 18 | 3300005539 | Ga0068853_100291773 | Ga0068853_1002917732 | 160 |
| 19 | 3300005327 | Ga0070658_11046640 | Ga0070658_110466401 | 161 |
| 20 | 3300044694 | Ga0466963_0003495 | Ga0466963_0003495_7834_8367 | 162 |
| 21 | 3300044694 | Ga0466963_0025770 | Ga0466963_0025770_2094_2627 | 162 |
| 22 | 3300044706 | Ga0466964_0182848 | Ga0466964_0182848_60_593 | 162 |
| 23 | 3300044842 | Ga0466957_0160061 | Ga0466957_0160061_295_828 | 162 |
| 24 | 3300045836 | Ga0466958_0000555 | Ga0466958_0000555_6221_6754 | 162 |
| 25 | 3300045976 | Ga0466967_0018104 | Ga0466967_0018104_2638_3171 | 162 |
| 26 | 3300045976 | Ga0466967_0030284 | Ga0466967_0030284_2068_2601 | 162 |
| 27 | 3300046461 | Ga0495641_0134365 | Ga0495641_0134365_10_528 | 162 |
| 28 | 3300050491 | nmdc:mga00v17_211740_c1 | nmdc:mga00v17_211740_c1_639_1214 | 162 |
| 29 | 3300005435 | Ga0070714_100412481 | Ga0070714_1004124812 | 163 |
| 30 | 3300005981 | Ga0081538_10009502 | Ga0081538_100095021 | 163 |
| 31 | 3300006028 | Ga0070717_10776215 | Ga0070717_107762152 | 163 |
| 32 | 3300025910 | Ga0207684_10397006 | Ga0207684_103970062 | 163 |
| 33 | 3300025915 | Ga0207693_10003417 | Ga0207693_100034172 | 163 |
| 34 | 3300025929 | Ga0207664_10142046 | Ga0207664_101420463 | 163 |
| 35 | 3300025939 | Ga0207665_10230559 | Ga0207665_102305593 | 163 |
| 36 | 3300046529 | Ga0495652_0483631 | Ga0495652_0483631_74_628 | 163 |
| 37 | 3300048910 | Ga0496107_0082299 | Ga0496107_0082299_68_616 | 163 |
| 38 | 3300048917 | Ga0496114_0029172 | Ga0496114_0029172_3236_3784 | 163 |
| 39 | 3300048918 | Ga0496115_0609071 | Ga0496115_0609071_72_620 | 163 |
| 40 | 3300049578 | Ga0501042_0276372 | Ga0501042_0276372_601_1158 | 163 |
| 41 | 3300005459 | Ga0068867_100325091 | Ga0068867_1003250913 | 164 |
| 42 | 3300005535 | Ga0070684_100272137 | Ga0070684_1002721372 | 164 |
| 43 | 3300006358 | Ga0068871_100309483 | Ga0068871_1003094832 | 164 |
| 44 | 3300009147 | Ga0114129_10206421 | Ga0114129_102064213 | 164 |
| 45 | 3300009148 | Ga0105243_10094679 | Ga0105243_100946792 | 164 |
| 46 | 3300013308 | Ga0157375_10452886 | Ga0157375_104528863 | 164 |
| 47 | 3300014325 | Ga0163163_10969987 | Ga0163163_109699872 | 164 |
| 48 | 3300014969 | Ga0157376_10357208 | Ga0157376_103572083 | 164 |
| 49 | 3300017792 | Ga0163161_10235473 | Ga0163161_102354731 | 164 |
| 50 | 3300026067 | Ga0207678_10813117 | Ga0207678_108131172 | 164 |
| 51 | 3300041451 | Ga0451791_1238341 | Ga0451791_1238341_321_854 | 164 |
| 52 | 3300041512 | Ga0451853_4101398 | Ga0451853_4101398_213_746 | 164 |
| 53 | 3300046674 | Ga0495588_0028333 | Ga0495588_0028333_1618_2148 | 164 |
| 54 | 3300046681 | Ga0495647_0032089 | Ga0495647_0032089_220_750 | 164 |
| 55 | 3300046690 | Ga0495624_0209441 | Ga0495624_0209441_279_812 | 164 |
| 56 | 3300047321 | Ga0495676_0274888 | Ga0495676_0274888_454_984 | 164 |
| 57 | 3300048090 | Ga0495615_0066534 | Ga0495615_0066534_291_821 | 164 |
| 58 | 3300048917 | Ga0496114_0659600 | Ga0496114_0659600_207_740 | 164 |
| 59 | 3300050512 | nmdc:mga0n895_650154_c1 | nmdc:mga0n895_650154_c1_229_798 | 164 |
| 60 | 3300005435 | Ga0070714_100499909 | Ga0070714_1004999092 | 165 |
| 61 | 3300006028 | Ga0070717_10048830 | Ga0070717_100488303 | 165 |
| 62 | 3300025929 | Ga0207664_10551494 | Ga0207664_105514942 | 165 |
| 63 | 3300048914 | Ga0496111_0313610 | Ga0496111_0313610_521_1090 | 165 |
| 64 | 3300049583 | Ga0501067_0022660 | Ga0501067_0022660_2184_2750 | 165 |
| 65 | 3300049583 | Ga0501067_0339271 | Ga0501067_0339271_107_670 | 165 |
| 66 | 3300049584 | Ga0501068_0269254 | Ga0501068_0269254_273_836 | 165 |
| 67 | 3300005536 | Ga0070697_100986152 | Ga0070697_1009861522 | 166 |
| 68 | 3300037418 | Ga0395900_0028435 | Ga0395900_0028435_1474_2040 | 166 |
| 69 | 3300037471 | Ga0395905_0084950 | Ga0395905_0084950_2249_2815 | 166 |
| 70 | 3300038443 | Ga0395901_0023866 | Ga0395901_0023866_2482_3048 | 166 |
| 71 | 3300005329 | Ga0070683_100487069 | Ga0070683_1004870692 | 167 |
| 72 | 3300005535 | Ga0070684_100563617 | Ga0070684_1005636172 | 167 |
| 73 | 3300005937 | Ga0081455_10021779 | Ga0081455_100217794 | 167 |
| 74 | 3300006048 | Ga0075363_100151567 | Ga0075363_1001515672 | 167 |
| 75 | 3300006178 | Ga0075367_10252709 | Ga0075367_102527092 | 167 |
| 76 | 3300006847 | Ga0075431_100071651 | Ga0075431_1000716513 | 167 |
| 77 | 3300006852 | Ga0075433_10000356 | Ga0075433_1000035624 | 167 |
| 78 | 3300006871 | Ga0075434_100006317 | Ga0075434_1000063176 | 167 |
| 79 | 3300006914 | Ga0075436_100018854 | Ga0075436_1000188544 | 167 |
| 80 | 3300007076 | Ga0075435_100021735 | Ga0075435_1000217354 | 167 |
| 81 | 3300009147 | Ga0114129_10005223 | Ga0114129_1000522318 | 167 |
| 82 | 3300026121 | Ga0207683_10305271 | Ga0207683_103052713 | 167 |
| 83 | 3300048907 | Ga0496104_0196231 | Ga0496104_0196231_682_1257 | 167 |
| 84 | 3300049576 | Ga0501040_0132496 | Ga0501040_0132496_531_1085 | 167 |
| 85 | 3300049582 | Ga0501048_0662280 | Ga0501048_0662280_105_659 | 167 |
| 86 | 3300049587 | Ga0501071_0192200 | Ga0501071_0192200_329_883 | 167 |
| 87 | 3300050507 | nmdc:mga05p37_149619_c1 | nmdc:mga05p37_149619_c1_38_598 | 167 |
| 88 | 3300050510 | nmdc:mga06r32_65761_c1 | nmdc:mga06r32_65761_c1_1906_2466 | 167 |
| 89 | 3300050512 | nmdc:mga0n895_22984_c1 | nmdc:mga0n895_22984_c1_715_1275 | 167 |
| 90 | 3300050513 | nmdc:mga0rr50_25078_c1 | nmdc:mga0rr50_25078_c1_1330_1890 | 167 |
| 91 | 3300050514 | nmdc:mga08x19_3167_c1 | nmdc:mga08x19_3167_c1_3172_3732 | 167 |
| 92 | 3300050515 | nmdc:mga0a205_15536_c1 | nmdc:mga0a205_15536_c1_4754_5314 | 167 |
| 93 | 3300054114 | Ga0501084_0950722 | Ga0501084_0950722_107_661 | 167 |
| 94 | 3300060353 | Ga0501082_1179501 | Ga0501082_1179501_19_573 | 167 |
| 95 | 3300005436 | Ga0070713_100194877 | Ga0070713_1001948773 | 168 |
| 96 | 3300025928 | Ga0207700_10000039 | Ga0207700_10000039116 | 168 |
| 97 | 3300042005 | Ga0439448_0004580 | Ga0439448_0004580_804_1361 | 168 |
| 98 | 3300042012 | Ga0439455_0082263 | Ga0439455_0082263_96_653 | 168 |
| 99 | 3300044694 | Ga0466963_0032633 | Ga0466963_0032633_2609_3157 | 168 |
| 100 | 3300049575 | Ga0501039_0330282 | Ga0501039_0330282_52_639 | 168 |
| 101 | 3300049576 | Ga0501040_0244757 | Ga0501040_0244757_194_781 | 168 |
| 102 | 3300049577 | Ga0501041_0209328 | Ga0501041_0209328_365_952 | 168 |
| 103 | 3300049587 | Ga0501071_0103454 | Ga0501071_0103454_1146_1733 | 168 |
| 104 | 3300049588 | Ga0501072_0288118 | Ga0501072_0288118_46_606 | 168 |
| 105 | 3300049593 | Ga0501077_0167938 | Ga0501077_0167938_327_914 | 168 |
| 106 | 3300049741 | Ga0501079_0102540 | Ga0501079_0102540_544_1131 | 168 |
| 107 | 3300049744 | Ga0501083_0395053 | Ga0501083_0395053_248_835 | 168 |
| 108 | 3300054114 | Ga0501084_0305330 | Ga0501084_0305330_228_788 | 168 |
| 109 | 3300061734 | Ga0530510_0235480 | Ga0530510_0235480_475_1062 | 168 |
| 110 | 3300005981 | Ga0081538_10066728 | Ga0081538_100667283 | 169 |
| 111 | 3300025929 | Ga0207664_10031688 | Ga0207664_100316882 | 169 |
| 112 | 3300031344 | Ga0265316_10829776 | Ga0265316_108297762 | 169 |
| 113 | 3300044694 | Ga0466963_0410885 | Ga0466963_0410885_142_699 | 169 |
| 114 | 3300044842 | Ga0466957_0174852 | Ga0466957_0174852_202_759 | 169 |
| 115 | 3300046683 | Ga0495658_0346437 | Ga0495658_0346437_111_683 | 169 |
| 116 | 3300059421 | Ga0590071_029440 | Ga0590071_029440_293_829 | 169 |
| 117 | 3300061719 | Ga0466962_0341031 | Ga0466962_0341031_13_570 | 169 |
| 118 | 3300005355 | Ga0070671_100177071 | Ga0070671_1001770712 | 170 |
| 119 | 3300009098 | Ga0105245_10079275 | Ga0105245_100792753 | 170 |
| 120 | 3300009553 | Ga0105249_10359169 | Ga0105249_103591692 | 170 |
| 121 | 3300010375 | Ga0105239_10382220 | Ga0105239_103822203 | 170 |
| 122 | 3300025927 | Ga0207687_10913967 | Ga0207687_109139672 | 170 |
| 123 | 3300025931 | Ga0207644_10148432 | Ga0207644_101484323 | 170 |
| 124 | 3300035112 | Ga0373932_0179749 | Ga0373932_0179749_175_732 | 170 |
| 125 | 3300035121 | Ga0373960_0077354 | Ga0373960_0077354_220_777 | 170 |
| 126 | 3300035242 | Ga0373962_0019918 | Ga0373962_0019918_516_1073 | 170 |
| 127 | 3300042005 | Ga0439448_0017016 | Ga0439448_0017016_850_1407 | 170 |
| 128 | 3300042012 | Ga0439455_0032572 | Ga0439455_0032572_470_1027 | 170 |
| 129 | 3300045976 | Ga0466967_0073452 | Ga0466967_0073452_1162_1749 | 170 |
| 130 | 3300047322 | Ga0495680_0262672 | Ga0495680_0262672_654_1196 | 170 |
| 131 | 3300050511 | nmdc:mga08y16_976175_c1 | nmdc:mga08y16_976175_c1_199_756 | 170 |
| 132 | 3300005439 | Ga0070711_101033929 | Ga0070711_1010339291 | 171 |
| 133 | 3300005468 | Ga0070707_100763184 | Ga0070707_1007631842 | 171 |
| 134 | 3300005471 | Ga0070698_100006514 | Ga0070698_1000065144 | 171 |
| 135 | 3300006852 | Ga0075433_10256523 | Ga0075433_102565233 | 171 |
| 136 | 3300009094 | Ga0111539_11808581 | Ga0111539_118085812 | 171 |
| 137 | 3300025922 | Ga0207646_10532390 | Ga0207646_105323902 | 171 |
| 138 | 3300045976 | Ga0466967_0082042 | Ga0466967_0082042_89_628 | 171 |
| 139 | 3300045976 | Ga0466967_0357779 | Ga0466967_0357779_674_1192 | 171 |
| 140 | 3300045976 | Ga0466967_0439012 | Ga0466967_0439012_309_827 | 171 |
| 141 | 3300046615 | Ga0495656_0379885 | Ga0495656_0379885_107_634 | 171 |
| 142 | 3300048913 | Ga0496110_1174103 | Ga0496110_1174103_28_633 | 171 |
| 143 | 3300048915 | Ga0496112_0702998 | Ga0496112_0702998_172_777 | 171 |
| 144 | 3300049588 | Ga0501072_0257062 | Ga0501072_0257062_810_1364 | 171 |
| 145 | 3300050507 | nmdc:mga05p37_111967_c1 | nmdc:mga05p37_111967_c1_2080_2685 | 171 |
| 146 | 3300050511 | nmdc:mga08y16_237134_c1 | nmdc:mga08y16_237134_c1_616_1221 | 171 |
| 147 | 3300050515 | nmdc:mga0a205_192468_c1 | nmdc:mga0a205_192468_c1_405_1010 | 171 |
| 148 | 3300005456 | Ga0070678_100641501 | Ga0070678_1006415012 | 172 |
| 149 | 3300031901 | Ga0307406_10684587 | Ga0307406_106845872 | 172 |
| 150 | 3300031995 | Ga0307409_100135212 | Ga0307409_1001352123 | 172 |
| 151 | 3300037312 | Ga0395899_0055815 | Ga0395899_0055815_32_550 | 172 |
| 152 | 3300038443 | Ga0395901_0306684 | Ga0395901_0306684_315_836 | 172 |
| 153 | 3300046455 | Ga0495603_0157395 | Ga0495603_0157395_786_1304 | 172 |
| 154 | 3300046559 | Ga0495667_0708842 | Ga0495667_0708842_20_574 | 172 |
| 155 | 3300047319 | Ga0495674_0142147 | Ga0495674_0142147_591_1145 | 172 |
| 156 | 3300047471 | Ga0495684_0308364 | Ga0495684_0308364_252_806 | 172 |
| 157 | 3300048915 | Ga0496112_0888855 | Ga0496112_0888855_35_583 | 172 |
| 158 | 3300049823 | Ga0501044_0382320 | Ga0501044_0382320_616_1134 | 172 |
| 159 | 3300053085 | Ga0495619_0110205 | Ga0495619_0110205_189_743 | 172 |
| 160 | 3300005328 | Ga0070676_10969579 | Ga0070676_109695791 | 173 |
| 161 | 3300005434 | Ga0070709_10083598 | Ga0070709_100835983 | 173 |
| 162 | 3300005455 | Ga0070663_100858871 | Ga0070663_1008588712 | 173 |
| 163 | 3300005981 | Ga0081538_10049856 | Ga0081538_100498564 | 173 |
| 164 | 3300005985 | Ga0081539_10001480 | Ga0081539_1000148022 | 173 |
| 165 | 3300006871 | Ga0075434_100613660 | Ga0075434_1006136602 | 173 |
| 166 | 3300009147 | Ga0114129_10096674 | Ga0114129_100966744 | 173 |
| 167 | 3300025934 | Ga0207686_10247284 | Ga0207686_102472842 | 173 |
| 168 | 3300025939 | Ga0207665_10200549 | Ga0207665_102005493 | 173 |
| 169 | 3300025944 | Ga0207661_10443721 | Ga0207661_104437212 | 173 |
| 170 | 3300026078 | Ga0207702_10994629 | Ga0207702_109946291 | 173 |
| 171 | 3300027907 | Ga0207428_10905526 | Ga0207428_109055261 | 173 |
| 172 | 3300031548 | Ga0307408_100428254 | Ga0307408_1004282542 | 173 |
| 173 | 3300031995 | Ga0307409_101126912 | Ga0307409_1011269122 | 173 |
| 174 | 3300032126 | Ga0307415_100226484 | Ga0307415_1002264843 | 173 |
| 175 | 3300032126 | Ga0307415_100776455 | Ga0307415_1007764552 | 173 |
| 176 | 3300037418 | Ga0395900_0841562 | Ga0395900_0841562_18_557 | 173 |
| 177 | 3300037466 | Ga0395898_0018907 | Ga0395898_0018907_5465_5998 | 173 |
| 178 | 3300037466 | Ga0395898_0502199 | Ga0395898_0502199_382_921 | 173 |
| 179 | 3300037466 | Ga0395898_0599200 | Ga0395898_0599200_292_840 | 173 |
| 180 | 3300037471 | Ga0395905_0578817 | Ga0395905_0578817_227_760 | 173 |
| 181 | 3300038443 | Ga0395901_0034145 | Ga0395901_0034145_3595_4128 | 173 |
| 182 | 3300038443 | Ga0395901_0269205 | Ga0395901_0269205_291_830 | 173 |
| 183 | 3300038443 | Ga0395901_0346615 | Ga0395901_0346615_162_695 | 173 |
| 184 | 3300038443 | Ga0395901_0416957 | Ga0395901_0416957_311_847 | 173 |
| 185 | 3300038443 | Ga0395901_0417481 | Ga0395901_0417481_667_1206 | 173 |
| 186 | 3300041503 | Ga0451847_0957932 | Ga0451847_0957932_12_545 | 173 |
| 187 | 3300041509 | Ga0451843_1640951 | Ga0451843_1640951_319_852 | 173 |
| 188 | 3300042461 | Ga0439460_0078707 | Ga0439460_0078707_143_670 | 173 |
| 189 | 3300045051 | Ga0451576_0062862 | Ga0451576_0062862_1012_1545 | 173 |
| 190 | 3300046453 | Ga0495627_176234 | Ga0495627_176234_18_551 | 173 |
| 191 | 3300046461 | Ga0495641_0228767 | Ga0495641_0228767_104_637 | 173 |
| 192 | 3300046492 | Ga0495585_0155960 | Ga0495585_0155960_202_735 | 173 |
| 193 | 3300046499 | Ga0495594_0270128 | Ga0495594_0270128_301_834 | 173 |
| 194 | 3300046500 | Ga0495596_0153004 | Ga0495596_0153004_311_841 | 173 |
| 195 | 3300046501 | Ga0495607_0146158 | Ga0495607_0146158_86_619 | 173 |
| 196 | 3300046528 | Ga0495642_0237858 | Ga0495642_0237858_139_672 | 173 |
| 197 | 3300048907 | Ga0496104_0082424 | Ga0496104_0082424_939_1514 | 173 |
| 198 | 3300048911 | Ga0496108_0559729 | Ga0496108_0559729_273_806 | 173 |
| 199 | 3300048913 | Ga0496110_0201306 | Ga0496110_0201306_519_1094 | 173 |
| 200 | 3300048914 | Ga0496111_0161028 | Ga0496111_0161028_422_997 | 173 |
| 201 | 3300049576 | Ga0501040_0088997 | Ga0501040_0088997_1255_1806 | 173 |
| 202 | 3300049577 | Ga0501041_0715275 | Ga0501041_0715275_88_630 | 173 |
| 203 | 3300049591 | Ga0501075_0136224 | Ga0501075_0136224_1146_1697 | 173 |
| 204 | 3300049591 | Ga0501075_0944545 | Ga0501075_0944545_38_565 | 173 |
| 205 | 3300049741 | Ga0501079_0305742 | Ga0501079_0305742_290_841 | 173 |
| 206 | 3300049743 | Ga0501081_0140264 | Ga0501081_0140264_730_1257 | 173 |
| 207 | 3300049744 | Ga0501083_0607682 | Ga0501083_0607682_27_554 | 173 |
| 208 | 3300049824 | Ga0501045_0142244 | Ga0501045_0142244_174_725 | 173 |
| 209 | 3300049824 | Ga0501045_0299010 | Ga0501045_0299010_621_1148 | 173 |
| 210 | 3300050507 | nmdc:mga05p37_105493_c1 | nmdc:mga05p37_105493_c1_530_1072 | 173 |
| 211 | 3300050512 | nmdc:mga0n895_1015942_c1 | nmdc:mga0n895_1015942_c1_104_646 | 173 |
| 212 | 3300005549 | Ga0070704_100569729 | Ga0070704_1005697292 | 174 |
| 213 | 3300025906 | Ga0207699_11041069 | Ga0207699_110410691 | 174 |
| 214 | 3300037312 | Ga0395899_0001247 | Ga0395899_0001247_5071_5607 | 174 |
| 215 | 3300037418 | Ga0395900_0000929 | Ga0395900_0000929_18432_18968 | 174 |
| 216 | 3300037466 | Ga0395898_0003495 | Ga0395898_0003495_565_1101 | 174 |
| 217 | 3300037471 | Ga0395905_0027711 | Ga0395905_0027711_4078_4614 | 174 |
| 218 | 3300038443 | Ga0395901_0009363 | Ga0395901_0009363_6194_6730 | 174 |
| 219 | 3300044706 | Ga0466964_0284676 | Ga0466964_0284676_146_676 | 174 |
| 220 | 3300046500 | Ga0495596_0117323 | Ga0495596_0117323_318_851 | 174 |
| 221 | 3300025922 | Ga0207646_10972119 | Ga0207646_109721192 | 175 |
| 222 | 3300037418 | Ga0395900_0467714 | Ga0395900_0467714_445_975 | 175 |
| 223 | 3300037466 | Ga0395898_0031535 | Ga0395898_0031535_1766_2296 | 175 |
| 224 | 3300037466 | Ga0395898_0318588 | Ga0395898_0318588_390_923 | 175 |
| 225 | 3300037471 | Ga0395905_0503503 | Ga0395905_0503503_53_586 | 175 |
| 226 | 3300038443 | Ga0395901_0121071 | Ga0395901_0121071_201_731 | 175 |
| 227 | 3300038443 | Ga0395901_0256914 | Ga0395901_0256914_218_751 | 175 |
| 228 | 3300042011 | Ga0439454_016454 | Ga0439454_016454_250_783 | 175 |
| 229 | 3300042013 | Ga0439456_009130 | Ga0439456_009130_562_1095 | 175 |
| 230 | 3300007076 | Ga0075435_100714000 | Ga0075435_1007140002 | 176 |
| 231 | 3300037418 | Ga0395900_0182550 | Ga0395900_0182550_959_1498 | 176 |
| 232 | 3300037466 | Ga0395898_0017551 | Ga0395898_0017551_5520_6059 | 176 |
| 233 | 3300037471 | Ga0395905_0486647 | Ga0395905_0486647_329_868 | 176 |
| 234 | 3300038443 | Ga0395901_0438974 | Ga0395901_0438974_488_1027 | 176 |
| 235 | 3300050512 | nmdc:mga0n895_365647_c1 | nmdc:mga0n895_365647_c1_143_682 | 176 |
| 236 | 3300050513 | nmdc:mga0rr50_175252_c1 | nmdc:mga0rr50_175252_c1_121_660 | 176 |
| 237 | 3300005471 | Ga0070698_100230638 | Ga0070698_1002306382 | 177 |
| 238 | 3300005518 | Ga0070699_100891540 | Ga0070699_1008915401 | 177 |
| 239 | 3300025929 | Ga0207664_10659635 | Ga0207664_106596352 | 177 |
| 240 | 3300028800 | Ga0265338_10176004 | Ga0265338_101760043 | 177 |
| 241 | 3300035120 | Ga0373957_0021029 | Ga0373957_0021029_390_947 | 177 |
| 242 | 3300035172 | Ga0373955_0103417 | Ga0373955_0103417_198_755 | 177 |
| 243 | 3300035410 | Ga0373924_0230323 | Ga0373924_0230323_148_690 | 177 |
| 244 | 3300035724 | Ga0373933_0056345 | Ga0373933_0056345_1662_2219 | 177 |
| 245 | 3300036401 | Ga0373937_0389745 | Ga0373937_0389745_618_1175 | 177 |
| 246 | 3300037418 | Ga0395900_0107562 | Ga0395900_0107562_988_1533 | 177 |
| 247 | 3300037466 | Ga0395898_0712537 | Ga0395898_0712537_236_790 | 177 |
| 248 | 3300038443 | Ga0395901_0105320 | Ga0395901_0105320_1718_2263 | 177 |
| 249 | 3300038443 | Ga0395901_0673512 | Ga0395901_0673512_333_887 | 177 |
| 250 | 3300041411 | Ga0439466_0052194 | Ga0439466_0052194_764_1309 | 177 |
| 251 | 3300046461 | Ga0495641_0036815 | Ga0495641_0036815_889_1443 | 177 |
| 252 | 3300046462 | Ga0495651_0212426 | Ga0495651_0212426_740_1297 | 177 |
| 253 | 3300046463 | Ga0495653_0394720 | Ga0495653_0394720_85_642 | 177 |
| 254 | 3300046475 | Ga0495639_0275647 | Ga0495639_0275647_14_547 | 177 |
| 255 | 3300046511 | Ga0495608_0179834 | Ga0495608_0179834_536_1093 | 177 |
| 256 | 3300046514 | Ga0495618_0200261 | Ga0495618_0200261_185_742 | 177 |
| 257 | 3300046536 | Ga0495587_0094499 | Ga0495587_0094499_132_689 | 177 |
| 258 | 3300046559 | Ga0495667_0045869 | Ga0495667_0045869_1047_1604 | 177 |
| 259 | 3300046675 | Ga0495657_0022704 | Ga0495657_0022704_1920_2477 | 177 |
| 260 | 3300046678 | Ga0495599_0205320 | Ga0495599_0205320_260_820 | 177 |
| 261 | 3300046680 | Ga0495646_0084834 | Ga0495646_0084834_1252_1806 | 177 |
| 262 | 3300046689 | Ga0495613_0117890 | Ga0495613_0117890_468_1025 | 177 |
| 263 | 3300047317 | Ga0495604_0229981 | Ga0495604_0229981_185_742 | 177 |
| 264 | 3300047317 | Ga0495604_0519229 | Ga0495604_0519229_12_575 | 177 |
| 265 | 3300047322 | Ga0495680_0124481 | Ga0495680_0124481_1152_1709 | 177 |
| 266 | 3300047471 | Ga0495684_0085002 | Ga0495684_0085002_44_601 | 177 |
| 267 | 3300048905 | Ga0496102_0331755 | Ga0496102_0331755_216_773 | 177 |
| 268 | 3300049576 | Ga0501040_0426173 | Ga0501040_0426173_64_621 | 177 |
| 269 | 3300049581 | Ga0501047_0536099 | Ga0501047_0536099_143_679 | 177 |
| 270 | 3300049583 | Ga0501067_0001839 | Ga0501067_0001839_7280_7837 | 177 |
| 271 | 3300049583 | Ga0501067_0042956 | Ga0501067_0042956_1750_2313 | 177 |
| 272 | 3300049584 | Ga0501068_0035879 | Ga0501068_0035879_388_945 | 177 |
| 273 | 3300049585 | Ga0501069_0005259 | Ga0501069_0005259_3301_3858 | 177 |
| 274 | 3300049590 | Ga0501074_0187294 | Ga0501074_0187294_275_820 | 177 |
| 275 | 3300049743 | Ga0501081_0626381 | Ga0501081_0626381_76_630 | 177 |
| 276 | 3300053084 | Ga0495595_0243151 | Ga0495595_0243151_255_812 | 177 |
| 277 | 3300053085 | Ga0495619_0133910 | Ga0495619_0133910_61_618 | 177 |
| 278 | 3300061734 | Ga0530510_0247340 | Ga0530510_0247340_185_742 | 177 |
| 279 | 3300061734 | Ga0530510_0295871 | Ga0530510_0295871_24_587 | 177 |
| 280 | 3300005327 | Ga0070658_10153748 | Ga0070658_101537483 | 178 |
| 281 | 3300005336 | Ga0070680_100512746 | Ga0070680_1005127462 | 178 |
| 282 | 3300005337 | Ga0070682_100709408 | Ga0070682_1007094081 | 178 |
| 283 | 3300005338 | Ga0068868_100398327 | Ga0068868_1003983272 | 178 |
| 284 | 3300005339 | Ga0070660_100138568 | Ga0070660_1001385683 | 178 |
| 285 | 3300005344 | Ga0070661_100307403 | Ga0070661_1003074033 | 178 |
| 286 | 3300005434 | Ga0070709_10516438 | Ga0070709_105164382 | 178 |
| 287 | 3300005435 | Ga0070714_100056410 | Ga0070714_1000564102 | 178 |
| 288 | 3300005435 | Ga0070714_100457697 | Ga0070714_1004576973 | 178 |
| 289 | 3300005435 | Ga0070714_100686230 | Ga0070714_1006862302 | 178 |
| 290 | 3300005437 | Ga0070710_10705229 | Ga0070710_107052291 | 178 |
| 291 | 3300005440 | Ga0070705_100003265 | Ga0070705_1000032655 | 178 |
| 292 | 3300005445 | Ga0070708_100036016 | Ga0070708_1000360163 | 178 |
| 293 | 3300005458 | Ga0070681_10033167 | Ga0070681_100331672 | 178 |
| 294 | 3300005467 | Ga0070706_100104183 | Ga0070706_1001041833 | 178 |
| 295 | 3300005471 | Ga0070698_100005957 | Ga0070698_1000059577 | 178 |
| 296 | 3300005518 | Ga0070699_100049107 | Ga0070699_1000491072 | 178 |
| 297 | 3300005530 | Ga0070679_100058632 | Ga0070679_1000586322 | 178 |
| 298 | 3300005530 | Ga0070679_100123667 | Ga0070679_1001236672 | 178 |
| 299 | 3300005614 | Ga0068856_100722282 | Ga0068856_1007222822 | 178 |
| 300 | 3300005616 | Ga0068852_101529243 | Ga0068852_1015292432 | 178 |
| 301 | 3300005841 | Ga0068863_100788009 | Ga0068863_1007880092 | 178 |
| 302 | 3300005937 | Ga0081455_10018484 | Ga0081455_100184847 | 178 |
| 303 | 3300006358 | Ga0068871_100448781 | Ga0068871_1004487812 | 178 |
| 304 | 3300006871 | Ga0075434_100026435 | Ga0075434_1000264353 | 178 |
| 305 | 3300006871 | Ga0075434_100205336 | Ga0075434_1002053362 | 178 |
| 306 | 3300007076 | Ga0075435_100046493 | Ga0075435_1000464933 | 178 |
| 307 | 3300009177 | Ga0105248_12108253 | Ga0105248_121082531 | 178 |
| 308 | 3300013105 | Ga0157369_10060850 | Ga0157369_100608503 | 178 |
| 309 | 3300013296 | Ga0157374_10252717 | Ga0157374_102527172 | 178 |
| 310 | 3300013307 | Ga0157372_10184457 | Ga0157372_101844573 | 178 |
| 311 | 3300014968 | Ga0157379_10362449 | Ga0157379_103624493 | 178 |
| 312 | 3300014969 | Ga0157376_10043222 | Ga0157376_100432223 | 178 |
| 313 | 3300020069 | Ga0197907_10087614 | Ga0197907_100876142 | 178 |
| 314 | 3300025909 | Ga0207705_10602159 | Ga0207705_106021592 | 178 |
| 315 | 3300025910 | Ga0207684_10031251 | Ga0207684_100312513 | 178 |
| 316 | 3300025910 | Ga0207684_10328060 | Ga0207684_103280603 | 178 |
| 317 | 3300025910 | Ga0207684_10375045 | Ga0207684_103750452 | 178 |
| 318 | 3300025912 | Ga0207707_10040613 | Ga0207707_100406134 | 178 |
| 319 | 3300025917 | Ga0207660_10837354 | Ga0207660_108373542 | 178 |
| 320 | 3300025919 | Ga0207657_10019186 | Ga0207657_100191862 | 178 |
| 321 | 3300025920 | Ga0207649_10079939 | Ga0207649_100799392 | 178 |
| 322 | 3300025921 | Ga0207652_10067742 | Ga0207652_100677422 | 178 |
| 323 | 3300025921 | Ga0207652_10267892 | Ga0207652_102678923 | 178 |
| 324 | 3300025927 | Ga0207687_10061765 | Ga0207687_100617652 | 178 |
| 325 | 3300025929 | Ga0207664_10111618 | Ga0207664_101116183 | 178 |
| 326 | 3300025932 | Ga0207690_10035842 | Ga0207690_100358424 | 178 |
| 327 | 3300026078 | Ga0207702_10366288 | Ga0207702_103662883 | 178 |
| 328 | 3300026078 | Ga0207702_10781942 | Ga0207702_107819421 | 178 |
| 329 | 3300026088 | Ga0207641_10736814 | Ga0207641_107368142 | 178 |
| 330 | 3300028381 | Ga0268264_10310941 | Ga0268264_103109413 | 178 |
| 331 | 3300028800 | Ga0265338_10002048 | Ga0265338_100020485 | 178 |
| 332 | 3300028800 | Ga0265338_10037077 | Ga0265338_100370773 | 178 |
| 333 | 3300031235 | Ga0265330_10083666 | Ga0265330_100836662 | 178 |
| 334 | 3300031241 | Ga0265325_10011700 | Ga0265325_100117005 | 178 |
| 335 | 3300031251 | Ga0265327_10019983 | Ga0265327_100199834 | 178 |
| 336 | 3300031251 | Ga0265327_10091882 | Ga0265327_100918823 | 178 |
| 337 | 3300031344 | Ga0265316_10035575 | Ga0265316_100355754 | 178 |
| 338 | 3300031595 | Ga0265313_10039754 | Ga0265313_100397542 | 178 |
| 339 | 3300031711 | Ga0265314_10032932 | Ga0265314_100329323 | 178 |
| 340 | 3300038443 | Ga0395901_1170640 | Ga0395901_1170640_24_587 | 178 |
| 341 | 3300044693 | Ga0466961_0014162 | Ga0466961_0014162_1198_1749 | 178 |
| 342 | 3300044694 | Ga0466963_0045512 | Ga0466963_0045512_2075_2647 | 178 |
| 343 | 3300044719 | Ga0466971_0032999 | Ga0466971_0032999_1727_2293 | 178 |
| 344 | 3300044735 | Ga0466968_0036149 | Ga0466968_0036149_383_934 | 178 |
| 345 | 3300044842 | Ga0466957_0136273 | Ga0466957_0136273_319_891 | 178 |
| 346 | 3300045051 | Ga0451576_0067477 | Ga0451576_0067477_1113_1673 | 178 |
| 347 | 3300045976 | Ga0466967_1297551 | Ga0466967_1297551_27_599 | 178 |
| 348 | 3300046455 | Ga0495603_0077703 | Ga0495603_0077703_536_1102 | 178 |
| 349 | 3300046463 | Ga0495653_0224620 | Ga0495653_0224620_338_886 | 178 |
| 350 | 3300046473 | Ga0495582_0382362 | Ga0495582_0382362_104_670 | 178 |
| 351 | 3300046492 | Ga0495585_0035552 | Ga0495585_0035552_1635_2183 | 178 |
| 352 | 3300046499 | Ga0495594_0297220 | Ga0495594_0297220_124_690 | 178 |
| 353 | 3300046500 | Ga0495596_0245209 | Ga0495596_0245209_42_590 | 178 |
| 354 | 3300046501 | Ga0495607_0047833 | Ga0495607_0047833_509_1057 | 178 |
| 355 | 3300046517 | Ga0495630_0413930 | Ga0495630_0413930_390_938 | 178 |
| 356 | 3300046523 | Ga0495644_0002130 | Ga0495644_0002130_6667_7215 | 178 |
| 357 | 3300046525 | Ga0495663_0039020 | Ga0495663_0039020_379_927 | 178 |
| 358 | 3300046528 | Ga0495642_0126155 | Ga0495642_0126155_259_807 | 178 |
| 359 | 3300046529 | Ga0495652_0131476 | Ga0495652_0131476_1282_1833 | 178 |
| 360 | 3300046535 | Ga0495586_0138047 | Ga0495586_0138047_141_707 | 178 |
| 361 | 3300046543 | Ga0495645_0110459 | Ga0495645_0110459_516_1067 | 178 |
| 362 | 3300046559 | Ga0495667_0071671 | Ga0495667_0071671_627_1175 | 178 |
| 363 | 3300046615 | Ga0495656_0010596 | Ga0495656_0010596_734_1282 | 178 |
| 364 | 3300046642 | Ga0495634_0013364 | Ga0495634_0013364_2451_3017 | 178 |
| 365 | 3300046648 | Ga0495611_0005390 | Ga0495611_0005390_4710_5258 | 178 |
| 366 | 3300046664 | Ga0495659_0147664 | Ga0495659_0147664_259_807 | 178 |
| 367 | 3300046665 | Ga0495661_0036475 | Ga0495661_0036475_2197_2745 | 178 |
| 368 | 3300046681 | Ga0495647_0183023 | Ga0495647_0183023_98_664 | 178 |
| 369 | 3300046683 | Ga0495658_0123416 | Ga0495658_0123416_185_733 | 178 |
| 370 | 3300046683 | Ga0495658_0160442 | Ga0495658_0160442_11_577 | 178 |
| 371 | 3300046689 | Ga0495613_0018523 | Ga0495613_0018523_981_1547 | 178 |
| 372 | 3300046691 | Ga0495670_0171972 | Ga0495670_0171972_549_1097 | 178 |
| 373 | 3300046809 | Ga0495600_0226585 | Ga0495600_0226585_141_689 | 178 |
| 374 | 3300047321 | Ga0495676_0015889 | Ga0495676_0015889_1215_1781 | 178 |
| 375 | 3300047322 | Ga0495680_0472068 | Ga0495680_0472068_26_574 | 178 |
| 376 | 3300047446 | Ga0495679_041023 | Ga0495679_041023_278_826 | 178 |
| 377 | 3300047471 | Ga0495684_0098060 | Ga0495684_0098060_623_1171 | 178 |
| 378 | 3300048089 | Ga0495614_0186915 | Ga0495614_0186915_32_598 | 178 |
| 379 | 3300048903 | Ga0496100_0108463 | Ga0496100_0108463_39_587 | 178 |
| 380 | 3300048904 | Ga0496101_0078019 | Ga0496101_0078019_336_884 | 178 |
| 381 | 3300048907 | Ga0496104_0011510 | Ga0496104_0011510_4341_4889 | 178 |
| 382 | 3300048907 | Ga0496104_0054094 | Ga0496104_0054094_2951_3499 | 178 |
| 383 | 3300048908 | Ga0496105_0006331 | Ga0496105_0006331_5902_6450 | 178 |
| 384 | 3300048908 | Ga0496105_0135698 | Ga0496105_0135698_202_750 | 178 |
| 385 | 3300048910 | Ga0496107_0054304 | Ga0496107_0054304_1270_1818 | 178 |
| 386 | 3300048911 | Ga0496108_0017772 | Ga0496108_0017772_1407_1955 | 178 |
| 387 | 3300048911 | Ga0496108_0074145 | Ga0496108_0074145_641_1192 | 178 |
| 388 | 3300048911 | Ga0496108_0498443 | Ga0496108_0498443_247_795 | 178 |
| 389 | 3300048912 | Ga0496109_0002480 | Ga0496109_0002480_10610_11158 | 178 |
| 390 | 3300048912 | Ga0496109_0259030 | Ga0496109_0259030_282_830 | 178 |
| 391 | 3300048912 | Ga0496109_0791076 | Ga0496109_0791076_151_702 | 178 |
| 392 | 3300048913 | Ga0496110_0272531 | Ga0496110_0272531_237_785 | 178 |
| 393 | 3300048913 | Ga0496110_0318439 | Ga0496110_0318439_657_1208 | 178 |
| 394 | 3300048914 | Ga0496111_0018470 | Ga0496111_0018470_529_1077 | 178 |
| 395 | 3300048915 | Ga0496112_0062637 | Ga0496112_0062637_299_850 | 178 |
| 396 | 3300048915 | Ga0496112_0797206 | Ga0496112_0797206_106_663 | 178 |
| 397 | 3300048916 | Ga0496113_0352820 | Ga0496113_0352820_248_796 | 178 |
| 398 | 3300048916 | Ga0496113_0364687 | Ga0496113_0364687_241_792 | 178 |
| 399 | 3300048916 | Ga0496113_0884574 | Ga0496113_0884574_50_607 | 178 |
| 400 | 3300048917 | Ga0496114_0084964 | Ga0496114_0084964_1747_2301 | 178 |
| 401 | 3300048917 | Ga0496114_0164022 | Ga0496114_0164022_969_1517 | 178 |
| 402 | 3300048917 | Ga0496114_0324283 | Ga0496114_0324283_45_593 | 178 |
| 403 | 3300048918 | Ga0496115_0031246 | Ga0496115_0031246_1553_2101 | 178 |
| 404 | 3300048918 | Ga0496115_0294146 | Ga0496115_0294146_322_870 | 178 |
| 405 | 3300049568 | Ga0501031_0109728 | Ga0501031_0109728_137_709 | 178 |
| 406 | 3300049587 | Ga0501071_0091668 | Ga0501071_0091668_633_1205 | 178 |
| 407 | 3300049824 | Ga0501045_0056450 | Ga0501045_0056450_113_685 | 178 |
| 408 | 3300050512 | nmdc:mga0n895_610042_c1 | nmdc:mga0n895_610042_c1_459_1025 | 178 |
| 409 | 3300050512 | nmdc:mga0n895_64234_c1 | nmdc:mga0n895_64234_c1_1835_2383 | 178 |
| 410 | 3300050513 | nmdc:mga0rr50_212011_c1 | nmdc:mga0rr50_212011_c1_683_1231 | 178 |
| 411 | 3300053083 | Ga0495655_0150883 | Ga0495655_0150883_113_661 | 178 |
| 412 | 3300053084 | Ga0495595_0111604 | Ga0495595_0111604_295_843 | 178 |
| 413 | 3300053085 | Ga0495619_0394848 | Ga0495619_0394848_170_721 | 178 |
| 414 | 3300061719 | Ga0466962_0065206 | Ga0466962_0065206_355_927 | 178 |
| 415 | 3300006847 | Ga0075431_100405111 | Ga0075431_1004051112 | 179 |
| 416 | 3300009147 | Ga0114129_10018938 | Ga0114129_1001893810 | 179 |
| 417 | 3300037466 | Ga0395898_0264603 | Ga0395898_0264603_716_1276 | 179 |
| 418 | 3300048915 | Ga0496112_0017461 | Ga0496112_0017461_515_1081 | 179 |
| 419 | 3300050510 | nmdc:mga06r32_323513_c1 | nmdc:mga06r32_323513_c1_650_1255 | 179 |
| 420 | 3300005937 | Ga0081455_10004771 | Ga0081455_1000477110 | 180 |
| 421 | 3300005983 | Ga0081540_1008816 | Ga0081540_10088167 | 180 |
| 422 | 3300006844 | Ga0075428_101248107 | Ga0075428_1012481072 | 180 |
| 423 | 3300006847 | Ga0075431_100491245 | Ga0075431_1004912453 | 180 |
| 424 | 3300006852 | Ga0075433_10076646 | Ga0075433_100766463 | 180 |
| 425 | 3300006880 | Ga0075429_100754254 | Ga0075429_1007542542 | 180 |
| 426 | 3300006914 | Ga0075436_100073703 | Ga0075436_1000737032 | 180 |
| 427 | 3300009147 | Ga0114129_11269764 | Ga0114129_112697642 | 180 |
| 428 | 3300025935 | Ga0207709_10479288 | Ga0207709_104792882 | 180 |
| 429 | 3300037471 | Ga0395905_0110005 | Ga0395905_0110005_1952_2509 | 180 |
| 430 | 3300038443 | Ga0395901_1001733 | Ga0395901_1001733_26_583 | 180 |
| 431 | 3300041511 | Ga0451855_0177353 | Ga0451855_0177353_258_821 | 180 |
| 432 | 3300049588 | Ga0501072_0182551 | Ga0501072_0182551_1068_1643 | 180 |
| 433 | 3300050507 | nmdc:mga05p37_136458_c1 | nmdc:mga05p37_136458_c1_1057_1614 | 180 |
| 434 | 3300050510 | nmdc:mga06r32_861657_c1 | nmdc:mga06r32_861657_c1_101_658 | 180 |
| 435 | 3300050512 | nmdc:mga0n895_49545_c1 | nmdc:mga0n895_49545_c1_1416_1973 | 180 |
| 436 | 3300044706 | Ga0466964_0005225 | Ga0466964_0005225_500_1060 | 181 |
| 437 | 3300025928 | Ga0207700_10688804 | Ga0207700_106888042 | 183 |
| 438 | 3300046477 | Ga0495664_0294987 | Ga0495664_0294987_161_736 | 183 |
| 439 | 3300046516 | Ga0495628_0439861 | Ga0495628_0439861_135_710 | 183 |
| 440 | 3300046543 | Ga0495645_0374668 | Ga0495645_0374668_65_640 | 183 |
| 441 | 3300053077 | Ga0495601_0089704 | Ga0495601_0089704_753_1328 | 183 |
| 442 | 3300005434 | Ga0070709_10017185 | Ga0070709_100171854 | 184 |
| 443 | 3300005435 | Ga0070714_100048810 | Ga0070714_1000488104 | 184 |
| 444 | 3300005435 | Ga0070714_100478709 | Ga0070714_1004787092 | 184 |
| 445 | 3300005436 | Ga0070713_100561668 | Ga0070713_1005616681 | 184 |
| 446 | 3300005440 | Ga0070705_100221036 | Ga0070705_1002210362 | 184 |
| 447 | 3300005545 | Ga0070695_100912868 | Ga0070695_1009128681 | 184 |
| 448 | 3300005549 | Ga0070704_100477060 | Ga0070704_1004770602 | 184 |
| 449 | 3300005614 | Ga0068856_101108919 | Ga0068856_1011089191 | 184 |
| 450 | 3300006028 | Ga0070717_10062703 | Ga0070717_100627033 | 184 |
| 451 | 3300006028 | Ga0070717_10128751 | Ga0070717_101287512 | 184 |
| 452 | 3300006163 | Ga0070715_10005193 | Ga0070715_100051933 | 184 |
| 453 | 3300009101 | Ga0105247_10216147 | Ga0105247_102161472 | 184 |
| 454 | 3300013296 | Ga0157374_10007471 | Ga0157374_100074714 | 184 |
| 455 | 3300025905 | Ga0207685_10001868 | Ga0207685_100018683 | 184 |
| 456 | 3300025906 | Ga0207699_10047193 | Ga0207699_100471934 | 184 |
| 457 | 3300025915 | Ga0207693_10067027 | Ga0207693_100670273 | 184 |
| 458 | 3300025916 | Ga0207663_10019197 | Ga0207663_100191973 | 184 |
| 459 | 3300025928 | Ga0207700_10017213 | Ga0207700_100172132 | 184 |
| 460 | 3300025928 | Ga0207700_10030611 | Ga0207700_100306112 | 184 |
| 461 | 3300025929 | Ga0207664_10023006 | Ga0207664_100230065 | 184 |
| 462 | 3300025929 | Ga0207664_10145755 | Ga0207664_101457553 | 184 |
| 463 | 3300025939 | Ga0207665_10000562 | Ga0207665_100005627 | 184 |
| 464 | 3300046455 | Ga0495603_0127388 | Ga0495603_0127388_432_1037 | 184 |
| 465 | 3300048903 | Ga0496100_0034400 | Ga0496100_0034400_698_1267 | 184 |
| 466 | 3300048904 | Ga0496101_0019494 | Ga0496101_0019494_2591_3160 | 184 |
| 467 | 3300048908 | Ga0496105_0014915 | Ga0496105_0014915_3814_4383 | 184 |
| 468 | 3300048909 | Ga0496106_0011574 | Ga0496106_0011574_3784_4353 | 184 |
| 469 | 3300048910 | Ga0496107_0001749 | Ga0496107_0001749_893_1462 | 184 |
| 470 | 3300048911 | Ga0496108_0015170 | Ga0496108_0015170_614_1183 | 184 |
| 471 | 3300048913 | Ga0496110_0076371 | Ga0496110_0076371_180_749 | 184 |
| 472 | 3300048917 | Ga0496114_0011850 | Ga0496114_0011850_4445_5014 | 184 |
| 473 | 3300048918 | Ga0496115_0034215 | Ga0496115_0034215_2749_3318 | 184 |
| 474 | 3300050513 | nmdc:mga0rr50_371358_c1 | nmdc:mga0rr50_371358_c1_34_603 | 184 |
| 475 | 3300001991 | JGI24743J22301_10093368 | JGI24743J22301_100933681 | 185 |
| 476 | 3300002077 | JGI24744J21845_10000511 | JGI24744J21845_100005116 | 185 |
| 477 | 3300005334 | Ga0068869_100598631 | Ga0068869_1005986312 | 185 |
| 478 | 3300005337 | Ga0070682_100085799 | Ga0070682_1000857993 | 185 |
| 479 | 3300005338 | Ga0068868_100177641 | Ga0068868_1001776412 | 185 |
| 480 | 3300005339 | Ga0070660_100031447 | Ga0070660_1000314472 | 185 |
| 481 | 3300005340 | Ga0070689_100016020 | Ga0070689_1000160201 | 185 |
| 482 | 3300005341 | Ga0070691_10406997 | Ga0070691_104069971 | 185 |
| 483 | 3300005345 | Ga0070692_10004479 | Ga0070692_100044795 | 185 |
| 484 | 3300005353 | Ga0070669_100148325 | Ga0070669_1001483253 | 185 |
| 485 | 3300005354 | Ga0070675_100259737 | Ga0070675_1002597373 | 185 |
| 486 | 3300005356 | Ga0070674_100042239 | Ga0070674_1000422394 | 185 |
| 487 | 3300005365 | Ga0070688_100157051 | Ga0070688_1001570512 | 185 |
| 488 | 3300005366 | Ga0070659_100103061 | Ga0070659_1001030613 | 185 |
| 489 | 3300005435 | Ga0070714_100287284 | Ga0070714_1002872842 | 185 |
| 490 | 3300005437 | Ga0070710_10004053 | Ga0070710_100040534 | 185 |
| 491 | 3300005438 | Ga0070701_10002145 | Ga0070701_100021456 | 185 |
| 492 | 3300005439 | Ga0070711_100002495 | Ga0070711_1000024958 | 185 |
| 493 | 3300005440 | Ga0070705_100226176 | Ga0070705_1002261761 | 185 |
| 494 | 3300005441 | Ga0070700_100003239 | Ga0070700_1000032394 | 185 |
| 495 | 3300005445 | Ga0070708_101085514 | Ga0070708_1010855141 | 185 |
| 496 | 3300005456 | Ga0070678_100003173 | Ga0070678_1000031734 | 185 |
| 497 | 3300005459 | Ga0068867_100000290 | Ga0068867_1000002905 | 185 |
| 498 | 3300005466 | Ga0070685_10004004 | Ga0070685_100040043 | 185 |
| 499 | 3300005468 | Ga0070707_100001362 | Ga0070707_10000136214 | 185 |
| 500 | 3300005471 | Ga0070698_100191412 | Ga0070698_1001914123 | 185 |
| 501 | 3300005518 | Ga0070699_100029009 | Ga0070699_1000290092 | 185 |
| 502 | 3300005539 | Ga0068853_100022345 | Ga0068853_1000223453 | 185 |
| 503 | 3300005543 | Ga0070672_100020180 | Ga0070672_1000201802 | 185 |
| 504 | 3300005544 | Ga0070686_100003179 | Ga0070686_1000031798 | 185 |
| 505 | 3300005546 | Ga0070696_100019107 | Ga0070696_1000191071 | 185 |
| 506 | 3300005547 | Ga0070693_100007413 | Ga0070693_1000074134 | 185 |
| 507 | 3300005548 | Ga0070665_100490541 | Ga0070665_1004905412 | 185 |
| 508 | 3300005549 | Ga0070704_100014360 | Ga0070704_1000143604 | 185 |
| 509 | 3300005578 | Ga0068854_100372974 | Ga0068854_1003729743 | 185 |
| 510 | 3300005614 | Ga0068856_100002162 | Ga0068856_10000216211 | 185 |
| 511 | 3300005615 | Ga0070702_100001183 | Ga0070702_1000011838 | 185 |
| 512 | 3300005718 | Ga0068866_10000154 | Ga0068866_100001544 | 185 |
| 513 | 3300006175 | Ga0070712_100017737 | Ga0070712_1000177374 | 185 |
| 514 | 3300006237 | Ga0097621_100071204 | Ga0097621_1000712042 | 185 |
| 515 | 3300006358 | Ga0068871_100028194 | Ga0068871_1000281943 | 185 |
| 516 | 3300006881 | Ga0068865_100004791 | Ga0068865_1000047916 | 185 |
| 517 | 3300009093 | Ga0105240_10171175 | Ga0105240_101711753 | 185 |
| 518 | 3300009098 | Ga0105245_10118169 | Ga0105245_101181693 | 185 |
| 519 | 3300009098 | Ga0105245_10454261 | Ga0105245_104542613 | 185 |
| 520 | 3300009101 | Ga0105247_10039396 | Ga0105247_100393963 | 185 |
| 521 | 3300009148 | Ga0105243_10010311 | Ga0105243_100103115 | 185 |
| 522 | 3300009174 | Ga0105241_10037245 | Ga0105241_100372452 | 185 |
| 523 | 3300009176 | Ga0105242_10012830 | Ga0105242_100128306 | 185 |
| 524 | 3300009177 | Ga0105248_10060688 | Ga0105248_100606884 | 185 |
| 525 | 3300009551 | Ga0105238_10527063 | Ga0105238_105270631 | 185 |
| 526 | 3300009553 | Ga0105249_10004222 | Ga0105249_100042229 | 185 |
| 527 | 3300010375 | Ga0105239_10001224 | Ga0105239_100012243 | 185 |
| 528 | 3300013296 | Ga0157374_10036408 | Ga0157374_100364084 | 185 |
| 529 | 3300013296 | Ga0157374_10638797 | Ga0157374_106387972 | 185 |
| 530 | 3300013297 | Ga0157378_10010246 | Ga0157378_100102466 | 185 |
| 531 | 3300013306 | Ga0163162_10073924 | Ga0163162_100739244 | 185 |
| 532 | 3300013308 | Ga0157375_10123928 | Ga0157375_101239282 | 185 |
| 533 | 3300013308 | Ga0157375_10210488 | Ga0157375_102104883 | 185 |
| 534 | 3300014325 | Ga0163163_10480721 | Ga0163163_104807213 | 185 |
| 535 | 3300014745 | Ga0157377_10001363 | Ga0157377_1000136310 | 185 |
| 536 | 3300014968 | Ga0157379_10851134 | Ga0157379_108511342 | 185 |
| 537 | 3300014969 | Ga0157376_10295804 | Ga0157376_102958043 | 185 |
| 538 | 3300014969 | Ga0157376_11971788 | Ga0157376_119717881 | 185 |
| 539 | 3300017792 | Ga0163161_10651930 | Ga0163161_106519302 | 185 |
| 540 | 3300025898 | Ga0207692_10030726 | Ga0207692_100307263 | 185 |
| 541 | 3300025899 | Ga0207642_10010716 | Ga0207642_100107163 | 185 |
| 542 | 3300025900 | Ga0207710_10067612 | Ga0207710_100676123 | 185 |
| 543 | 3300025901 | Ga0207688_10218706 | Ga0207688_102187062 | 185 |
| 544 | 3300025903 | Ga0207680_10303086 | Ga0207680_103030862 | 185 |
| 545 | 3300025910 | Ga0207684_10174070 | Ga0207684_101740702 | 185 |
| 546 | 3300025911 | Ga0207654_10196745 | Ga0207654_101967452 | 185 |
| 547 | 3300025915 | Ga0207693_10000499 | Ga0207693_1000049910 | 185 |
| 548 | 3300025916 | Ga0207663_10353975 | Ga0207663_103539752 | 185 |
| 549 | 3300025917 | Ga0207660_10282331 | Ga0207660_102823312 | 185 |
| 550 | 3300025918 | Ga0207662_10008232 | Ga0207662_100082324 | 185 |
| 551 | 3300025919 | Ga0207657_10003301 | Ga0207657_1000330116 | 185 |
| 552 | 3300025922 | Ga0207646_10001072 | Ga0207646_1000107214 | 185 |
| 553 | 3300025923 | Ga0207681_10051957 | Ga0207681_100519572 | 185 |
| 554 | 3300025924 | Ga0207694_10580544 | Ga0207694_105805442 | 185 |
| 555 | 3300025926 | Ga0207659_10094931 | Ga0207659_100949313 | 185 |
| 556 | 3300025927 | Ga0207687_10043392 | Ga0207687_100433923 | 185 |
| 557 | 3300025929 | Ga0207664_10240634 | Ga0207664_102406342 | 185 |
| 558 | 3300025932 | Ga0207690_10229136 | Ga0207690_102291363 | 185 |
| 559 | 3300025933 | Ga0207706_10243375 | Ga0207706_102433752 | 185 |
| 560 | 3300025934 | Ga0207686_10008930 | Ga0207686_100089305 | 185 |
| 561 | 3300025935 | Ga0207709_10002593 | Ga0207709_1000259311 | 185 |
| 562 | 3300025936 | Ga0207670_10053086 | Ga0207670_100530862 | 185 |
| 563 | 3300025937 | Ga0207669_10017923 | Ga0207669_100179233 | 185 |
| 564 | 3300025938 | Ga0207704_10002157 | Ga0207704_100021576 | 185 |
| 565 | 3300025939 | Ga0207665_10216066 | Ga0207665_102160662 | 185 |
| 566 | 3300025940 | Ga0207691_10023300 | Ga0207691_100233005 | 185 |
| 567 | 3300025941 | Ga0207711_10184345 | Ga0207711_101843452 | 185 |
| 568 | 3300025961 | Ga0207712_10004332 | Ga0207712_100043325 | 185 |
| 569 | 3300025986 | Ga0207658_10381825 | Ga0207658_103818253 | 185 |
| 570 | 3300026023 | Ga0207677_10019726 | Ga0207677_100197263 | 185 |
| 571 | 3300026041 | Ga0207639_10045621 | Ga0207639_100456213 | 185 |
| 572 | 3300026067 | Ga0207678_10297588 | Ga0207678_102975882 | 185 |
| 573 | 3300026075 | Ga0207708_10000434 | Ga0207708_1000043426 | 185 |
| 574 | 3300026078 | Ga0207702_10040757 | Ga0207702_100407573 | 185 |
| 575 | 3300026089 | Ga0207648_10002641 | Ga0207648_100026412 | 185 |
| 576 | 3300026121 | Ga0207683_10006588 | Ga0207683_100065887 | 185 |
| 577 | 3300026142 | Ga0207698_10022867 | Ga0207698_100228673 | 185 |
| 578 | 3300028379 | Ga0268266_10103613 | Ga0268266_101036132 | 185 |
| 579 | 3300028380 | Ga0268265_10069817 | Ga0268265_100698173 | 185 |
| 580 | 3300037312 | Ga0395899_0022282 | Ga0395899_0022282_806_1363 | 185 |
| 581 | 3300037312 | Ga0395899_0022398 | Ga0395899_0022398_705_1262 | 185 |
| 582 | 3300037418 | Ga0395900_0000528 | Ga0395900_0000528_9487_10044 | 185 |
| 583 | 3300037418 | Ga0395900_0012327 | Ga0395900_0012327_2214_2771 | 185 |
| 584 | 3300037418 | Ga0395900_0020618 | Ga0395900_0020618_662_1219 | 185 |
| 585 | 3300037418 | Ga0395900_0024631 | Ga0395900_0024631_3320_3883 | 185 |
| 586 | 3300037466 | Ga0395898_0002139 | Ga0395898_0002139_20258_20815 | 185 |
| 587 | 3300037466 | Ga0395898_0008588 | Ga0395898_0008588_9726_10283 | 185 |
| 588 | 3300037466 | Ga0395898_0009600 | Ga0395898_0009600_7265_7822 | 185 |
| 589 | 3300037466 | Ga0395898_0010892 | Ga0395898_0010892_7253_7816 | 185 |
| 590 | 3300037471 | Ga0395905_0000661 | Ga0395905_0000661_6993_7550 | 185 |
| 591 | 3300037471 | Ga0395905_0005716 | Ga0395905_0005716_5254_5811 | 185 |
| 592 | 3300037471 | Ga0395905_0023587 | Ga0395905_0023587_4423_4986 | 185 |
| 593 | 3300037471 | Ga0395905_0033887 | Ga0395905_0033887_846_1403 | 185 |
| 594 | 3300038443 | Ga0395901_0001602 | Ga0395901_0001602_19908_20465 | 185 |
| 595 | 3300038443 | Ga0395901_0001739 | Ga0395901_0001739_19851_20408 | 185 |
| 596 | 3300038443 | Ga0395901_0003765 | Ga0395901_0003765_9817_10374 | 185 |
| 597 | 3300038443 | Ga0395901_0538128 | Ga0395901_0538128_56_613 | 185 |
| 598 | 3300041512 | Ga0451853_2407108 | Ga0451853_2407108_102_659 | 185 |
| 599 | 3300044694 | Ga0466963_0055679 | Ga0466963_0055679_33_653 | 185 |
| 600 | 3300044719 | Ga0466971_0005123 | Ga0466971_0005123_5029_5649 | 185 |
| 601 | 3300044842 | Ga0466957_0398821 | Ga0466957_0398821_205_825 | 185 |
| 602 | 3300045836 | Ga0466958_0023339 | Ga0466958_0023339_119_739 | 185 |
| 603 | 3300045976 | Ga0466967_0149725 | Ga0466967_0149725_261_866 | 185 |
| 604 | 3300046473 | Ga0495582_0017452 | Ga0495582_0017452_1963_2520 | 185 |
| 605 | 3300046492 | Ga0495585_0177735 | Ga0495585_0177735_284_841 | 185 |
| 606 | 3300046500 | Ga0495596_0075480 | Ga0495596_0075480_342_899 | 185 |
| 607 | 3300046525 | Ga0495663_0134772 | Ga0495663_0134772_122_679 | 185 |
| 608 | 3300046528 | Ga0495642_0063768 | Ga0495642_0063768_608_1165 | 185 |
| 609 | 3300046539 | Ga0495621_0158474 | Ga0495621_0158474_113_670 | 185 |
| 610 | 3300046615 | Ga0495656_0067924 | Ga0495656_0067924_315_872 | 185 |
| 611 | 3300046648 | Ga0495611_0090748 | Ga0495611_0090748_781_1338 | 185 |
| 612 | 3300046674 | Ga0495588_0348885 | Ga0495588_0348885_147_704 | 185 |
| 613 | 3300046683 | Ga0495658_0269902 | Ga0495658_0269902_21_578 | 185 |
| 614 | 3300046691 | Ga0495670_0121638 | Ga0495670_0121638_467_1024 | 185 |
| 615 | 3300046794 | Ga0495589_0003474 | Ga0495589_0003474_3124_3681 | 185 |
| 616 | 3300047315 | Ga0495581_0006841 | Ga0495581_0006841_3131_3688 | 185 |
| 617 | 3300048089 | Ga0495614_0354557 | Ga0495614_0354557_28_585 | 185 |
| 618 | 3300048904 | Ga0496101_0004691 | Ga0496101_0004691_4814_5371 | 185 |
| 619 | 3300048905 | Ga0496102_0001550 | Ga0496102_0001550_16240_16797 | 185 |
| 620 | 3300048905 | Ga0496102_0370947 | Ga0496102_0370947_176_733 | 185 |
| 621 | 3300048906 | Ga0496103_0006198 | Ga0496103_0006198_2079_2636 | 185 |
| 622 | 3300048907 | Ga0496104_0073268 | Ga0496104_0073268_463_1020 | 185 |
| 623 | 3300048907 | Ga0496104_0260432 | Ga0496104_0260432_495_1052 | 185 |
| 624 | 3300048908 | Ga0496105_0262801 | Ga0496105_0262801_361_918 | 185 |
| 625 | 3300048909 | Ga0496106_0019910 | Ga0496106_0019910_481_1038 | 185 |
| 626 | 3300048910 | Ga0496107_0006312 | Ga0496107_0006312_5393_5950 | 185 |
| 627 | 3300048911 | Ga0496108_0083422 | Ga0496108_0083422_479_1036 | 185 |
| 628 | 3300048911 | Ga0496108_0156093 | Ga0496108_0156093_640_1197 | 185 |
| 629 | 3300048912 | Ga0496109_0044381 | Ga0496109_0044381_568_1125 | 185 |
| 630 | 3300048912 | Ga0496109_0263528 | Ga0496109_0263528_323_880 | 185 |
| 631 | 3300048913 | Ga0496110_0014207 | Ga0496110_0014207_403_960 | 185 |
| 632 | 3300048914 | Ga0496111_0001848 | Ga0496111_0001848_6734_7291 | 185 |
| 633 | 3300048915 | Ga0496112_0056358 | Ga0496112_0056358_390_947 | 185 |
| 634 | 3300048916 | Ga0496113_0231003 | Ga0496113_0231003_203_760 | 185 |
| 635 | 3300048917 | Ga0496114_0007714 | Ga0496114_0007714_6784_7341 | 185 |
| 636 | 3300048918 | Ga0496115_0001849 | Ga0496115_0001849_2373_2930 | 185 |
| 637 | 3300061719 | Ga0466962_0004154 | Ga0466962_0004154_1252_1872 | 185 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6k6k-assembly1.cif.gz_A | the crystal structure of light-driven cyanobacterial chloride importer (n63a/p118a) mastigocladopsis repens | 0.9118 | 11 | 57 |
| 6xl3-assembly1.cif.gz_A | mastigocladopsis repens rhodopsin chloride pump | 0.9044 | 11 | 57 |
| 7zoy-assembly1.cif.gz_A | crystal structure of synechocystis halorhodopsin (syhr), so4-bound form, ground state | 0.8983 | 11 | 57 |
| 6zkg-assembly1.cif.gz_K | complex i with nadh, closed | 0.8965 | 14 | 84 |
| 7wg5-assembly1.cif.gz_E | cyclic electron transport supercomplex ndh-psi from arabidopsis | 0.8923 | 10 | 83 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1mftB00 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Immunoglobulin FC, subunit C | 0.9415 | 11 | 57 | 1.20.5.420 |
| af_P81309_1_82_1.10.287.3510 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.903 | 16 | 83 | 1.10.287.3510 |
| af_Q57879_1_79_1.10.287.3510 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8897 | 15 | 85 | 1.10.287.3510 |
| 6humE00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8663 | 11 | 83 | 1.10.287.3510 |
| af_P18934_2_96_1.10.287.3510 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8602 | 11 | 83 | 1.10.287.3510 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R5QBW9-F1-model_v4 | Uncharacterized protein | 0.889 | 11 | 83 |
GO:0016020
|
| AF-A0A2K2VGL9-F1-model_v4 | NADH-quinone oxidoreductase subunit J | 0.7644 | 6 | 93 |
GO:0008137
GO:0016020 |
| AF-A0A2N2LBR2-F1-model_v4 | Hydrogenase | 0.7603 | 15 | 91 |
GO:0005886
|
| AF-T2IZZ7-F1-model_v4 | NADH-quinone oxidoreductase subunit J (EC 7.1.1.-) | 0.7278 | 7 | 103 |
GO:0005886
GO:0008137 GO:0048038 GO:1902495 |
| AF-A0A257WMP9-F1-model_v4 | NADH-quinone oxidoreductase subunit J (EC 7.1.1.-) | 0.723 | 11 | 117 |
GO:0005886
GO:0008137 GO:0048038 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar