F471454

General Info

Members Datasets Scaffolds Average Seq Length
637 301 637 182

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0055679|Ga0466963_0055679_33_653
Length 206
Sequence VSSLVVASSAGNVLVWIVWVVAGFSCLAAGVAVISFSNPFYSALALIGNLASLAVMYLLLSAEFVAAAQVLVYAGAVVVMFLFVIAYVGPRHETPWSGGPGWQTVCAVAAAGALLVEIVVAIGLQAGGSLSHTAKVGADFGTPAWIGRIFLVDHLLAFEVTSIVLLVAAVGGVILGAHTRRAEPPVLPDEQEPEAEPEREVAGWAR

Samples

Sample ID Description Type Environment
1 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
152 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
153 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
154 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
155 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
158 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
163 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
164 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
165 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
166 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
167 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
176 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
177 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
178 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
179 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
180 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
181 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
182 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
183 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
184 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
185 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
186 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
187 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
188 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
189 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
190 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
191 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
192 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
193 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
194 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
195 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
198 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
199 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
200 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
201 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
202 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
203 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
204 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
205 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
206 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
207 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
208 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
209 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
210 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
211 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
212 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
213 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
214 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
215 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
216 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
217 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
218 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
219 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
220 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
221 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
222 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
223 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
224 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
225 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
226 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
227 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
228 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
229 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
230 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
231 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
232 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
233 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
234 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
235 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
236 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
237 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
238 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
239 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
240 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
241 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
242 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
243 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
244 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
245 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
246 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
247 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
248 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
249 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
250 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
251 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
252 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
253 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
254 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
255 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
256 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
257 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
258 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
259 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
260 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
261 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
262 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
263 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
264 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
265 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
273 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
274 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
275 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
276 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
277 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
278 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
279 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
280 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
281 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
282 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
283 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
285 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
286 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
287 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
288 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
289 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
290 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
291 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
292 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
293 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
294 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
295 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
296 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
297 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
298 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
299 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
300 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
301 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.84
Metatranscriptomes 0.16
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.47
Nodule 0
Rhizoplane 11.15
Rhizosphere 87.6
Stem 0
Stem Tuber 0
Unclassified 0.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10093368 3300001991 Bacteria 643
2 JGI24744J21845_10000511 3300002077 Bacteria 6919
3 Ga0070658_10153748 3300005327 Bacteria 1927
4 Ga0070658_11046640 3300005327 Bacteria 710
5 Ga0070676_10969579 3300005328 Bacteria 637
6 Ga0070683_100487069 3300005329 Bacteria 1178
7 Ga0068869_100598631 3300005334 Bacteria 931
8 Ga0070680_100512746 3300005336 Bacteria 1026
9 Ga0070682_100085799 3300005337 Bacteria 2049
10 Ga0070682_100709408 3300005337 Unclassified 807
11 Ga0068868_100177641 3300005338 Bacteria 1765
12 Ga0068868_100398327 3300005338 Bacteria 1187
13 Ga0070660_100031447 3300005339 Bacteria 3986
14 Ga0070660_100138568 3300005339 Bacteria 1950
15 Ga0070689_100016020 3300005340 Bacteria 5481
16 Ga0070691_10406997 3300005341 Bacteria 768
17 Ga0070661_100307403 3300005344 Bacteria 1235
18 Ga0070692_10004479 3300005345 Bacteria 5845
19 Ga0070669_100148325 3300005353 Bacteria 1814
20 Ga0070675_100259737 3300005354 Bacteria 1522
21 Ga0070671_100177071 3300005355 Bacteria 1805
22 Ga0070674_100042239 3300005356 Bacteria 3096
23 Ga0070688_100157051 3300005365 Bacteria 1560
24 Ga0070659_100103061 3300005366 Bacteria 2298
25 Ga0070709_10017185 3300005434 Bacteria 4143
26 Ga0070709_10083598 3300005434 Bacteria 2088
27 Ga0070709_10516438 3300005434 Bacteria 909
28 Ga0070714_100048810 3300005435 Bacteria 3601
29 Ga0070714_100056410 3300005435 Bacteria 3360
30 Ga0070714_100284742 3300005435 Bacteria 1536
31 Ga0070714_100287284 3300005435 Bacteria 1530
32 Ga0070714_100412481 3300005435 Bacteria 1278
33 Ga0070714_100457697 3300005435 Unclassified 1213
34 Ga0070714_100478709 3300005435 Bacteria 1185
35 Ga0070714_100499909 3300005435 Bacteria 1159
36 Ga0070714_100686230 3300005435 Bacteria 987
37 Ga0070713_100194877 3300005436 Bacteria 1827
38 Ga0070713_100561668 3300005436 Bacteria 1081
39 Ga0070710_10004053 3300005437 Bacteria 6956
40 Ga0070710_10281210 3300005437 Bacteria 1080
41 Ga0070710_10705229 3300005437 Bacteria 713
42 Ga0070701_10002145 3300005438 Bacteria 7512
43 Ga0070711_100002495 3300005439 Bacteria 10504
44 Ga0070711_101033929 3300005439 Bacteria 706
45 Ga0070705_100003265 3300005440 Bacteria 7976
46 Ga0070705_100221036 3300005440 Bacteria 1312
47 Ga0070705_100226176 3300005440 Bacteria 1298
48 Ga0070700_100003239 3300005441 Bacteria 8374
49 Ga0070708_100036016 3300005445 Bacteria 4314
50 Ga0070708_101085514 3300005445 Bacteria 750
51 Ga0070663_100858871 3300005455 Bacteria 781
52 Ga0070678_100003173 3300005456 Bacteria 9108
53 Ga0070678_100641501 3300005456 Bacteria 952
54 Ga0070681_10033167 3300005458 Bacteria 5183
55 Ga0068867_100000290 3300005459 Bacteria 32965
56 Ga0068867_100325091 3300005459 Bacteria 1275
57 Ga0070685_10004004 3300005466 Bacteria 7442
58 Ga0070706_100104183 3300005467 Bacteria 2638
59 Ga0070707_100001362 3300005468 Bacteria 23998
60 Ga0070707_100763184 3300005468 Bacteria 930
61 Ga0070698_100005957 3300005471 Bacteria 13293
62 Ga0070698_100006514 3300005471 Bacteria 12660
63 Ga0070698_100146609 3300005471 Bacteria 2309
64 Ga0070698_100191412 3300005471 Bacteria 1983
65 Ga0070698_100230638 3300005471 Bacteria 1784
66 Ga0070699_100029009 3300005518 Bacteria 4770
67 Ga0070699_100049107 3300005518 Bacteria 3652
68 Ga0070699_100891540 3300005518 Bacteria 815
69 Ga0070679_100058632 3300005530 Bacteria 3836
70 Ga0070679_100123667 3300005530 Bacteria 2570
71 Ga0070684_100272137 3300005535 Bacteria 1551
72 Ga0070684_100563617 3300005535 Bacteria 1058
73 Ga0070697_100704590 3300005536 Bacteria 891
74 Ga0070697_100986152 3300005536 Unclassified 749
75 Ga0068853_100022345 3300005539 Bacteria 5282
76 Ga0068853_100291773 3300005539 Bacteria 1506
77 Ga0070672_100020180 3300005543 Bacteria 4856
78 Ga0070686_100003179 3300005544 Bacteria 8991
79 Ga0070695_100912868 3300005545 Unclassified 710
80 Ga0070696_100019107 3300005546 Bacteria 4639
81 Ga0070693_100007413 3300005547 Bacteria 5362
82 Ga0070665_100490541 3300005548 Bacteria 1239
83 Ga0070704_100014360 3300005549 Bacteria 4945
84 Ga0070704_100477060 3300005549 Bacteria 1079
85 Ga0070704_100569729 3300005549 Bacteria 992
86 Ga0068854_100372974 3300005578 Bacteria 1174
87 Ga0068856_100002162 3300005614 Bacteria 20361
88 Ga0068856_100722282 3300005614 Bacteria 1016
89 Ga0068856_101108919 3300005614 Unclassified 809
90 Ga0070702_100001183 3300005615 Bacteria 10515
91 Ga0068852_101529243 3300005616 Unclassified 690
92 Ga0068866_10000154 3300005718 Bacteria 31512
93 Ga0068863_100788009 3300005841 Bacteria 948
94 Ga0081455_10004771 3300005937 Bacteria 15060
95 Ga0081455_10018484 3300005937 Bacteria 6637
96 Ga0081455_10021779 3300005937 Bacteria 6004
97 Ga0081538_10009502 3300005981 Bacteria 8105
98 Ga0081538_10049856 3300005981 Bacteria 2535
99 Ga0081538_10066728 3300005981 Bacteria 2014
100 Ga0081540_1008816 3300005983 Bacteria 7005
101 Ga0081539_10001480 3300005985 Bacteria 39812
102 Ga0070717_10048830 3300006028 Bacteria 3472
103 Ga0070717_10062703 3300006028 Bacteria 3083
104 Ga0070717_10128751 3300006028 Bacteria 2175
105 Ga0070717_10776215 3300006028 Bacteria 871
106 Ga0075363_100151567 3300006048 Bacteria 1309
107 Ga0070715_10005193 3300006163 Bacteria 4327
108 Ga0070712_100017737 3300006175 Bacteria 4611
109 Ga0075367_10252709 3300006178 Bacteria 1106
110 Ga0097621_100071204 3300006237 Bacteria 2873
111 Ga0068871_100028194 3300006358 Bacteria 4400
112 Ga0068871_100309483 3300006358 Bacteria 1388
113 Ga0068871_100448781 3300006358 Bacteria 1156
114 Ga0075428_100766993 3300006844 Bacteria 1026
115 Ga0075428_101248107 3300006844 Bacteria 782
116 Ga0075431_100071651 3300006847 Bacteria 3576
117 Ga0075431_100405111 3300006847 Unclassified 1365
118 Ga0075431_100491245 3300006847 Bacteria 1219
119 Ga0075433_10000356 3300006852 Bacteria 28714
120 Ga0075433_10076646 3300006852 Bacteria 2944
121 Ga0075433_10256523 3300006852 Bacteria 1551
122 Ga0075434_100006317 3300006871 Bacteria 10861
123 Ga0075434_100026435 3300006871 Bacteria 5685
124 Ga0075434_100205336 3300006871 Bacteria 1990
125 Ga0075434_100613660 3300006871 Bacteria 1107
126 Ga0075429_100754254 3300006880 Bacteria 852
127 Ga0068865_100004791 3300006881 Bacteria 8181
128 Ga0075436_100018854 3300006914 Bacteria 4724
129 Ga0075436_100073703 3300006914 Bacteria 2363
130 Ga0075435_100021735 3300007076 Bacteria 4941
131 Ga0075435_100046493 3300007076 Bacteria 3482
132 Ga0075435_100714000 3300007076 Bacteria 871
133 Ga0105240_10171175 3300009093 Bacteria 2572
134 Ga0105240_10736098 3300009093 Bacteria 1073
135 Ga0111539_10543509 3300009094 Bacteria 1353
136 Ga0111539_11808581 3300009094 Unclassified 708
137 Ga0105245_10079275 3300009098 Bacteria 2998
138 Ga0105245_10118169 3300009098 Bacteria 2474
139 Ga0105245_10454261 3300009098 Bacteria 1290
140 Ga0105247_10039396 3300009101 Bacteria 2887
141 Ga0105247_10216147 3300009101 Bacteria 1295
142 Ga0114129_10005223 3300009147 Bacteria 18302
143 Ga0114129_10018938 3300009147 Bacteria 9808
144 Ga0114129_10096674 3300009147 Bacteria 4089
145 Ga0114129_10206421 3300009147 Bacteria 2658
146 Ga0114129_11269764 3300009147 Bacteria 914
147 Ga0105243_10010311 3300009148 Bacteria 7098
148 Ga0105243_10094679 3300009148 Bacteria 2467
149 Ga0105241_10037245 3300009174 Bacteria 3664
150 Ga0105242_10012830 3300009176 Bacteria 6456
151 Ga0105248_10060688 3300009177 Bacteria 4245
152 Ga0105248_12108253 3300009177 Bacteria 641
153 Ga0105238_10527063 3300009551 Bacteria 1184
154 Ga0105249_10004222 3300009553 Bacteria 12419
155 Ga0105249_10359169 3300009553 Bacteria 1478
156 Ga0105239_10001224 3300010375 Bacteria 34981
157 Ga0105239_10382220 3300010375 Bacteria 1592
158 Ga0157369_10060850 3300013105 Bacteria 4072
159 Ga0157374_10007471 3300013296 Bacteria 9318
160 Ga0157374_10036408 3300013296 Bacteria 4507
161 Ga0157374_10252717 3300013296 Bacteria 1735
162 Ga0157374_10638797 3300013296 Bacteria 1076
163 Ga0157378_10010246 3300013297 Bacteria 8184
164 Ga0163162_10073924 3300013306 Bacteria 3466
165 Ga0157372_10184457 3300013307 Bacteria 2416
166 Ga0157375_10123928 3300013308 Bacteria 2697
167 Ga0157375_10210488 3300013308 Bacteria 2102
168 Ga0157375_10452886 3300013308 Bacteria 1449
169 Ga0163163_10480721 3300014325 Bacteria 1303
170 Ga0163163_10969987 3300014325 Bacteria 913
171 Ga0157377_10001363 3300014745 Bacteria 10498
172 Ga0157379_10362449 3300014968 Bacteria 1328
173 Ga0157379_10851134 3300014968 Bacteria 863
174 Ga0157376_10043222 3300014969 Bacteria 3697
175 Ga0157376_10295804 3300014969 Bacteria 1530
176 Ga0157376_10357208 3300014969 Bacteria 1400
177 Ga0157376_11971788 3300014969 Bacteria 621
178 Ga0163161_10235473 3300017792 Bacteria 1422
179 Ga0163161_10651930 3300017792 Bacteria 872
180 Ga0197907_10087614 3300020069 Bacteria 708
181 Ga0207692_10030726 3300025898 Bacteria 2565
182 Ga0207642_10010716 3300025899 Bacteria 3244
183 Ga0207710_10067612 3300025900 Bacteria 1632
184 Ga0207688_10218706 3300025901 Bacteria 1147
185 Ga0207680_10303086 3300025903 Bacteria 1114
186 Ga0207685_10001868 3300025905 Bacteria 4625
187 Ga0207699_10047193 3300025906 Bacteria 2524
188 Ga0207699_11041069 3300025906 Bacteria 605
189 Ga0207705_10602159 3300025909 Bacteria 854
190 Ga0207684_10031251 3300025910 Bacteria 4530
191 Ga0207684_10174070 3300025910 Bacteria 1855
192 Ga0207684_10328060 3300025910 Bacteria 1319
193 Ga0207684_10375045 3300025910 Bacteria 1224
194 Ga0207684_10397006 3300025910 Bacteria 1186
195 Ga0207654_10196745 3300025911 Bacteria 1325
196 Ga0207707_10040613 3300025912 Bacteria 4063
197 Ga0207693_10000499 3300025915 Bacteria 35458
198 Ga0207693_10003417 3300025915 Bacteria 13556
199 Ga0207693_10067027 3300025915 Bacteria 2811
200 Ga0207663_10019197 3300025916 Bacteria 3845
201 Ga0207663_10353975 3300025916 Bacteria 1112
202 Ga0207660_10282331 3300025917 Bacteria 1318
203 Ga0207660_10837354 3300025917 Unclassified 751
204 Ga0207662_10008232 3300025918 Bacteria 5703
205 Ga0207657_10003301 3300025919 Bacteria 17246
206 Ga0207657_10019186 3300025919 Bacteria 6503
207 Ga0207649_10079939 3300025920 Bacteria 2113
208 Ga0207652_10067742 3300025921 Bacteria 3096
209 Ga0207652_10267892 3300025921 Bacteria 1541
210 Ga0207646_10001072 3300025922 Bacteria 34848
211 Ga0207646_10532390 3300025922 Bacteria 1057
212 Ga0207646_10972119 3300025922 Bacteria 751
213 Ga0207681_10051957 3300025923 Bacteria 2778
214 Ga0207694_10580544 3300025924 Bacteria 942
215 Ga0207659_10094931 3300025926 Bacteria 2236
216 Ga0207687_10043392 3300025927 Bacteria 3098
217 Ga0207687_10061765 3300025927 Bacteria 2647
218 Ga0207687_10913967 3300025927 Bacteria 751
219 Ga0207700_10000039 3300025928 Bacteria 102496
220 Ga0207700_10017213 3300025928 Bacteria 4823
221 Ga0207700_10030611 3300025928 Bacteria 3813
222 Ga0207700_10688804 3300025928 Bacteria 912
223 Ga0207664_10023006 3300025929 Bacteria 4663
224 Ga0207664_10031688 3300025929 Bacteria 4047
225 Ga0207664_10111618 3300025929 Bacteria 2275
226 Ga0207664_10113134 3300025929 Bacteria 2260
227 Ga0207664_10142046 3300025929 Bacteria 2032
228 Ga0207664_10145755 3300025929 Bacteria 2007
229 Ga0207664_10240634 3300025929 Bacteria 1576
230 Ga0207664_10551494 3300025929 Bacteria 1034
231 Ga0207664_10659635 3300025929 Bacteria 940
232 Ga0207644_10148432 3300025931 Bacteria 1812
233 Ga0207690_10035842 3300025932 Bacteria 3208
234 Ga0207690_10229136 3300025932 Bacteria 1425
235 Ga0207706_10243375 3300025933 Bacteria 1572
236 Ga0207686_10008930 3300025934 Bacteria 5423
237 Ga0207686_10247284 3300025934 Bacteria 1301
238 Ga0207709_10002593 3300025935 Bacteria 11265
239 Ga0207709_10479288 3300025935 Bacteria 967
240 Ga0207670_10053086 3300025936 Bacteria 2729
241 Ga0207669_10017923 3300025937 Bacteria 3646
242 Ga0207704_10002157 3300025938 Bacteria 8814
243 Ga0207665_10000562 3300025939 Bacteria 25011
244 Ga0207665_10200549 3300025939 Bacteria 1454
245 Ga0207665_10216066 3300025939 Bacteria 1403
246 Ga0207665_10230559 3300025939 Bacteria 1361
247 Ga0207691_10023300 3300025940 Bacteria 5829
248 Ga0207711_10184345 3300025941 Bacteria 1899
249 Ga0207661_10443721 3300025944 Bacteria 1181
250 Ga0207712_10004332 3300025961 Bacteria 8964
251 Ga0207658_10381825 3300025986 Bacteria 1234
252 Ga0207677_10019726 3300026023 Bacteria 4078
253 Ga0207639_10045621 3300026041 Bacteria 3302
254 Ga0207678_10297588 3300026067 Bacteria 1386
255 Ga0207678_10813117 3300026067 Bacteria 825
256 Ga0207708_10000434 3300026075 Bacteria 32516
257 Ga0207702_10040757 3300026078 Bacteria 3893
258 Ga0207702_10366288 3300026078 Bacteria 1382
259 Ga0207702_10781942 3300026078 Bacteria 943
260 Ga0207702_10994629 3300026078 Bacteria 832
261 Ga0207641_10736814 3300026088 Bacteria 972
262 Ga0207648_10002641 3300026089 Bacteria 19147
263 Ga0207683_10006588 3300026121 Bacteria 9935
264 Ga0207683_10305271 3300026121 Bacteria 1456
265 Ga0207698_10022867 3300026142 Bacteria 4357
266 Ga0207428_10905526 3300027907 Bacteria 623
267 Ga0268266_10103613 3300028379 Bacteria 2511
268 Ga0268265_10069817 3300028380 Bacteria 2730
269 Ga0268264_10310941 3300028381 Bacteria 1487
270 Ga0265338_10002048 3300028800 Bacteria 31167
271 Ga0265338_10037077 3300028800 Bacteria 4648
272 Ga0265338_10176004 3300028800 Bacteria 1635
273 Ga0265330_10083666 3300031235 Bacteria 1373
274 Ga0265325_10011700 3300031241 Bacteria 5036
275 Ga0265327_10019983 3300031251 Bacteria 4099
276 Ga0265327_10091882 3300031251 Bacteria 1478
277 Ga0265316_10035575 3300031344 Bacteria 4034
278 Ga0265316_10829776 3300031344 Bacteria 648
279 Ga0307408_100428254 3300031548 Bacteria 1143
280 Ga0265313_10039754 3300031595 Bacteria 2331
281 Ga0265314_10032932 3300031711 Bacteria 3806
282 Ga0307406_10684587 3300031901 Bacteria 855
283 Ga0307409_100135212 3300031995 Bacteria 2114
284 Ga0307409_101126912 3300031995 Bacteria 806
285 Ga0307415_100226484 3300032126 Bacteria 1503
286 Ga0307415_100776455 3300032126 Bacteria 872
287 Ga0373932_0179749 3300035112 Bacteria 742
288 Ga0373957_0021029 3300035120 Bacteria 2312
289 Ga0373960_0077354 3300035121 Bacteria 1041
290 Ga0373955_0103417 3300035172 Bacteria 1638
291 Ga0373962_0019918 3300035242 Bacteria 1758
292 Ga0373924_0230323 3300035410 Bacteria 819
293 Ga0373933_0056345 3300035724 Bacteria 2359
294 Ga0373937_0389745 3300036401 Bacteria 1321
295 Ga0395899_0001247 3300037312 Bacteria 22094
296 Ga0395899_0022282 3300037312 Bacteria 4804
297 Ga0395899_0022398 3300037312 Bacteria 4791
298 Ga0395899_0055815 3300037312 Bacteria 2921
299 Ga0395900_0000528 3300037418 Bacteria 53945
300 Ga0395900_0000929 3300037418 Bacteria 38304
301 Ga0395900_0012327 3300037418 Bacteria 8745
302 Ga0395900_0020618 3300037418 Bacteria 6734
303 Ga0395900_0024631 3300037418 Bacteria 6159
304 Ga0395900_0028435 3300037418 Bacteria 5726
305 Ga0395900_0107562 3300037418 Bacteria 2865
306 Ga0395900_0182550 3300037418 Bacteria 2131
307 Ga0395900_0467714 3300037418 Bacteria 1215
308 Ga0395900_0841562 3300037418 Bacteria 843
309 Ga0395898_0002139 3300037466 Bacteria 24346
310 Ga0395898_0003495 3300037466 Bacteria 17560
311 Ga0395898_0008588 3300037466 Bacteria 10780
312 Ga0395898_0009600 3300037466 Bacteria 10161
313 Ga0395898_0010892 3300037466 Bacteria 9489
314 Ga0395898_0017551 3300037466 Bacteria 7305
315 Ga0395898_0018907 3300037466 Bacteria 7020
316 Ga0395898_0031535 3300037466 Bacteria 5295
317 Ga0395898_0264603 3300037466 Bacteria 1640
318 Ga0395898_0318588 3300037466 Bacteria 1483
319 Ga0395898_0502199 3300037466 Bacteria 1153
320 Ga0395898_0599200 3300037466 Bacteria 1044
321 Ga0395898_0712537 3300037466 Bacteria 945
322 Ga0395905_0000661 3300037471 Bacteria 45819
323 Ga0395905_0005716 3300037471 Bacteria 12642
324 Ga0395905_0023587 3300037471 Bacteria 5812
325 Ga0395905_0027711 3300037471 Bacteria 5342
326 Ga0395905_0033887 3300037471 Bacteria 4797
327 Ga0395905_0084950 3300037471 Bacteria 2966
328 Ga0395905_0110005 3300037471 Bacteria 2587
329 Ga0395905_0486647 3300037471 Bacteria 1133
330 Ga0395905_0503503 3300037471 Bacteria 1111
331 Ga0395905_0578817 3300037471 Bacteria 1024
332 Ga0395901_0001602 3300038443 Bacteria 23437
333 Ga0395901_0001739 3300038443 Bacteria 22507
334 Ga0395901_0003765 3300038443 Bacteria 15289
335 Ga0395901_0009363 3300038443 Bacteria 9934
336 Ga0395901_0023866 3300038443 Bacteria 6273
337 Ga0395901_0034145 3300038443 Bacteria 5253
338 Ga0395901_0105320 3300038443 Bacteria 2960
339 Ga0395901_0121071 3300038443 Bacteria 2750
340 Ga0395901_0256914 3300038443 Bacteria 1819
341 Ga0395901_0269205 3300038443 Bacteria 1772
342 Ga0395901_0306684 3300038443 Bacteria 1645
343 Ga0395901_0346615 3300038443 Bacteria 1533
344 Ga0395901_0416957 3300038443 Bacteria 1377
345 Ga0395901_0417481 3300038443 Bacteria 1376
346 Ga0395901_0438974 3300038443 Bacteria 1336
347 Ga0395901_0538128 3300038443 Unclassified 1185
348 Ga0395901_0673512 3300038443 Bacteria 1035
349 Ga0395901_1001733 3300038443 Bacteria 811
350 Ga0395901_1170640 3300038443 Bacteria 736
351 Ga0439453_0031552 3300041408 Bacteria 1006
352 Ga0439466_0052194 3300041411 Bacteria 1337
353 Ga0451791_1238341 3300041451 Bacteria 898
354 Ga0451847_0957932 3300041503 Unclassified 648
355 Ga0451843_1640951 3300041509 Bacteria 890
356 Ga0451855_0177353 3300041511 Bacteria 2063
357 Ga0451853_2407108 3300041512 Bacteria 1007
358 Ga0451853_4101398 3300041512 Bacteria 1260
359 Ga0439448_0004580 3300042005 Bacteria 3907
360 Ga0439448_0017016 3300042005 Bacteria 2217
361 Ga0439454_016454 3300042011 Bacteria 1046
362 Ga0439455_0026431 3300042012 Bacteria 1417
363 Ga0439455_0032572 3300042012 Bacteria 1304
364 Ga0439455_0082263 3300042012 Bacteria 876
365 Ga0439456_009130 3300042013 Bacteria 2048
366 Ga0450914_000795 3300042118 Bacteria 1700
367 Ga0450917_005151 3300042120 Unclassified 969
368 Ga0450920_006368 3300042122 Bacteria 2123
369 Ga0439460_0078707 3300042461 Bacteria 1032
370 Ga0466961_0014162 3300044693 Bacteria 5117
371 Ga0466963_0003495 3300044694 Bacteria 9015
372 Ga0466963_0025770 3300044694 Bacteria 3753
373 Ga0466963_0032633 3300044694 Bacteria 3374
374 Ga0466963_0045512 3300044694 Bacteria 2890
375 Ga0466963_0055679 3300044694 Bacteria 2630
376 Ga0466963_0410885 3300044694 Bacteria 954
377 Ga0466964_0005225 3300044706 Bacteria 4815
378 Ga0466964_0182848 3300044706 Bacteria 995
379 Ga0466964_0284676 3300044706 Bacteria 827
380 Ga0466971_0005123 3300044719 Bacteria 5676
381 Ga0466971_0032999 3300044719 Bacteria 2320
382 Ga0466968_0036149 3300044735 Bacteria 2069
383 Ga0466957_0136273 3300044842 Bacteria 1578
384 Ga0466957_0160061 3300044842 Bacteria 1462
385 Ga0466957_0174852 3300044842 Bacteria 1400
386 Ga0466957_0398821 3300044842 Bacteria 940
387 Ga0451576_0062862 3300045051 Bacteria 3870
388 Ga0451576_0067477 3300045051 Bacteria 3724
389 Ga0466958_0000555 3300045836 Bacteria 15880
390 Ga0466958_0023339 3300045836 Bacteria 3630
391 Ga0466967_0018104 3300045976 Bacteria 5620
392 Ga0466967_0030284 3300045976 Bacteria 4540
393 Ga0466967_0073452 3300045976 Bacteria 3069
394 Ga0466967_0082042 3300045976 Bacteria 2913
395 Ga0466967_0149725 3300045976 Bacteria 2180
396 Ga0466967_0357779 3300045976 Bacteria 1414
397 Ga0466967_0439012 3300045976 Bacteria 1274
398 Ga0466967_1297551 3300045976 Bacteria 725
399 Ga0495627_176234 3300046453 Unclassified 593
400 Ga0495603_0077703 3300046455 Bacteria 1947
401 Ga0495603_0127388 3300046455 Bacteria 1483
402 Ga0495603_0157395 3300046455 Bacteria 1318
403 Ga0495641_0036815 3300046461 Bacteria 2297
404 Ga0495641_0134365 3300046461 Unclassified 1104
405 Ga0495641_0228767 3300046461 Bacteria 834
406 Ga0495651_0212426 3300046462 Bacteria 1345
407 Ga0495653_0224620 3300046463 Bacteria 1260
408 Ga0495653_0394720 3300046463 Bacteria 881
409 Ga0495582_0017452 3300046473 Bacteria 3928
410 Ga0495582_0382362 3300046473 Unclassified 811
411 Ga0495639_0275647 3300046475 Bacteria 835
412 Ga0495664_0294987 3300046477 Unclassified 979
413 Ga0495585_0035552 3300046492 Bacteria 2814
414 Ga0495585_0155960 3300046492 Bacteria 1188
415 Ga0495585_0177735 3300046492 Bacteria 1096
416 Ga0495594_0270128 3300046499 Bacteria 969
417 Ga0495594_0297220 3300046499 Bacteria 920
418 Ga0495596_0075480 3300046500 Bacteria 1309
419 Ga0495596_0117323 3300046500 Bacteria 1034
420 Ga0495596_0153004 3300046500 Bacteria 896
421 Ga0495596_0245209 3300046500 Unclassified 695
422 Ga0495607_0047833 3300046501 Bacteria 2503
423 Ga0495607_0146158 3300046501 Bacteria 1215
424 Ga0495608_0179834 3300046511 Bacteria 1338
425 Ga0495618_0200261 3300046514 Bacteria 1264
426 Ga0495628_0206062 3300046516 Bacteria 1480
427 Ga0495628_0439861 3300046516 Bacteria 948
428 Ga0495630_0413930 3300046517 Bacteria 1033
429 Ga0495644_0002130 3300046523 Bacteria 7939
430 Ga0495663_0039020 3300046525 Bacteria 1438
431 Ga0495663_0134772 3300046525 Bacteria 835
432 Ga0495642_0063768 3300046528 Bacteria 1532
433 Ga0495642_0126155 3300046528 Bacteria 1100
434 Ga0495642_0237858 3300046528 Bacteria 796
435 Ga0495652_0131476 3300046529 Bacteria 1981
436 Ga0495652_0483631 3300046529 Bacteria 861
437 Ga0495586_0138047 3300046535 Unclassified 1367
438 Ga0495587_0094499 3300046536 Bacteria 1726
439 Ga0495621_0158474 3300046539 Bacteria 894
440 Ga0495645_0110459 3300046543 Bacteria 1946
441 Ga0495645_0374668 3300046543 Bacteria 912
442 Ga0495667_0045869 3300046559 Bacteria 2891
443 Ga0495667_0071671 3300046559 Bacteria 2259
444 Ga0495667_0708842 3300046559 Bacteria 623
445 Ga0495656_0010596 3300046615 Bacteria 3357
446 Ga0495656_0067924 3300046615 Bacteria 1574
447 Ga0495656_0379885 3300046615 Bacteria 736
448 Ga0495634_0013364 3300046642 Bacteria 5933
449 Ga0495611_0005390 3300046648 Bacteria 5475
450 Ga0495611_0090748 3300046648 Bacteria 1412
451 Ga0495659_0147664 3300046664 Bacteria 942
452 Ga0495661_0036475 3300046665 Bacteria 3079
453 Ga0495588_0028333 3300046674 Bacteria 2803
454 Ga0495588_0348885 3300046674 Bacteria 778
455 Ga0495657_0022704 3300046675 Bacteria 4490
456 Ga0495599_0205320 3300046678 Bacteria 1210
457 Ga0495646_0084834 3300046680 Bacteria 1839
458 Ga0495647_0032089 3300046681 Bacteria 1956
459 Ga0495647_0183023 3300046681 Bacteria 912
460 Ga0495658_0123416 3300046683 Bacteria 1569
461 Ga0495658_0160442 3300046683 Unclassified 1386
462 Ga0495658_0269902 3300046683 Bacteria 1072
463 Ga0495658_0346437 3300046683 Bacteria 944
464 Ga0495613_0018523 3300046689 Bacteria 5191
465 Ga0495613_0117890 3300046689 Bacteria 1909
466 Ga0495624_0209441 3300046690 Bacteria 1183
467 Ga0495670_0121638 3300046691 Bacteria 1356
468 Ga0495670_0171972 3300046691 Bacteria 1141
469 Ga0495589_0003474 3300046794 Bacteria 8524
470 Ga0495600_0226585 3300046809 Bacteria 1194
471 Ga0495581_0006841 3300047315 Bacteria 6613
472 Ga0495604_0229981 3300047317 Bacteria 1272
473 Ga0495604_0519229 3300047317 Bacteria 771
474 Ga0495674_0142147 3300047319 Bacteria 2017
475 Ga0495676_0015889 3300047321 Bacteria 6690
476 Ga0495676_0274888 3300047321 Bacteria 1142
477 Ga0495680_0124481 3300047322 Bacteria 1900
478 Ga0495680_0262672 3300047322 Bacteria 1221
479 Ga0495680_0472068 3300047322 Bacteria 855
480 Ga0495679_041023 3300047446 Bacteria 1436
481 Ga0495684_0085002 3300047471 Bacteria 2399
482 Ga0495684_0098060 3300047471 Bacteria 2216
483 Ga0495684_0308364 3300047471 Bacteria 1135
484 Ga0495614_0186915 3300048089 Unclassified 934
485 Ga0495614_0354557 3300048089 Bacteria 684
486 Ga0495615_0066534 3300048090 Bacteria 963
487 Ga0496100_0034400 3300048903 Bacteria 3179
488 Ga0496100_0108463 3300048903 Bacteria 1925
489 Ga0496101_0004691 3300048904 Bacteria 8654
490 Ga0496101_0019494 3300048904 Bacteria 4630
491 Ga0496101_0078019 3300048904 Bacteria 2442
492 Ga0496102_0001550 3300048905 Bacteria 20301
493 Ga0496102_0331755 3300048905 Bacteria 1433
494 Ga0496102_0370947 3300048905 Bacteria 1347
495 Ga0496103_0006198 3300048906 Bacteria 7145
496 Ga0496104_0011510 3300048907 Bacteria 7927
497 Ga0496104_0054094 3300048907 Bacteria 3794
498 Ga0496104_0073268 3300048907 Bacteria 3258
499 Ga0496104_0082424 3300048907 Bacteria 3067
500 Ga0496104_0196231 3300048907 Bacteria 1931
501 Ga0496104_0260432 3300048907 Bacteria 1647
502 Ga0496105_0006331 3300048908 Bacteria 9093
503 Ga0496105_0014915 3300048908 Bacteria 6185
504 Ga0496105_0135698 3300048908 Bacteria 2027
505 Ga0496105_0262801 3300048908 Bacteria 1395
506 Ga0496106_0011574 3300048909 Bacteria 6520
507 Ga0496106_0019910 3300048909 Bacteria 4976
508 Ga0496107_0001749 3300048910 Bacteria 13668
509 Ga0496107_0006312 3300048910 Bacteria 8147
510 Ga0496107_0054304 3300048910 Bacteria 2891
511 Ga0496107_0082299 3300048910 Bacteria 2348
512 Ga0496108_0015170 3300048911 Bacteria 6285
513 Ga0496108_0017772 3300048911 Bacteria 5816
514 Ga0496108_0074145 3300048911 Bacteria 2873
515 Ga0496108_0083422 3300048911 Bacteria 2711
516 Ga0496108_0156093 3300048911 Bacteria 1971
517 Ga0496108_0498443 3300048911 Bacteria 1064
518 Ga0496108_0559729 3300048911 Bacteria 997
519 Ga0496109_0002480 3300048912 Bacteria 15458
520 Ga0496109_0044381 3300048912 Bacteria 4032
521 Ga0496109_0259030 3300048912 Bacteria 1638
522 Ga0496109_0263528 3300048912 Bacteria 1623
523 Ga0496109_0791076 3300048912 Unclassified 886
524 Ga0496110_0014207 3300048913 Bacteria 6606
525 Ga0496110_0076371 3300048913 Bacteria 2979
526 Ga0496110_0201306 3300048913 Bacteria 1809
527 Ga0496110_0272531 3300048913 Bacteria 1541
528 Ga0496110_0318439 3300048913 Unclassified 1417
529 Ga0496110_1174103 3300048913 Bacteria 676
530 Ga0496111_0001848 3300048914 Bacteria 12482
531 Ga0496111_0018470 3300048914 Bacteria 4832
532 Ga0496111_0161028 3300048914 Bacteria 1666
533 Ga0496111_0313610 3300048914 Bacteria 1162
534 Ga0496112_0017461 3300048915 Bacteria 6741
535 Ga0496112_0056358 3300048915 Bacteria 3867
536 Ga0496112_0062637 3300048915 Bacteria 3669
537 Ga0496112_0702998 3300048915 Bacteria 939
538 Ga0496112_0757818 3300048915 Bacteria 897
539 Ga0496112_0797206 3300048915 Bacteria 869
540 Ga0496112_0888855 3300048915 Bacteria 813
541 Ga0496113_0231003 3300048916 Bacteria 1475
542 Ga0496113_0352820 3300048916 Bacteria 1180
543 Ga0496113_0364687 3300048916 Bacteria 1159
544 Ga0496113_0884574 3300048916 Bacteria 707
545 Ga0496114_0007714 3300048917 Bacteria 8512
546 Ga0496114_0011850 3300048917 Bacteria 6976
547 Ga0496114_0029172 3300048917 Bacteria 4532
548 Ga0496114_0084964 3300048917 Bacteria 2680
549 Ga0496114_0164022 3300048917 Bacteria 1934
550 Ga0496114_0324283 3300048917 Bacteria 1361
551 Ga0496114_0659600 3300048917 Bacteria 920
552 Ga0496115_0001849 3300048918 Bacteria 15140
553 Ga0496115_0031246 3300048918 Bacteria 4194
554 Ga0496115_0034215 3300048918 Bacteria 4015
555 Ga0496115_0294146 3300048918 Bacteria 1331
556 Ga0496115_0609071 3300048918 Bacteria 867
557 Ga0501031_0109728 3300049568 Bacteria 1802
558 Ga0501039_0330282 3300049575 Bacteria 1198
559 Ga0501040_0088997 3300049576 Bacteria 2145
560 Ga0501040_0132496 3300049576 Bacteria 1753
561 Ga0501040_0244757 3300049576 Bacteria 1279
562 Ga0501040_0426173 3300049576 Bacteria 954
563 Ga0501041_0209328 3300049577 Bacteria 1223
564 Ga0501041_0715275 3300049577 Bacteria 641
565 Ga0501042_0276372 3300049578 Bacteria 1213
566 Ga0501047_0536099 3300049581 Bacteria 995
567 Ga0501048_0662280 3300049582 Bacteria 750
568 Ga0501067_0001839 3300049583 Bacteria 11670
569 Ga0501067_0022660 3300049583 Bacteria 3476
570 Ga0501067_0042956 3300049583 Bacteria 2510
571 Ga0501067_0339271 3300049583 Bacteria 837
572 Ga0501068_0035879 3300049584 Bacteria 2962
573 Ga0501068_0269254 3300049584 Bacteria 1087
574 Ga0501069_0005259 3300049585 Bacteria 6723
575 Ga0501071_0091668 3300049587 Bacteria 2233
576 Ga0501071_0103454 3300049587 Bacteria 2101
577 Ga0501071_0192200 3300049587 Bacteria 1531
578 Ga0501072_0182551 3300049588 Bacteria 1674
579 Ga0501072_0257062 3300049588 Bacteria 1391
580 Ga0501072_0288118 3300049588 Unclassified 1306
581 Ga0501074_0187294 3300049590 Bacteria 1476
582 Ga0501075_0136224 3300049591 Bacteria 1871
583 Ga0501075_0944545 3300049591 Bacteria 655
584 Ga0501077_0167938 3300049593 Bacteria 1394
585 Ga0501079_0102540 3300049741 Bacteria 2219
586 Ga0501079_0305742 3300049741 Bacteria 1244
587 Ga0501081_0140264 3300049743 Bacteria 1732
588 Ga0501081_0626381 3300049743 Bacteria 806
589 Ga0501083_0395053 3300049744 Bacteria 900
590 Ga0501083_0607682 3300049744 Bacteria 711
591 Ga0501044_0382320 3300049823 Bacteria 1323
592 Ga0501045_0056450 3300049824 Bacteria 2872
593 Ga0501045_0142244 3300049824 Bacteria 1784
594 Ga0501045_0299010 3300049824 Bacteria 1198
595 nmdc:mga00v17_211740_c1 3300050491 Bacteria 1254
596 nmdc:mga05p37_105493_c1 3300050507 Bacteria 3467
597 nmdc:mga05p37_111967_c1 3300050507 Bacteria 3356
598 nmdc:mga05p37_136458_c1 3300050507 Bacteria 3008
599 nmdc:mga05p37_149619_c1 3300050507 Bacteria 2857
600 nmdc:mga06r32_323513_c1 3300050510 Bacteria 1527
601 nmdc:mga06r32_65761_c1 3300050510 Bacteria 3498
602 nmdc:mga06r32_861657_c1 3300050510 Bacteria 864
603 nmdc:mga08y16_237134_c1 3300050511 Bacteria 1886
604 nmdc:mga08y16_315673_c1 3300050511 Bacteria 1609
605 nmdc:mga08y16_976175_c1 3300050511 Bacteria 829
606 nmdc:mga0n895_1015942_c1 3300050512 Bacteria 810
607 nmdc:mga0n895_22984_c1 3300050512 Bacteria 5853
608 nmdc:mga0n895_365647_c1 3300050512 Bacteria 1460
609 nmdc:mga0n895_49545_c1 3300050512 Bacteria 4116
610 nmdc:mga0n895_610042_c1 3300050512 Bacteria 1093
611 nmdc:mga0n895_64234_c1 3300050512 Bacteria 3631
612 nmdc:mga0n895_650154_c1 3300050512 Bacteria 1053
613 nmdc:mga0rr50_175252_c1 3300050513 Bacteria 1750
614 nmdc:mga0rr50_212011_c1 3300050513 Bacteria 1596
615 nmdc:mga0rr50_25078_c1 3300050513 Bacteria 4142
616 nmdc:mga0rr50_371358_c1 3300050513 Bacteria 1205
617 nmdc:mga08x19_3167_c1 3300050514 Bacteria 9874
618 nmdc:mga0a205_15536_c1 3300050515 Bacteria 7115
619 nmdc:mga0a205_192468_c1 3300050515 Bacteria 1931
620 Ga0495601_0089704 3300053077 Bacteria 1977
621 Ga0495655_0150883 3300053083 Bacteria 731
622 Ga0495595_0111604 3300053084 Bacteria 1326
623 Ga0495595_0243151 3300053084 Bacteria 900
624 Ga0495619_0110205 3300053085 Bacteria 1880
625 Ga0495619_0133910 3300053085 Bacteria 1704
626 Ga0495619_0394848 3300053085 Unclassified 955
627 Ga0501084_0305330 3300054114 Bacteria 1344
628 Ga0501084_0950722 3300054114 Bacteria 722
629 Ga0590071_029440 3300059421 Bacteria 1305
630 Ga0501082_1179501 3300060353 Bacteria 669
631 Ga0466962_0004154 3300061719 Bacteria 6942
632 Ga0466962_0065206 3300061719 Bacteria 1739
633 Ga0466962_0341031 3300061719 Bacteria 745
634 Ga0530510_0235480 3300061734 Bacteria 1362
635 Ga0530510_0247340 3300061734 Bacteria 1328
636 Ga0530510_0295871 3300061734 Bacteria 1211
637 Ga0530510_0906747 3300061734 Bacteria 674

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048915 Ga0496112_0757818 Ga0496112_0757818_256_822 156
2 3300005435 Ga0070714_100284742 Ga0070714_1002847422 157
3 3300025929 Ga0207664_10113134 Ga0207664_101131342 157
4 3300041408 Ga0439453_0031552 Ga0439453_0031552_39_590 157
5 3300042012 Ga0439455_0026431 Ga0439455_0026431_231_782 157
6 3300042118 Ga0450914_000795 Ga0450914_000795_510_1061 157
7 3300042120 Ga0450917_005151 Ga0450917_005151_218_769 157
8 3300042122 Ga0450920_006368 Ga0450920_006368_401_952 157
9 3300005471 Ga0070698_100146609 Ga0070698_1001466093 158
10 3300005536 Ga0070697_100704590 Ga0070697_1007045902 158
11 3300046516 Ga0495628_0206062 Ga0495628_0206062_38_658 158
12 3300061734 Ga0530510_0906747 Ga0530510_0906747_62_619 158
13 3300005437 Ga0070710_10281210 Ga0070710_102812103 159
14 3300006844 Ga0075428_100766993 Ga0075428_1007669932 159
15 3300009093 Ga0105240_10736098 Ga0105240_107360982 159
16 3300009094 Ga0111539_10543509 Ga0111539_105435091 159
17 3300050511 nmdc:mga08y16_315673_c1 nmdc:mga08y16_315673_c1_936_1502 159
18 3300005539 Ga0068853_100291773 Ga0068853_1002917732 160
19 3300005327 Ga0070658_11046640 Ga0070658_110466401 161
20 3300044694 Ga0466963_0003495 Ga0466963_0003495_7834_8367 162
21 3300044694 Ga0466963_0025770 Ga0466963_0025770_2094_2627 162
22 3300044706 Ga0466964_0182848 Ga0466964_0182848_60_593 162
23 3300044842 Ga0466957_0160061 Ga0466957_0160061_295_828 162
24 3300045836 Ga0466958_0000555 Ga0466958_0000555_6221_6754 162
25 3300045976 Ga0466967_0018104 Ga0466967_0018104_2638_3171 162
26 3300045976 Ga0466967_0030284 Ga0466967_0030284_2068_2601 162
27 3300046461 Ga0495641_0134365 Ga0495641_0134365_10_528 162
28 3300050491 nmdc:mga00v17_211740_c1 nmdc:mga00v17_211740_c1_639_1214 162
29 3300005435 Ga0070714_100412481 Ga0070714_1004124812 163
30 3300005981 Ga0081538_10009502 Ga0081538_100095021 163
31 3300006028 Ga0070717_10776215 Ga0070717_107762152 163
32 3300025910 Ga0207684_10397006 Ga0207684_103970062 163
33 3300025915 Ga0207693_10003417 Ga0207693_100034172 163
34 3300025929 Ga0207664_10142046 Ga0207664_101420463 163
35 3300025939 Ga0207665_10230559 Ga0207665_102305593 163
36 3300046529 Ga0495652_0483631 Ga0495652_0483631_74_628 163
37 3300048910 Ga0496107_0082299 Ga0496107_0082299_68_616 163
38 3300048917 Ga0496114_0029172 Ga0496114_0029172_3236_3784 163
39 3300048918 Ga0496115_0609071 Ga0496115_0609071_72_620 163
40 3300049578 Ga0501042_0276372 Ga0501042_0276372_601_1158 163
41 3300005459 Ga0068867_100325091 Ga0068867_1003250913 164
42 3300005535 Ga0070684_100272137 Ga0070684_1002721372 164
43 3300006358 Ga0068871_100309483 Ga0068871_1003094832 164
44 3300009147 Ga0114129_10206421 Ga0114129_102064213 164
45 3300009148 Ga0105243_10094679 Ga0105243_100946792 164
46 3300013308 Ga0157375_10452886 Ga0157375_104528863 164
47 3300014325 Ga0163163_10969987 Ga0163163_109699872 164
48 3300014969 Ga0157376_10357208 Ga0157376_103572083 164
49 3300017792 Ga0163161_10235473 Ga0163161_102354731 164
50 3300026067 Ga0207678_10813117 Ga0207678_108131172 164
51 3300041451 Ga0451791_1238341 Ga0451791_1238341_321_854 164
52 3300041512 Ga0451853_4101398 Ga0451853_4101398_213_746 164
53 3300046674 Ga0495588_0028333 Ga0495588_0028333_1618_2148 164
54 3300046681 Ga0495647_0032089 Ga0495647_0032089_220_750 164
55 3300046690 Ga0495624_0209441 Ga0495624_0209441_279_812 164
56 3300047321 Ga0495676_0274888 Ga0495676_0274888_454_984 164
57 3300048090 Ga0495615_0066534 Ga0495615_0066534_291_821 164
58 3300048917 Ga0496114_0659600 Ga0496114_0659600_207_740 164
59 3300050512 nmdc:mga0n895_650154_c1 nmdc:mga0n895_650154_c1_229_798 164
60 3300005435 Ga0070714_100499909 Ga0070714_1004999092 165
61 3300006028 Ga0070717_10048830 Ga0070717_100488303 165
62 3300025929 Ga0207664_10551494 Ga0207664_105514942 165
63 3300048914 Ga0496111_0313610 Ga0496111_0313610_521_1090 165
64 3300049583 Ga0501067_0022660 Ga0501067_0022660_2184_2750 165
65 3300049583 Ga0501067_0339271 Ga0501067_0339271_107_670 165
66 3300049584 Ga0501068_0269254 Ga0501068_0269254_273_836 165
67 3300005536 Ga0070697_100986152 Ga0070697_1009861522 166
68 3300037418 Ga0395900_0028435 Ga0395900_0028435_1474_2040 166
69 3300037471 Ga0395905_0084950 Ga0395905_0084950_2249_2815 166
70 3300038443 Ga0395901_0023866 Ga0395901_0023866_2482_3048 166
71 3300005329 Ga0070683_100487069 Ga0070683_1004870692 167
72 3300005535 Ga0070684_100563617 Ga0070684_1005636172 167
73 3300005937 Ga0081455_10021779 Ga0081455_100217794 167
74 3300006048 Ga0075363_100151567 Ga0075363_1001515672 167
75 3300006178 Ga0075367_10252709 Ga0075367_102527092 167
76 3300006847 Ga0075431_100071651 Ga0075431_1000716513 167
77 3300006852 Ga0075433_10000356 Ga0075433_1000035624 167
78 3300006871 Ga0075434_100006317 Ga0075434_1000063176 167
79 3300006914 Ga0075436_100018854 Ga0075436_1000188544 167
80 3300007076 Ga0075435_100021735 Ga0075435_1000217354 167
81 3300009147 Ga0114129_10005223 Ga0114129_1000522318 167
82 3300026121 Ga0207683_10305271 Ga0207683_103052713 167
83 3300048907 Ga0496104_0196231 Ga0496104_0196231_682_1257 167
84 3300049576 Ga0501040_0132496 Ga0501040_0132496_531_1085 167
85 3300049582 Ga0501048_0662280 Ga0501048_0662280_105_659 167
86 3300049587 Ga0501071_0192200 Ga0501071_0192200_329_883 167
87 3300050507 nmdc:mga05p37_149619_c1 nmdc:mga05p37_149619_c1_38_598 167
88 3300050510 nmdc:mga06r32_65761_c1 nmdc:mga06r32_65761_c1_1906_2466 167
89 3300050512 nmdc:mga0n895_22984_c1 nmdc:mga0n895_22984_c1_715_1275 167
90 3300050513 nmdc:mga0rr50_25078_c1 nmdc:mga0rr50_25078_c1_1330_1890 167
91 3300050514 nmdc:mga08x19_3167_c1 nmdc:mga08x19_3167_c1_3172_3732 167
92 3300050515 nmdc:mga0a205_15536_c1 nmdc:mga0a205_15536_c1_4754_5314 167
93 3300054114 Ga0501084_0950722 Ga0501084_0950722_107_661 167
94 3300060353 Ga0501082_1179501 Ga0501082_1179501_19_573 167
95 3300005436 Ga0070713_100194877 Ga0070713_1001948773 168
96 3300025928 Ga0207700_10000039 Ga0207700_10000039116 168
97 3300042005 Ga0439448_0004580 Ga0439448_0004580_804_1361 168
98 3300042012 Ga0439455_0082263 Ga0439455_0082263_96_653 168
99 3300044694 Ga0466963_0032633 Ga0466963_0032633_2609_3157 168
100 3300049575 Ga0501039_0330282 Ga0501039_0330282_52_639 168
101 3300049576 Ga0501040_0244757 Ga0501040_0244757_194_781 168
102 3300049577 Ga0501041_0209328 Ga0501041_0209328_365_952 168
103 3300049587 Ga0501071_0103454 Ga0501071_0103454_1146_1733 168
104 3300049588 Ga0501072_0288118 Ga0501072_0288118_46_606 168
105 3300049593 Ga0501077_0167938 Ga0501077_0167938_327_914 168
106 3300049741 Ga0501079_0102540 Ga0501079_0102540_544_1131 168
107 3300049744 Ga0501083_0395053 Ga0501083_0395053_248_835 168
108 3300054114 Ga0501084_0305330 Ga0501084_0305330_228_788 168
109 3300061734 Ga0530510_0235480 Ga0530510_0235480_475_1062 168
110 3300005981 Ga0081538_10066728 Ga0081538_100667283 169
111 3300025929 Ga0207664_10031688 Ga0207664_100316882 169
112 3300031344 Ga0265316_10829776 Ga0265316_108297762 169
113 3300044694 Ga0466963_0410885 Ga0466963_0410885_142_699 169
114 3300044842 Ga0466957_0174852 Ga0466957_0174852_202_759 169
115 3300046683 Ga0495658_0346437 Ga0495658_0346437_111_683 169
116 3300059421 Ga0590071_029440 Ga0590071_029440_293_829 169
117 3300061719 Ga0466962_0341031 Ga0466962_0341031_13_570 169
118 3300005355 Ga0070671_100177071 Ga0070671_1001770712 170
119 3300009098 Ga0105245_10079275 Ga0105245_100792753 170
120 3300009553 Ga0105249_10359169 Ga0105249_103591692 170
121 3300010375 Ga0105239_10382220 Ga0105239_103822203 170
122 3300025927 Ga0207687_10913967 Ga0207687_109139672 170
123 3300025931 Ga0207644_10148432 Ga0207644_101484323 170
124 3300035112 Ga0373932_0179749 Ga0373932_0179749_175_732 170
125 3300035121 Ga0373960_0077354 Ga0373960_0077354_220_777 170
126 3300035242 Ga0373962_0019918 Ga0373962_0019918_516_1073 170
127 3300042005 Ga0439448_0017016 Ga0439448_0017016_850_1407 170
128 3300042012 Ga0439455_0032572 Ga0439455_0032572_470_1027 170
129 3300045976 Ga0466967_0073452 Ga0466967_0073452_1162_1749 170
130 3300047322 Ga0495680_0262672 Ga0495680_0262672_654_1196 170
131 3300050511 nmdc:mga08y16_976175_c1 nmdc:mga08y16_976175_c1_199_756 170
132 3300005439 Ga0070711_101033929 Ga0070711_1010339291 171
133 3300005468 Ga0070707_100763184 Ga0070707_1007631842 171
134 3300005471 Ga0070698_100006514 Ga0070698_1000065144 171
135 3300006852 Ga0075433_10256523 Ga0075433_102565233 171
136 3300009094 Ga0111539_11808581 Ga0111539_118085812 171
137 3300025922 Ga0207646_10532390 Ga0207646_105323902 171
138 3300045976 Ga0466967_0082042 Ga0466967_0082042_89_628 171
139 3300045976 Ga0466967_0357779 Ga0466967_0357779_674_1192 171
140 3300045976 Ga0466967_0439012 Ga0466967_0439012_309_827 171
141 3300046615 Ga0495656_0379885 Ga0495656_0379885_107_634 171
142 3300048913 Ga0496110_1174103 Ga0496110_1174103_28_633 171
143 3300048915 Ga0496112_0702998 Ga0496112_0702998_172_777 171
144 3300049588 Ga0501072_0257062 Ga0501072_0257062_810_1364 171
145 3300050507 nmdc:mga05p37_111967_c1 nmdc:mga05p37_111967_c1_2080_2685 171
146 3300050511 nmdc:mga08y16_237134_c1 nmdc:mga08y16_237134_c1_616_1221 171
147 3300050515 nmdc:mga0a205_192468_c1 nmdc:mga0a205_192468_c1_405_1010 171
148 3300005456 Ga0070678_100641501 Ga0070678_1006415012 172
149 3300031901 Ga0307406_10684587 Ga0307406_106845872 172
150 3300031995 Ga0307409_100135212 Ga0307409_1001352123 172
151 3300037312 Ga0395899_0055815 Ga0395899_0055815_32_550 172
152 3300038443 Ga0395901_0306684 Ga0395901_0306684_315_836 172
153 3300046455 Ga0495603_0157395 Ga0495603_0157395_786_1304 172
154 3300046559 Ga0495667_0708842 Ga0495667_0708842_20_574 172
155 3300047319 Ga0495674_0142147 Ga0495674_0142147_591_1145 172
156 3300047471 Ga0495684_0308364 Ga0495684_0308364_252_806 172
157 3300048915 Ga0496112_0888855 Ga0496112_0888855_35_583 172
158 3300049823 Ga0501044_0382320 Ga0501044_0382320_616_1134 172
159 3300053085 Ga0495619_0110205 Ga0495619_0110205_189_743 172
160 3300005328 Ga0070676_10969579 Ga0070676_109695791 173
161 3300005434 Ga0070709_10083598 Ga0070709_100835983 173
162 3300005455 Ga0070663_100858871 Ga0070663_1008588712 173
163 3300005981 Ga0081538_10049856 Ga0081538_100498564 173
164 3300005985 Ga0081539_10001480 Ga0081539_1000148022 173
165 3300006871 Ga0075434_100613660 Ga0075434_1006136602 173
166 3300009147 Ga0114129_10096674 Ga0114129_100966744 173
167 3300025934 Ga0207686_10247284 Ga0207686_102472842 173
168 3300025939 Ga0207665_10200549 Ga0207665_102005493 173
169 3300025944 Ga0207661_10443721 Ga0207661_104437212 173
170 3300026078 Ga0207702_10994629 Ga0207702_109946291 173
171 3300027907 Ga0207428_10905526 Ga0207428_109055261 173
172 3300031548 Ga0307408_100428254 Ga0307408_1004282542 173
173 3300031995 Ga0307409_101126912 Ga0307409_1011269122 173
174 3300032126 Ga0307415_100226484 Ga0307415_1002264843 173
175 3300032126 Ga0307415_100776455 Ga0307415_1007764552 173
176 3300037418 Ga0395900_0841562 Ga0395900_0841562_18_557 173
177 3300037466 Ga0395898_0018907 Ga0395898_0018907_5465_5998 173
178 3300037466 Ga0395898_0502199 Ga0395898_0502199_382_921 173
179 3300037466 Ga0395898_0599200 Ga0395898_0599200_292_840 173
180 3300037471 Ga0395905_0578817 Ga0395905_0578817_227_760 173
181 3300038443 Ga0395901_0034145 Ga0395901_0034145_3595_4128 173
182 3300038443 Ga0395901_0269205 Ga0395901_0269205_291_830 173
183 3300038443 Ga0395901_0346615 Ga0395901_0346615_162_695 173
184 3300038443 Ga0395901_0416957 Ga0395901_0416957_311_847 173
185 3300038443 Ga0395901_0417481 Ga0395901_0417481_667_1206 173
186 3300041503 Ga0451847_0957932 Ga0451847_0957932_12_545 173
187 3300041509 Ga0451843_1640951 Ga0451843_1640951_319_852 173
188 3300042461 Ga0439460_0078707 Ga0439460_0078707_143_670 173
189 3300045051 Ga0451576_0062862 Ga0451576_0062862_1012_1545 173
190 3300046453 Ga0495627_176234 Ga0495627_176234_18_551 173
191 3300046461 Ga0495641_0228767 Ga0495641_0228767_104_637 173
192 3300046492 Ga0495585_0155960 Ga0495585_0155960_202_735 173
193 3300046499 Ga0495594_0270128 Ga0495594_0270128_301_834 173
194 3300046500 Ga0495596_0153004 Ga0495596_0153004_311_841 173
195 3300046501 Ga0495607_0146158 Ga0495607_0146158_86_619 173
196 3300046528 Ga0495642_0237858 Ga0495642_0237858_139_672 173
197 3300048907 Ga0496104_0082424 Ga0496104_0082424_939_1514 173
198 3300048911 Ga0496108_0559729 Ga0496108_0559729_273_806 173
199 3300048913 Ga0496110_0201306 Ga0496110_0201306_519_1094 173
200 3300048914 Ga0496111_0161028 Ga0496111_0161028_422_997 173
201 3300049576 Ga0501040_0088997 Ga0501040_0088997_1255_1806 173
202 3300049577 Ga0501041_0715275 Ga0501041_0715275_88_630 173
203 3300049591 Ga0501075_0136224 Ga0501075_0136224_1146_1697 173
204 3300049591 Ga0501075_0944545 Ga0501075_0944545_38_565 173
205 3300049741 Ga0501079_0305742 Ga0501079_0305742_290_841 173
206 3300049743 Ga0501081_0140264 Ga0501081_0140264_730_1257 173
207 3300049744 Ga0501083_0607682 Ga0501083_0607682_27_554 173
208 3300049824 Ga0501045_0142244 Ga0501045_0142244_174_725 173
209 3300049824 Ga0501045_0299010 Ga0501045_0299010_621_1148 173
210 3300050507 nmdc:mga05p37_105493_c1 nmdc:mga05p37_105493_c1_530_1072 173
211 3300050512 nmdc:mga0n895_1015942_c1 nmdc:mga0n895_1015942_c1_104_646 173
212 3300005549 Ga0070704_100569729 Ga0070704_1005697292 174
213 3300025906 Ga0207699_11041069 Ga0207699_110410691 174
214 3300037312 Ga0395899_0001247 Ga0395899_0001247_5071_5607 174
215 3300037418 Ga0395900_0000929 Ga0395900_0000929_18432_18968 174
216 3300037466 Ga0395898_0003495 Ga0395898_0003495_565_1101 174
217 3300037471 Ga0395905_0027711 Ga0395905_0027711_4078_4614 174
218 3300038443 Ga0395901_0009363 Ga0395901_0009363_6194_6730 174
219 3300044706 Ga0466964_0284676 Ga0466964_0284676_146_676 174
220 3300046500 Ga0495596_0117323 Ga0495596_0117323_318_851 174
221 3300025922 Ga0207646_10972119 Ga0207646_109721192 175
222 3300037418 Ga0395900_0467714 Ga0395900_0467714_445_975 175
223 3300037466 Ga0395898_0031535 Ga0395898_0031535_1766_2296 175
224 3300037466 Ga0395898_0318588 Ga0395898_0318588_390_923 175
225 3300037471 Ga0395905_0503503 Ga0395905_0503503_53_586 175
226 3300038443 Ga0395901_0121071 Ga0395901_0121071_201_731 175
227 3300038443 Ga0395901_0256914 Ga0395901_0256914_218_751 175
228 3300042011 Ga0439454_016454 Ga0439454_016454_250_783 175
229 3300042013 Ga0439456_009130 Ga0439456_009130_562_1095 175
230 3300007076 Ga0075435_100714000 Ga0075435_1007140002 176
231 3300037418 Ga0395900_0182550 Ga0395900_0182550_959_1498 176
232 3300037466 Ga0395898_0017551 Ga0395898_0017551_5520_6059 176
233 3300037471 Ga0395905_0486647 Ga0395905_0486647_329_868 176
234 3300038443 Ga0395901_0438974 Ga0395901_0438974_488_1027 176
235 3300050512 nmdc:mga0n895_365647_c1 nmdc:mga0n895_365647_c1_143_682 176
236 3300050513 nmdc:mga0rr50_175252_c1 nmdc:mga0rr50_175252_c1_121_660 176
237 3300005471 Ga0070698_100230638 Ga0070698_1002306382 177
238 3300005518 Ga0070699_100891540 Ga0070699_1008915401 177
239 3300025929 Ga0207664_10659635 Ga0207664_106596352 177
240 3300028800 Ga0265338_10176004 Ga0265338_101760043 177
241 3300035120 Ga0373957_0021029 Ga0373957_0021029_390_947 177
242 3300035172 Ga0373955_0103417 Ga0373955_0103417_198_755 177
243 3300035410 Ga0373924_0230323 Ga0373924_0230323_148_690 177
244 3300035724 Ga0373933_0056345 Ga0373933_0056345_1662_2219 177
245 3300036401 Ga0373937_0389745 Ga0373937_0389745_618_1175 177
246 3300037418 Ga0395900_0107562 Ga0395900_0107562_988_1533 177
247 3300037466 Ga0395898_0712537 Ga0395898_0712537_236_790 177
248 3300038443 Ga0395901_0105320 Ga0395901_0105320_1718_2263 177
249 3300038443 Ga0395901_0673512 Ga0395901_0673512_333_887 177
250 3300041411 Ga0439466_0052194 Ga0439466_0052194_764_1309 177
251 3300046461 Ga0495641_0036815 Ga0495641_0036815_889_1443 177
252 3300046462 Ga0495651_0212426 Ga0495651_0212426_740_1297 177
253 3300046463 Ga0495653_0394720 Ga0495653_0394720_85_642 177
254 3300046475 Ga0495639_0275647 Ga0495639_0275647_14_547 177
255 3300046511 Ga0495608_0179834 Ga0495608_0179834_536_1093 177
256 3300046514 Ga0495618_0200261 Ga0495618_0200261_185_742 177
257 3300046536 Ga0495587_0094499 Ga0495587_0094499_132_689 177
258 3300046559 Ga0495667_0045869 Ga0495667_0045869_1047_1604 177
259 3300046675 Ga0495657_0022704 Ga0495657_0022704_1920_2477 177
260 3300046678 Ga0495599_0205320 Ga0495599_0205320_260_820 177
261 3300046680 Ga0495646_0084834 Ga0495646_0084834_1252_1806 177
262 3300046689 Ga0495613_0117890 Ga0495613_0117890_468_1025 177
263 3300047317 Ga0495604_0229981 Ga0495604_0229981_185_742 177
264 3300047317 Ga0495604_0519229 Ga0495604_0519229_12_575 177
265 3300047322 Ga0495680_0124481 Ga0495680_0124481_1152_1709 177
266 3300047471 Ga0495684_0085002 Ga0495684_0085002_44_601 177
267 3300048905 Ga0496102_0331755 Ga0496102_0331755_216_773 177
268 3300049576 Ga0501040_0426173 Ga0501040_0426173_64_621 177
269 3300049581 Ga0501047_0536099 Ga0501047_0536099_143_679 177
270 3300049583 Ga0501067_0001839 Ga0501067_0001839_7280_7837 177
271 3300049583 Ga0501067_0042956 Ga0501067_0042956_1750_2313 177
272 3300049584 Ga0501068_0035879 Ga0501068_0035879_388_945 177
273 3300049585 Ga0501069_0005259 Ga0501069_0005259_3301_3858 177
274 3300049590 Ga0501074_0187294 Ga0501074_0187294_275_820 177
275 3300049743 Ga0501081_0626381 Ga0501081_0626381_76_630 177
276 3300053084 Ga0495595_0243151 Ga0495595_0243151_255_812 177
277 3300053085 Ga0495619_0133910 Ga0495619_0133910_61_618 177
278 3300061734 Ga0530510_0247340 Ga0530510_0247340_185_742 177
279 3300061734 Ga0530510_0295871 Ga0530510_0295871_24_587 177
280 3300005327 Ga0070658_10153748 Ga0070658_101537483 178
281 3300005336 Ga0070680_100512746 Ga0070680_1005127462 178
282 3300005337 Ga0070682_100709408 Ga0070682_1007094081 178
283 3300005338 Ga0068868_100398327 Ga0068868_1003983272 178
284 3300005339 Ga0070660_100138568 Ga0070660_1001385683 178
285 3300005344 Ga0070661_100307403 Ga0070661_1003074033 178
286 3300005434 Ga0070709_10516438 Ga0070709_105164382 178
287 3300005435 Ga0070714_100056410 Ga0070714_1000564102 178
288 3300005435 Ga0070714_100457697 Ga0070714_1004576973 178
289 3300005435 Ga0070714_100686230 Ga0070714_1006862302 178
290 3300005437 Ga0070710_10705229 Ga0070710_107052291 178
291 3300005440 Ga0070705_100003265 Ga0070705_1000032655 178
292 3300005445 Ga0070708_100036016 Ga0070708_1000360163 178
293 3300005458 Ga0070681_10033167 Ga0070681_100331672 178
294 3300005467 Ga0070706_100104183 Ga0070706_1001041833 178
295 3300005471 Ga0070698_100005957 Ga0070698_1000059577 178
296 3300005518 Ga0070699_100049107 Ga0070699_1000491072 178
297 3300005530 Ga0070679_100058632 Ga0070679_1000586322 178
298 3300005530 Ga0070679_100123667 Ga0070679_1001236672 178
299 3300005614 Ga0068856_100722282 Ga0068856_1007222822 178
300 3300005616 Ga0068852_101529243 Ga0068852_1015292432 178
301 3300005841 Ga0068863_100788009 Ga0068863_1007880092 178
302 3300005937 Ga0081455_10018484 Ga0081455_100184847 178
303 3300006358 Ga0068871_100448781 Ga0068871_1004487812 178
304 3300006871 Ga0075434_100026435 Ga0075434_1000264353 178
305 3300006871 Ga0075434_100205336 Ga0075434_1002053362 178
306 3300007076 Ga0075435_100046493 Ga0075435_1000464933 178
307 3300009177 Ga0105248_12108253 Ga0105248_121082531 178
308 3300013105 Ga0157369_10060850 Ga0157369_100608503 178
309 3300013296 Ga0157374_10252717 Ga0157374_102527172 178
310 3300013307 Ga0157372_10184457 Ga0157372_101844573 178
311 3300014968 Ga0157379_10362449 Ga0157379_103624493 178
312 3300014969 Ga0157376_10043222 Ga0157376_100432223 178
313 3300020069 Ga0197907_10087614 Ga0197907_100876142 178
314 3300025909 Ga0207705_10602159 Ga0207705_106021592 178
315 3300025910 Ga0207684_10031251 Ga0207684_100312513 178
316 3300025910 Ga0207684_10328060 Ga0207684_103280603 178
317 3300025910 Ga0207684_10375045 Ga0207684_103750452 178
318 3300025912 Ga0207707_10040613 Ga0207707_100406134 178
319 3300025917 Ga0207660_10837354 Ga0207660_108373542 178
320 3300025919 Ga0207657_10019186 Ga0207657_100191862 178
321 3300025920 Ga0207649_10079939 Ga0207649_100799392 178
322 3300025921 Ga0207652_10067742 Ga0207652_100677422 178
323 3300025921 Ga0207652_10267892 Ga0207652_102678923 178
324 3300025927 Ga0207687_10061765 Ga0207687_100617652 178
325 3300025929 Ga0207664_10111618 Ga0207664_101116183 178
326 3300025932 Ga0207690_10035842 Ga0207690_100358424 178
327 3300026078 Ga0207702_10366288 Ga0207702_103662883 178
328 3300026078 Ga0207702_10781942 Ga0207702_107819421 178
329 3300026088 Ga0207641_10736814 Ga0207641_107368142 178
330 3300028381 Ga0268264_10310941 Ga0268264_103109413 178
331 3300028800 Ga0265338_10002048 Ga0265338_100020485 178
332 3300028800 Ga0265338_10037077 Ga0265338_100370773 178
333 3300031235 Ga0265330_10083666 Ga0265330_100836662 178
334 3300031241 Ga0265325_10011700 Ga0265325_100117005 178
335 3300031251 Ga0265327_10019983 Ga0265327_100199834 178
336 3300031251 Ga0265327_10091882 Ga0265327_100918823 178
337 3300031344 Ga0265316_10035575 Ga0265316_100355754 178
338 3300031595 Ga0265313_10039754 Ga0265313_100397542 178
339 3300031711 Ga0265314_10032932 Ga0265314_100329323 178
340 3300038443 Ga0395901_1170640 Ga0395901_1170640_24_587 178
341 3300044693 Ga0466961_0014162 Ga0466961_0014162_1198_1749 178
342 3300044694 Ga0466963_0045512 Ga0466963_0045512_2075_2647 178
343 3300044719 Ga0466971_0032999 Ga0466971_0032999_1727_2293 178
344 3300044735 Ga0466968_0036149 Ga0466968_0036149_383_934 178
345 3300044842 Ga0466957_0136273 Ga0466957_0136273_319_891 178
346 3300045051 Ga0451576_0067477 Ga0451576_0067477_1113_1673 178
347 3300045976 Ga0466967_1297551 Ga0466967_1297551_27_599 178
348 3300046455 Ga0495603_0077703 Ga0495603_0077703_536_1102 178
349 3300046463 Ga0495653_0224620 Ga0495653_0224620_338_886 178
350 3300046473 Ga0495582_0382362 Ga0495582_0382362_104_670 178
351 3300046492 Ga0495585_0035552 Ga0495585_0035552_1635_2183 178
352 3300046499 Ga0495594_0297220 Ga0495594_0297220_124_690 178
353 3300046500 Ga0495596_0245209 Ga0495596_0245209_42_590 178
354 3300046501 Ga0495607_0047833 Ga0495607_0047833_509_1057 178
355 3300046517 Ga0495630_0413930 Ga0495630_0413930_390_938 178
356 3300046523 Ga0495644_0002130 Ga0495644_0002130_6667_7215 178
357 3300046525 Ga0495663_0039020 Ga0495663_0039020_379_927 178
358 3300046528 Ga0495642_0126155 Ga0495642_0126155_259_807 178
359 3300046529 Ga0495652_0131476 Ga0495652_0131476_1282_1833 178
360 3300046535 Ga0495586_0138047 Ga0495586_0138047_141_707 178
361 3300046543 Ga0495645_0110459 Ga0495645_0110459_516_1067 178
362 3300046559 Ga0495667_0071671 Ga0495667_0071671_627_1175 178
363 3300046615 Ga0495656_0010596 Ga0495656_0010596_734_1282 178
364 3300046642 Ga0495634_0013364 Ga0495634_0013364_2451_3017 178
365 3300046648 Ga0495611_0005390 Ga0495611_0005390_4710_5258 178
366 3300046664 Ga0495659_0147664 Ga0495659_0147664_259_807 178
367 3300046665 Ga0495661_0036475 Ga0495661_0036475_2197_2745 178
368 3300046681 Ga0495647_0183023 Ga0495647_0183023_98_664 178
369 3300046683 Ga0495658_0123416 Ga0495658_0123416_185_733 178
370 3300046683 Ga0495658_0160442 Ga0495658_0160442_11_577 178
371 3300046689 Ga0495613_0018523 Ga0495613_0018523_981_1547 178
372 3300046691 Ga0495670_0171972 Ga0495670_0171972_549_1097 178
373 3300046809 Ga0495600_0226585 Ga0495600_0226585_141_689 178
374 3300047321 Ga0495676_0015889 Ga0495676_0015889_1215_1781 178
375 3300047322 Ga0495680_0472068 Ga0495680_0472068_26_574 178
376 3300047446 Ga0495679_041023 Ga0495679_041023_278_826 178
377 3300047471 Ga0495684_0098060 Ga0495684_0098060_623_1171 178
378 3300048089 Ga0495614_0186915 Ga0495614_0186915_32_598 178
379 3300048903 Ga0496100_0108463 Ga0496100_0108463_39_587 178
380 3300048904 Ga0496101_0078019 Ga0496101_0078019_336_884 178
381 3300048907 Ga0496104_0011510 Ga0496104_0011510_4341_4889 178
382 3300048907 Ga0496104_0054094 Ga0496104_0054094_2951_3499 178
383 3300048908 Ga0496105_0006331 Ga0496105_0006331_5902_6450 178
384 3300048908 Ga0496105_0135698 Ga0496105_0135698_202_750 178
385 3300048910 Ga0496107_0054304 Ga0496107_0054304_1270_1818 178
386 3300048911 Ga0496108_0017772 Ga0496108_0017772_1407_1955 178
387 3300048911 Ga0496108_0074145 Ga0496108_0074145_641_1192 178
388 3300048911 Ga0496108_0498443 Ga0496108_0498443_247_795 178
389 3300048912 Ga0496109_0002480 Ga0496109_0002480_10610_11158 178
390 3300048912 Ga0496109_0259030 Ga0496109_0259030_282_830 178
391 3300048912 Ga0496109_0791076 Ga0496109_0791076_151_702 178
392 3300048913 Ga0496110_0272531 Ga0496110_0272531_237_785 178
393 3300048913 Ga0496110_0318439 Ga0496110_0318439_657_1208 178
394 3300048914 Ga0496111_0018470 Ga0496111_0018470_529_1077 178
395 3300048915 Ga0496112_0062637 Ga0496112_0062637_299_850 178
396 3300048915 Ga0496112_0797206 Ga0496112_0797206_106_663 178
397 3300048916 Ga0496113_0352820 Ga0496113_0352820_248_796 178
398 3300048916 Ga0496113_0364687 Ga0496113_0364687_241_792 178
399 3300048916 Ga0496113_0884574 Ga0496113_0884574_50_607 178
400 3300048917 Ga0496114_0084964 Ga0496114_0084964_1747_2301 178
401 3300048917 Ga0496114_0164022 Ga0496114_0164022_969_1517 178
402 3300048917 Ga0496114_0324283 Ga0496114_0324283_45_593 178
403 3300048918 Ga0496115_0031246 Ga0496115_0031246_1553_2101 178
404 3300048918 Ga0496115_0294146 Ga0496115_0294146_322_870 178
405 3300049568 Ga0501031_0109728 Ga0501031_0109728_137_709 178
406 3300049587 Ga0501071_0091668 Ga0501071_0091668_633_1205 178
407 3300049824 Ga0501045_0056450 Ga0501045_0056450_113_685 178
408 3300050512 nmdc:mga0n895_610042_c1 nmdc:mga0n895_610042_c1_459_1025 178
409 3300050512 nmdc:mga0n895_64234_c1 nmdc:mga0n895_64234_c1_1835_2383 178
410 3300050513 nmdc:mga0rr50_212011_c1 nmdc:mga0rr50_212011_c1_683_1231 178
411 3300053083 Ga0495655_0150883 Ga0495655_0150883_113_661 178
412 3300053084 Ga0495595_0111604 Ga0495595_0111604_295_843 178
413 3300053085 Ga0495619_0394848 Ga0495619_0394848_170_721 178
414 3300061719 Ga0466962_0065206 Ga0466962_0065206_355_927 178
415 3300006847 Ga0075431_100405111 Ga0075431_1004051112 179
416 3300009147 Ga0114129_10018938 Ga0114129_1001893810 179
417 3300037466 Ga0395898_0264603 Ga0395898_0264603_716_1276 179
418 3300048915 Ga0496112_0017461 Ga0496112_0017461_515_1081 179
419 3300050510 nmdc:mga06r32_323513_c1 nmdc:mga06r32_323513_c1_650_1255 179
420 3300005937 Ga0081455_10004771 Ga0081455_1000477110 180
421 3300005983 Ga0081540_1008816 Ga0081540_10088167 180
422 3300006844 Ga0075428_101248107 Ga0075428_1012481072 180
423 3300006847 Ga0075431_100491245 Ga0075431_1004912453 180
424 3300006852 Ga0075433_10076646 Ga0075433_100766463 180
425 3300006880 Ga0075429_100754254 Ga0075429_1007542542 180
426 3300006914 Ga0075436_100073703 Ga0075436_1000737032 180
427 3300009147 Ga0114129_11269764 Ga0114129_112697642 180
428 3300025935 Ga0207709_10479288 Ga0207709_104792882 180
429 3300037471 Ga0395905_0110005 Ga0395905_0110005_1952_2509 180
430 3300038443 Ga0395901_1001733 Ga0395901_1001733_26_583 180
431 3300041511 Ga0451855_0177353 Ga0451855_0177353_258_821 180
432 3300049588 Ga0501072_0182551 Ga0501072_0182551_1068_1643 180
433 3300050507 nmdc:mga05p37_136458_c1 nmdc:mga05p37_136458_c1_1057_1614 180
434 3300050510 nmdc:mga06r32_861657_c1 nmdc:mga06r32_861657_c1_101_658 180
435 3300050512 nmdc:mga0n895_49545_c1 nmdc:mga0n895_49545_c1_1416_1973 180
436 3300044706 Ga0466964_0005225 Ga0466964_0005225_500_1060 181
437 3300025928 Ga0207700_10688804 Ga0207700_106888042 183
438 3300046477 Ga0495664_0294987 Ga0495664_0294987_161_736 183
439 3300046516 Ga0495628_0439861 Ga0495628_0439861_135_710 183
440 3300046543 Ga0495645_0374668 Ga0495645_0374668_65_640 183
441 3300053077 Ga0495601_0089704 Ga0495601_0089704_753_1328 183
442 3300005434 Ga0070709_10017185 Ga0070709_100171854 184
443 3300005435 Ga0070714_100048810 Ga0070714_1000488104 184
444 3300005435 Ga0070714_100478709 Ga0070714_1004787092 184
445 3300005436 Ga0070713_100561668 Ga0070713_1005616681 184
446 3300005440 Ga0070705_100221036 Ga0070705_1002210362 184
447 3300005545 Ga0070695_100912868 Ga0070695_1009128681 184
448 3300005549 Ga0070704_100477060 Ga0070704_1004770602 184
449 3300005614 Ga0068856_101108919 Ga0068856_1011089191 184
450 3300006028 Ga0070717_10062703 Ga0070717_100627033 184
451 3300006028 Ga0070717_10128751 Ga0070717_101287512 184
452 3300006163 Ga0070715_10005193 Ga0070715_100051933 184
453 3300009101 Ga0105247_10216147 Ga0105247_102161472 184
454 3300013296 Ga0157374_10007471 Ga0157374_100074714 184
455 3300025905 Ga0207685_10001868 Ga0207685_100018683 184
456 3300025906 Ga0207699_10047193 Ga0207699_100471934 184
457 3300025915 Ga0207693_10067027 Ga0207693_100670273 184
458 3300025916 Ga0207663_10019197 Ga0207663_100191973 184
459 3300025928 Ga0207700_10017213 Ga0207700_100172132 184
460 3300025928 Ga0207700_10030611 Ga0207700_100306112 184
461 3300025929 Ga0207664_10023006 Ga0207664_100230065 184
462 3300025929 Ga0207664_10145755 Ga0207664_101457553 184
463 3300025939 Ga0207665_10000562 Ga0207665_100005627 184
464 3300046455 Ga0495603_0127388 Ga0495603_0127388_432_1037 184
465 3300048903 Ga0496100_0034400 Ga0496100_0034400_698_1267 184
466 3300048904 Ga0496101_0019494 Ga0496101_0019494_2591_3160 184
467 3300048908 Ga0496105_0014915 Ga0496105_0014915_3814_4383 184
468 3300048909 Ga0496106_0011574 Ga0496106_0011574_3784_4353 184
469 3300048910 Ga0496107_0001749 Ga0496107_0001749_893_1462 184
470 3300048911 Ga0496108_0015170 Ga0496108_0015170_614_1183 184
471 3300048913 Ga0496110_0076371 Ga0496110_0076371_180_749 184
472 3300048917 Ga0496114_0011850 Ga0496114_0011850_4445_5014 184
473 3300048918 Ga0496115_0034215 Ga0496115_0034215_2749_3318 184
474 3300050513 nmdc:mga0rr50_371358_c1 nmdc:mga0rr50_371358_c1_34_603 184
475 3300001991 JGI24743J22301_10093368 JGI24743J22301_100933681 185
476 3300002077 JGI24744J21845_10000511 JGI24744J21845_100005116 185
477 3300005334 Ga0068869_100598631 Ga0068869_1005986312 185
478 3300005337 Ga0070682_100085799 Ga0070682_1000857993 185
479 3300005338 Ga0068868_100177641 Ga0068868_1001776412 185
480 3300005339 Ga0070660_100031447 Ga0070660_1000314472 185
481 3300005340 Ga0070689_100016020 Ga0070689_1000160201 185
482 3300005341 Ga0070691_10406997 Ga0070691_104069971 185
483 3300005345 Ga0070692_10004479 Ga0070692_100044795 185
484 3300005353 Ga0070669_100148325 Ga0070669_1001483253 185
485 3300005354 Ga0070675_100259737 Ga0070675_1002597373 185
486 3300005356 Ga0070674_100042239 Ga0070674_1000422394 185
487 3300005365 Ga0070688_100157051 Ga0070688_1001570512 185
488 3300005366 Ga0070659_100103061 Ga0070659_1001030613 185
489 3300005435 Ga0070714_100287284 Ga0070714_1002872842 185
490 3300005437 Ga0070710_10004053 Ga0070710_100040534 185
491 3300005438 Ga0070701_10002145 Ga0070701_100021456 185
492 3300005439 Ga0070711_100002495 Ga0070711_1000024958 185
493 3300005440 Ga0070705_100226176 Ga0070705_1002261761 185
494 3300005441 Ga0070700_100003239 Ga0070700_1000032394 185
495 3300005445 Ga0070708_101085514 Ga0070708_1010855141 185
496 3300005456 Ga0070678_100003173 Ga0070678_1000031734 185
497 3300005459 Ga0068867_100000290 Ga0068867_1000002905 185
498 3300005466 Ga0070685_10004004 Ga0070685_100040043 185
499 3300005468 Ga0070707_100001362 Ga0070707_10000136214 185
500 3300005471 Ga0070698_100191412 Ga0070698_1001914123 185
501 3300005518 Ga0070699_100029009 Ga0070699_1000290092 185
502 3300005539 Ga0068853_100022345 Ga0068853_1000223453 185
503 3300005543 Ga0070672_100020180 Ga0070672_1000201802 185
504 3300005544 Ga0070686_100003179 Ga0070686_1000031798 185
505 3300005546 Ga0070696_100019107 Ga0070696_1000191071 185
506 3300005547 Ga0070693_100007413 Ga0070693_1000074134 185
507 3300005548 Ga0070665_100490541 Ga0070665_1004905412 185
508 3300005549 Ga0070704_100014360 Ga0070704_1000143604 185
509 3300005578 Ga0068854_100372974 Ga0068854_1003729743 185
510 3300005614 Ga0068856_100002162 Ga0068856_10000216211 185
511 3300005615 Ga0070702_100001183 Ga0070702_1000011838 185
512 3300005718 Ga0068866_10000154 Ga0068866_100001544 185
513 3300006175 Ga0070712_100017737 Ga0070712_1000177374 185
514 3300006237 Ga0097621_100071204 Ga0097621_1000712042 185
515 3300006358 Ga0068871_100028194 Ga0068871_1000281943 185
516 3300006881 Ga0068865_100004791 Ga0068865_1000047916 185
517 3300009093 Ga0105240_10171175 Ga0105240_101711753 185
518 3300009098 Ga0105245_10118169 Ga0105245_101181693 185
519 3300009098 Ga0105245_10454261 Ga0105245_104542613 185
520 3300009101 Ga0105247_10039396 Ga0105247_100393963 185
521 3300009148 Ga0105243_10010311 Ga0105243_100103115 185
522 3300009174 Ga0105241_10037245 Ga0105241_100372452 185
523 3300009176 Ga0105242_10012830 Ga0105242_100128306 185
524 3300009177 Ga0105248_10060688 Ga0105248_100606884 185
525 3300009551 Ga0105238_10527063 Ga0105238_105270631 185
526 3300009553 Ga0105249_10004222 Ga0105249_100042229 185
527 3300010375 Ga0105239_10001224 Ga0105239_100012243 185
528 3300013296 Ga0157374_10036408 Ga0157374_100364084 185
529 3300013296 Ga0157374_10638797 Ga0157374_106387972 185
530 3300013297 Ga0157378_10010246 Ga0157378_100102466 185
531 3300013306 Ga0163162_10073924 Ga0163162_100739244 185
532 3300013308 Ga0157375_10123928 Ga0157375_101239282 185
533 3300013308 Ga0157375_10210488 Ga0157375_102104883 185
534 3300014325 Ga0163163_10480721 Ga0163163_104807213 185
535 3300014745 Ga0157377_10001363 Ga0157377_1000136310 185
536 3300014968 Ga0157379_10851134 Ga0157379_108511342 185
537 3300014969 Ga0157376_10295804 Ga0157376_102958043 185
538 3300014969 Ga0157376_11971788 Ga0157376_119717881 185
539 3300017792 Ga0163161_10651930 Ga0163161_106519302 185
540 3300025898 Ga0207692_10030726 Ga0207692_100307263 185
541 3300025899 Ga0207642_10010716 Ga0207642_100107163 185
542 3300025900 Ga0207710_10067612 Ga0207710_100676123 185
543 3300025901 Ga0207688_10218706 Ga0207688_102187062 185
544 3300025903 Ga0207680_10303086 Ga0207680_103030862 185
545 3300025910 Ga0207684_10174070 Ga0207684_101740702 185
546 3300025911 Ga0207654_10196745 Ga0207654_101967452 185
547 3300025915 Ga0207693_10000499 Ga0207693_1000049910 185
548 3300025916 Ga0207663_10353975 Ga0207663_103539752 185
549 3300025917 Ga0207660_10282331 Ga0207660_102823312 185
550 3300025918 Ga0207662_10008232 Ga0207662_100082324 185
551 3300025919 Ga0207657_10003301 Ga0207657_1000330116 185
552 3300025922 Ga0207646_10001072 Ga0207646_1000107214 185
553 3300025923 Ga0207681_10051957 Ga0207681_100519572 185
554 3300025924 Ga0207694_10580544 Ga0207694_105805442 185
555 3300025926 Ga0207659_10094931 Ga0207659_100949313 185
556 3300025927 Ga0207687_10043392 Ga0207687_100433923 185
557 3300025929 Ga0207664_10240634 Ga0207664_102406342 185
558 3300025932 Ga0207690_10229136 Ga0207690_102291363 185
559 3300025933 Ga0207706_10243375 Ga0207706_102433752 185
560 3300025934 Ga0207686_10008930 Ga0207686_100089305 185
561 3300025935 Ga0207709_10002593 Ga0207709_1000259311 185
562 3300025936 Ga0207670_10053086 Ga0207670_100530862 185
563 3300025937 Ga0207669_10017923 Ga0207669_100179233 185
564 3300025938 Ga0207704_10002157 Ga0207704_100021576 185
565 3300025939 Ga0207665_10216066 Ga0207665_102160662 185
566 3300025940 Ga0207691_10023300 Ga0207691_100233005 185
567 3300025941 Ga0207711_10184345 Ga0207711_101843452 185
568 3300025961 Ga0207712_10004332 Ga0207712_100043325 185
569 3300025986 Ga0207658_10381825 Ga0207658_103818253 185
570 3300026023 Ga0207677_10019726 Ga0207677_100197263 185
571 3300026041 Ga0207639_10045621 Ga0207639_100456213 185
572 3300026067 Ga0207678_10297588 Ga0207678_102975882 185
573 3300026075 Ga0207708_10000434 Ga0207708_1000043426 185
574 3300026078 Ga0207702_10040757 Ga0207702_100407573 185
575 3300026089 Ga0207648_10002641 Ga0207648_100026412 185
576 3300026121 Ga0207683_10006588 Ga0207683_100065887 185
577 3300026142 Ga0207698_10022867 Ga0207698_100228673 185
578 3300028379 Ga0268266_10103613 Ga0268266_101036132 185
579 3300028380 Ga0268265_10069817 Ga0268265_100698173 185
580 3300037312 Ga0395899_0022282 Ga0395899_0022282_806_1363 185
581 3300037312 Ga0395899_0022398 Ga0395899_0022398_705_1262 185
582 3300037418 Ga0395900_0000528 Ga0395900_0000528_9487_10044 185
583 3300037418 Ga0395900_0012327 Ga0395900_0012327_2214_2771 185
584 3300037418 Ga0395900_0020618 Ga0395900_0020618_662_1219 185
585 3300037418 Ga0395900_0024631 Ga0395900_0024631_3320_3883 185
586 3300037466 Ga0395898_0002139 Ga0395898_0002139_20258_20815 185
587 3300037466 Ga0395898_0008588 Ga0395898_0008588_9726_10283 185
588 3300037466 Ga0395898_0009600 Ga0395898_0009600_7265_7822 185
589 3300037466 Ga0395898_0010892 Ga0395898_0010892_7253_7816 185
590 3300037471 Ga0395905_0000661 Ga0395905_0000661_6993_7550 185
591 3300037471 Ga0395905_0005716 Ga0395905_0005716_5254_5811 185
592 3300037471 Ga0395905_0023587 Ga0395905_0023587_4423_4986 185
593 3300037471 Ga0395905_0033887 Ga0395905_0033887_846_1403 185
594 3300038443 Ga0395901_0001602 Ga0395901_0001602_19908_20465 185
595 3300038443 Ga0395901_0001739 Ga0395901_0001739_19851_20408 185
596 3300038443 Ga0395901_0003765 Ga0395901_0003765_9817_10374 185
597 3300038443 Ga0395901_0538128 Ga0395901_0538128_56_613 185
598 3300041512 Ga0451853_2407108 Ga0451853_2407108_102_659 185
599 3300044694 Ga0466963_0055679 Ga0466963_0055679_33_653 185
600 3300044719 Ga0466971_0005123 Ga0466971_0005123_5029_5649 185
601 3300044842 Ga0466957_0398821 Ga0466957_0398821_205_825 185
602 3300045836 Ga0466958_0023339 Ga0466958_0023339_119_739 185
603 3300045976 Ga0466967_0149725 Ga0466967_0149725_261_866 185
604 3300046473 Ga0495582_0017452 Ga0495582_0017452_1963_2520 185
605 3300046492 Ga0495585_0177735 Ga0495585_0177735_284_841 185
606 3300046500 Ga0495596_0075480 Ga0495596_0075480_342_899 185
607 3300046525 Ga0495663_0134772 Ga0495663_0134772_122_679 185
608 3300046528 Ga0495642_0063768 Ga0495642_0063768_608_1165 185
609 3300046539 Ga0495621_0158474 Ga0495621_0158474_113_670 185
610 3300046615 Ga0495656_0067924 Ga0495656_0067924_315_872 185
611 3300046648 Ga0495611_0090748 Ga0495611_0090748_781_1338 185
612 3300046674 Ga0495588_0348885 Ga0495588_0348885_147_704 185
613 3300046683 Ga0495658_0269902 Ga0495658_0269902_21_578 185
614 3300046691 Ga0495670_0121638 Ga0495670_0121638_467_1024 185
615 3300046794 Ga0495589_0003474 Ga0495589_0003474_3124_3681 185
616 3300047315 Ga0495581_0006841 Ga0495581_0006841_3131_3688 185
617 3300048089 Ga0495614_0354557 Ga0495614_0354557_28_585 185
618 3300048904 Ga0496101_0004691 Ga0496101_0004691_4814_5371 185
619 3300048905 Ga0496102_0001550 Ga0496102_0001550_16240_16797 185
620 3300048905 Ga0496102_0370947 Ga0496102_0370947_176_733 185
621 3300048906 Ga0496103_0006198 Ga0496103_0006198_2079_2636 185
622 3300048907 Ga0496104_0073268 Ga0496104_0073268_463_1020 185
623 3300048907 Ga0496104_0260432 Ga0496104_0260432_495_1052 185
624 3300048908 Ga0496105_0262801 Ga0496105_0262801_361_918 185
625 3300048909 Ga0496106_0019910 Ga0496106_0019910_481_1038 185
626 3300048910 Ga0496107_0006312 Ga0496107_0006312_5393_5950 185
627 3300048911 Ga0496108_0083422 Ga0496108_0083422_479_1036 185
628 3300048911 Ga0496108_0156093 Ga0496108_0156093_640_1197 185
629 3300048912 Ga0496109_0044381 Ga0496109_0044381_568_1125 185
630 3300048912 Ga0496109_0263528 Ga0496109_0263528_323_880 185
631 3300048913 Ga0496110_0014207 Ga0496110_0014207_403_960 185
632 3300048914 Ga0496111_0001848 Ga0496111_0001848_6734_7291 185
633 3300048915 Ga0496112_0056358 Ga0496112_0056358_390_947 185
634 3300048916 Ga0496113_0231003 Ga0496113_0231003_203_760 185
635 3300048917 Ga0496114_0007714 Ga0496114_0007714_6784_7341 185
636 3300048918 Ga0496115_0001849 Ga0496115_0001849_2373_2930 185
637 3300061719 Ga0466962_0004154 Ga0466962_0004154_1252_1872 185

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00499

Oxidored_q3

NADH-ubiquinone/plastoquinone oxidoreductase chain 6

29

175

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6k6k-assembly1.cif.gz_A the crystal structure of light-driven cyanobacterial chloride importer (n63a/p118a) mastigocladopsis repens 0.9118 11 57
6xl3-assembly1.cif.gz_A mastigocladopsis repens rhodopsin chloride pump 0.9044 11 57
7zoy-assembly1.cif.gz_A crystal structure of synechocystis halorhodopsin (syhr), so4-bound form, ground state 0.8983 11 57
6zkg-assembly1.cif.gz_K complex i with nadh, closed 0.8965 14 84
7wg5-assembly1.cif.gz_E cyclic electron transport supercomplex ndh-psi from arabidopsis 0.8923 10 83
ID Description Score Start End Superfamily
1mftB00 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Immunoglobulin FC, subunit C 0.9415 11 57 1.20.5.420
af_P81309_1_82_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.903 16 83 1.10.287.3510
af_Q57879_1_79_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8897 15 85 1.10.287.3510
6humE00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8663 11 83 1.10.287.3510
af_P18934_2_96_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8602 11 83 1.10.287.3510
ID Description Score Start End GO Terms
AF-A0A4R5QBW9-F1-model_v4 Uncharacterized protein 0.889 11 83 GO:0016020
AF-A0A2K2VGL9-F1-model_v4 NADH-quinone oxidoreductase subunit J 0.7644 6 93 GO:0008137
GO:0016020
AF-A0A2N2LBR2-F1-model_v4 Hydrogenase 0.7603 15 91 GO:0005886
AF-T2IZZ7-F1-model_v4 NADH-quinone oxidoreductase subunit J (EC 7.1.1.-) 0.7278 7 103 GO:0005886
GO:0008137
GO:0048038
GO:1902495
AF-A0A257WMP9-F1-model_v4 NADH-quinone oxidoreductase subunit J (EC 7.1.1.-) 0.723 11 117 GO:0005886
GO:0008137
GO:0048038

Feature Viewer

pLDDT pTM Quality
79.25 0.5 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map