F471356

General Info

Members Datasets Scaffolds Average Seq Length
636 326 1272 204

Family's Representative Sequence

Representative Sequence 3300035725|Ga0373947_0108768|Ga0373947_0108768_549_1220
Length 223
Sequence MYIQTIARREPAGAPERTRMTIRLHRGDLPDLARYTGAVAIDTETMGLDLRRDRLCVVQLSPGDGSADVVQIPAGARDAPNIKALLADPDRVKIFHFARFDIGSLFNAFGVMPQPVYCTKIASRLIRTYTDKHGLKDLTREVLGVDLSKQQQSSDWGAGELTDAQVAYAASDVLHLHALREKLDVMLAREGRSGLAEACFRFLPDRVRLDLAGWAAEDIFAHS

Samples

Sample ID Description Type Environment
1 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
86 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
114 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
115 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
172 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
174 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
175 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
176 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
177 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
178 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
179 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
180 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
181 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
182 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
183 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
185 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
186 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
187 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
188 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
189 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
190 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
191 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
192 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
193 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
194 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
195 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
196 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
197 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
198 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
199 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
202 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
203 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
204 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
205 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
206 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
207 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
208 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
209 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
210 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
211 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
212 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
213 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
214 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
215 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
216 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
217 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
218 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
219 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
220 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
221 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
222 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
223 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
224 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
225 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
226 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
227 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
228 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
229 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
230 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
231 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
232 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
233 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
234 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
235 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
236 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
237 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
238 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
239 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
240 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
241 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
242 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
243 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
244 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
245 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
246 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
247 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
248 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
249 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
250 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
251 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
252 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
253 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
254 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
255 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
256 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
257 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
258 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
259 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
260 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
261 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
262 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
263 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
264 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
265 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
266 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
267 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
268 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
269 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
270 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
271 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
272 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
273 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
274 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
275 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
276 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
277 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
278 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
279 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
280 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
281 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
282 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
283 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
284 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
285 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
286 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
287 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
296 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
297 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
298 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
299 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
300 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
301 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
302 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
303 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
304 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
306 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
307 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
308 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
309 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
310 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
311 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
312 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
313 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
314 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
315 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
316 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
317 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
318 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
319 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
320 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
321 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
322 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
323 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
324 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
325 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
326 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.37
Metatranscriptomes 0.63
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.89
Nodule 0
Rhizoplane 7.08
Rhizosphere 89.62
Stem 0
Stem Tuber 0
Unclassified 0.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373947_0108768 3300035725 Bacteria 1749
2 JGI24743J22301_10002841 3300001991 Bacteria 2666
3 JGI24748J21848_1003646 3300002074 Bacteria 1762
4 JGI24034J26672_10003107 3300002239 Bacteria 2308
5 JGI24742J22300_10003804 3300002244 Bacteria 2453
6 JGI24751J29686_10057246 3300002459 Bacteria 803
7 JGI25405J52794_10013046 3300003911 Bacteria 1607
8 Ga0070683_100125993 3300005329 Bacteria 2421
9 Ga0070690_100020158 3300005330 Bacteria 4059
10 Ga0070670_101012216 3300005331 Bacteria 756
11 Ga0068869_100021486 3300005334 Bacteria 4440
12 Ga0070666_10277517 3300005335 Bacteria 1191
13 Ga0070680_100030364 3300005336 Bacteria 4341
14 Ga0070680_100200918 3300005336 Bacteria 1681
15 Ga0070680_100963232 3300005336 Bacteria 737
16 Ga0070682_100100958 3300005337 Bacteria 1904
17 Ga0070660_100138276 3300005339 Bacteria 1953
18 Ga0070660_100274609 3300005339 Bacteria 1378
19 Ga0070689_100043073 3300005340 Bacteria 3467
20 Ga0070689_100069805 3300005340 Bacteria 2742
21 Ga0070689_100934922 3300005340 Bacteria 768
22 Ga0070691_10100586 3300005341 Bacteria 1435
23 Ga0070661_100286817 3300005344 Bacteria 1278
24 Ga0070669_100047588 3300005353 Bacteria 3129
25 Ga0070675_100015993 3300005354 Bacteria 5945
26 Ga0070671_100212251 3300005355 Bacteria 1642
27 Ga0070674_100106432 3300005356 Bacteria 2052
28 Ga0070673_100020247 3300005364 Bacteria 4795
29 Ga0070673_100102811 3300005364 Bacteria 2356
30 Ga0070659_100046457 3300005366 Bacteria 3403
31 Ga0070659_100062721 3300005366 Bacteria 2939
32 Ga0070667_100046241 3300005367 Bacteria 3661
33 Ga0070709_10002356 3300005434 Bacteria 10237
34 Ga0070714_100000516 3300005435 Bacteria 28020
35 Ga0070714_100032390 3300005435 Bacteria 4362
36 Ga0070714_100225140 3300005435 Bacteria 1726
37 Ga0070714_100305241 3300005435 Bacteria 1485
38 Ga0070713_100000228 3300005436 Bacteria 37335
39 Ga0070713_100042484 3300005436 Bacteria 3710
40 Ga0070713_100151159 3300005436 Bacteria 2066
41 Ga0070713_100420863 3300005436 Bacteria 1250
42 Ga0070713_100799543 3300005436 Bacteria 904
43 Ga0070710_10000438 3300005437 Bacteria 19522
44 Ga0070710_10027608 3300005437 Bacteria 3029
45 Ga0070710_10041742 3300005437 Bacteria 2534
46 Ga0070711_100000998 3300005439 Bacteria 15007
47 Ga0070711_100022504 3300005439 Bacteria 4086
48 Ga0070711_100087626 3300005439 Bacteria 2235
49 Ga0070711_100309712 3300005439 Bacteria 1258
50 Ga0070705_100071243 3300005440 Bacteria 2102
51 Ga0070700_100015500 3300005441 Bacteria 4323
52 Ga0070694_100179707 3300005444 Bacteria 1564
53 Ga0070708_100170495 3300005445 Bacteria 2032
54 Ga0070663_100043993 3300005455 Bacteria 3145
55 Ga0070678_100038784 3300005456 Bacteria 3356
56 Ga0070678_100077082 3300005456 Bacteria 2513
57 Ga0070662_100715253 3300005457 Bacteria 848
58 Ga0070681_10040092 3300005458 Bacteria 4695
59 Ga0070681_10133037 3300005458 Bacteria 2419
60 Ga0070681_10176764 3300005458 Bacteria 2057
61 Ga0070685_10098872 3300005466 Bacteria 1779
62 Ga0070699_100001660 3300005518 Bacteria 20314
63 Ga0070699_100107612 3300005518 Bacteria 2446
64 Ga0070679_100418344 3300005530 Bacteria 1286
65 Ga0070684_100096214 3300005535 Bacteria 2639
66 Ga0070684_100523915 3300005535 Bacteria 1099
67 Ga0070684_100976772 3300005535 Bacteria 794
68 Ga0068853_100031218 3300005539 Bacteria 4505
69 Ga0070672_100031508 3300005543 Bacteria 3991
70 Ga0070686_100343805 3300005544 Bacteria 1119
71 Ga0070686_100367767 3300005544 Bacteria 1085
72 Ga0070696_100069040 3300005546 Bacteria 2482
73 Ga0070696_100538989 3300005546 Bacteria 933
74 Ga0070693_100015829 3300005547 Bacteria 3892
75 Ga0070704_100191795 3300005549 Bacteria 1643
76 Ga0068855_100087918 3300005563 Bacteria 3590
77 Ga0068855_100687574 3300005563 Bacteria 1096
78 Ga0070664_100198971 3300005564 Bacteria 1787
79 Ga0068857_100104138 3300005577 Bacteria 2548
80 Ga0068856_100063610 3300005614 Bacteria 3645
81 Ga0068856_100145997 3300005614 Bacteria 2373
82 Ga0070702_100010590 3300005615 Bacteria 4549
83 Ga0068852_100028980 3300005616 Bacteria 4540
84 Ga0068859_100054914 3300005617 Bacteria 4007
85 Ga0068864_100029107 3300005618 Bacteria 4674
86 Ga0068866_10033138 3300005718 Bacteria 2503
87 Ga0068861_100548052 3300005719 Bacteria 1053
88 Ga0068870_10039220 3300005840 Bacteria 2450
89 Ga0068863_100022637 3300005841 Bacteria 6001
90 Ga0068863_100034649 3300005841 Bacteria 4808
91 Ga0068858_100520295 3300005842 Bacteria 1150
92 Ga0068860_100040135 3300005843 Bacteria 4475
93 Ga0081455_10005070 3300005937 Bacteria 14543
94 Ga0081455_10066301 3300005937 Bacteria 3016
95 Ga0081455_10094519 3300005937 Bacteria 2414
96 Ga0081455_10216197 3300005937 Bacteria 1424
97 Ga0081538_10043320 3300005981 Bacteria 2828
98 Ga0081538_10051969 3300005981 Bacteria 2454
99 Ga0081540_1002980 3300005983 Bacteria 13569
100 Ga0081540_1013731 3300005983 Bacteria 5249
101 Ga0081540_1039921 3300005983 Bacteria 2454
102 Ga0070717_10001451 3300006028 Bacteria 16359
103 Ga0070717_10037846 3300006028 Bacteria 3918
104 Ga0070717_10254847 3300006028 Bacteria 1551
105 Ga0070717_10879504 3300006028 Bacteria 816
106 Ga0075365_10169317 3300006038 Bacteria 1524
107 Ga0075365_10360169 3300006038 Bacteria 1025
108 Ga0075365_10555440 3300006038 Bacteria 812
109 Ga0075364_10124450 3300006051 Bacteria 1727
110 Ga0070715_10007582 3300006163 Bacteria 3741
111 Ga0070715_10351872 3300006163 Bacteria 805
112 Ga0070716_100002431 3300006173 Bacteria 8578
113 Ga0070712_100005438 3300006175 Bacteria 7888
114 Ga0070712_100021532 3300006175 Bacteria 4235
115 Ga0070712_100033200 3300006175 Bacteria 3490
116 Ga0070712_100131046 3300006175 Bacteria 1900
117 Ga0070712_100324098 3300006175 Bacteria 1253
118 Ga0075362_10028795 3300006177 Bacteria 2389
119 Ga0097621_100239957 3300006237 Bacteria 1584
120 Ga0068871_100003229 3300006358 Bacteria 11175
121 Ga0068871_100034078 3300006358 Bacteria 4038
122 Ga0075428_100035411 3300006844 Bacteria 5503
123 Ga0075428_100130551 3300006844 Bacteria 2733
124 Ga0075428_100341916 3300006844 Bacteria 1606
125 Ga0075428_100456888 3300006844 Bacteria 1368
126 Ga0075430_100085006 3300006846 Bacteria 2649
127 Ga0075430_100114182 3300006846 Bacteria 2251
128 Ga0075430_100733612 3300006846 Bacteria 814
129 Ga0075431_100089172 3300006847 Bacteria 3183
130 Ga0075431_100126853 3300006847 Bacteria 2633
131 Ga0075431_100209340 3300006847 Bacteria 1992
132 Ga0075431_100241399 3300006847 Bacteria 1838
133 Ga0075431_100261362 3300006847 Bacteria 1756
134 Ga0075431_100622792 3300006847 Bacteria 1061
135 Ga0075433_10059560 3300006852 Bacteria 3341
136 Ga0075433_10165094 3300006852 Bacteria 1971
137 Ga0075433_10573134 3300006852 Bacteria 992
138 Ga0075434_100013888 3300006871 Bacteria 7684
139 Ga0075434_100025533 3300006871 Bacteria 5780
140 Ga0075434_100028232 3300006871 Bacteria 5511
141 Ga0075434_100037650 3300006871 Bacteria 4788
142 Ga0075434_100200178 3300006871 Bacteria 2017
143 Ga0075429_100019927 3300006880 Bacteria 5816
144 Ga0075429_100590517 3300006880 Bacteria 973
145 Ga0068865_100055931 3300006881 Bacteria 2747
146 Ga0075436_100054731 3300006914 Bacteria 2755
147 Ga0075436_100056203 3300006914 Bacteria 2719
148 Ga0075436_100062547 3300006914 Bacteria 2572
149 Ga0075436_100149168 3300006914 Bacteria 1645
150 Ga0097620_100054916 3300006931 Bacteria 4007
151 Ga0075435_100075849 3300007076 Bacteria 2754
152 Ga0075435_100257310 3300007076 Bacteria 1487
153 Ga0075435_100334873 3300007076 Bacteria 1296
154 Ga0099795_10013769 3300007788 Bacteria 2492
155 Ga0099795_10038409 3300007788 Bacteria 1690
156 Ga0105244_10135109 3300009036 Bacteria 1189
157 Ga0105240_10008453 3300009093 Bacteria 14724
158 Ga0111539_10024989 3300009094 Bacteria 7320
159 Ga0111539_10046220 3300009094 Bacteria 5208
160 Ga0111539_10096871 3300009094 Bacteria 3465
161 Ga0111539_10611570 3300009094 Bacteria 1269
162 Ga0105245_10192033 3300009098 Bacteria 1956
163 Ga0105247_10010607 3300009101 Bacteria 5565
164 Ga0114129_10000935 3300009147 Bacteria 38153
165 Ga0114129_10004270 3300009147 Bacteria 20184
166 Ga0114129_10592075 3300009147 Bacteria 1438
167 Ga0114129_11168683 3300009147 Bacteria 960
168 Ga0105243_10021908 3300009148 Bacteria 4853
169 Ga0105243_10353871 3300009148 Bacteria 1349
170 Ga0105242_10396208 3300009176 Bacteria 1287
171 Ga0105237_10263250 3300009545 Bacteria 1727
172 Ga0105237_11474697 3300009545 Bacteria 687
173 Ga0105249_10111789 3300009553 Bacteria 2583
174 Ga0099796_10001237 3300010159 Bacteria 4998
175 Ga0099796_10020911 3300010159 Bacteria 2007
176 Ga0105239_10251176 3300010375 Bacteria 1986
177 Ga0105246_10921805 3300011119 Bacteria 785
178 Ga0157371_10041979 3300013102 Bacteria 3262
179 Ga0157370_10015656 3300013104 Bacteria 7703
180 Ga0157370_10039908 3300013104 Bacteria 4535
181 Ga0157378_10045512 3300013297 Bacteria 3899
182 Ga0163162_10352622 3300013306 Bacteria 1604
183 Ga0163162_10713452 3300013306 Bacteria 1124
184 Ga0157375_10157997 3300013308 Bacteria 2407
185 Ga0157375_11502162 3300013308 Bacteria 795
186 Ga0163163_10033817 3300014325 Bacteria 4948
187 Ga0163163_10174555 3300014325 Bacteria 2195
188 Ga0182008_10282054 3300014497 Unclassified 865
189 Ga0157377_10001219 3300014745 Bacteria 10969
190 Ga0157379_10099971 3300014968 Bacteria 2604
191 Ga0157379_10991284 3300014968 Bacteria 801
192 Ga0157376_10048866 3300014969 Bacteria 3502
193 Ga0157376_10887020 3300014969 Bacteria 909
194 Ga0163161_10041464 3300017792 Bacteria 3307
195 Ga0206356_10872937 3300020070 Bacteria 3160
196 Ga0206354_10703793 3300020081 Bacteria 845
197 Ga0206353_10634153 3300020082 Bacteria 813
198 Ga0213876_10119202 3300021384 Bacteria 1401
199 Ga0213876_10216241 3300021384 Bacteria 1019
200 Ga0224572_1003288 3300024225 Bacteria 2717
201 Ga0224572_1032726 3300024225 Bacteria 990
202 Ga0228598_1000571 3300024227 Bacteria 7717
203 Ga0228598_1019546 3300024227 Bacteria 1335
204 Ga0228598_1023532 3300024227 Bacteria 1212
205 Ga0207692_10002828 3300025898 Bacteria 6702
206 Ga0207710_10244645 3300025900 Bacteria 896
207 Ga0207688_10000659 3300025901 Bacteria 17029
208 Ga0207685_10005621 3300025905 Bacteria 3332
209 Ga0207699_10010235 3300025906 Bacteria 4698
210 Ga0207645_10021226 3300025907 Bacteria 4237
211 Ga0207643_10002609 3300025908 Bacteria 9751
212 Ga0207684_10005466 3300025910 Bacteria 11712
213 Ga0207654_10133868 3300025911 Bacteria 1572
214 Ga0207707_10021522 3300025912 Bacteria 5636
215 Ga0207707_10082233 3300025912 Bacteria 2811
216 Ga0207707_10123221 3300025912 Bacteria 2267
217 Ga0207707_10490052 3300025912 Bacteria 1049
218 Ga0207695_10110239 3300025913 Bacteria 2733
219 Ga0207671_10255580 3300025914 Bacteria 1378
220 Ga0207693_10003700 3300025915 Bacteria 13032
221 Ga0207693_10009265 3300025915 Bacteria 8037
222 Ga0207693_10009485 3300025915 Bacteria 7927
223 Ga0207693_10018894 3300025915 Bacteria 5487
224 Ga0207693_10019210 3300025915 Bacteria 5438
225 Ga0207693_10079652 3300025915 Bacteria 2564
226 Ga0207663_10029311 3300025916 Bacteria 3231
227 Ga0207663_10079166 3300025916 Bacteria 2145
228 Ga0207663_10329768 3300025916 Bacteria 1149
229 Ga0207663_10428302 3300025916 Bacteria 1017
230 Ga0207660_10210520 3300025917 Bacteria 1522
231 Ga0207662_10053364 3300025918 Bacteria 2408
232 Ga0207657_10060159 3300025919 Bacteria 3261
233 Ga0207657_10293138 3300025919 Bacteria 1290
234 Ga0207649_10422866 3300025920 Bacteria 1001
235 Ga0207652_10011332 3300025921 Bacteria 7184
236 Ga0207652_10183073 3300025921 Bacteria 1883
237 Ga0207652_10774176 3300025921 Bacteria 853
238 Ga0207646_10719294 3300025922 Bacteria 892
239 Ga0207681_10115720 3300025923 Bacteria 1958
240 Ga0207650_10016019 3300025925 Bacteria 5230
241 Ga0207650_10038239 3300025925 Bacteria 3503
242 Ga0207650_10571988 3300025925 Bacteria 948
243 Ga0207659_10448539 3300025926 Bacteria 1086
244 Ga0207687_10176754 3300025927 Bacteria 1651
245 Ga0207700_10000458 3300025928 Bacteria 23936
246 Ga0207700_10080940 3300025928 Bacteria 2534
247 Ga0207700_10082705 3300025928 Bacteria 2511
248 Ga0207700_10325806 3300025928 Bacteria 1332
249 Ga0207700_10477550 3300025928 Bacteria 1101
250 Ga0207664_10000692 3300025929 Bacteria 23079
251 Ga0207664_10436917 3300025929 Bacteria 1167
252 Ga0207644_10198890 3300025931 Bacteria 1580
253 Ga0207706_10003497 3300025933 Bacteria 15003
254 Ga0207709_10584461 3300025935 Bacteria 882
255 Ga0207670_10020194 3300025936 Bacteria 4088
256 Ga0207669_10067393 3300025937 Bacteria 2230
257 Ga0207704_10411065 3300025938 Bacteria 1070
258 Ga0207665_10005548 3300025939 Bacteria 8416
259 Ga0207665_10152045 3300025939 Bacteria 1659
260 Ga0207665_10194478 3300025939 Bacteria 1475
261 Ga0207665_10453537 3300025939 Bacteria 984
262 Ga0207665_10464056 3300025939 Bacteria 973
263 Ga0207691_10002332 3300025940 Bacteria 18584
264 Ga0207711_10071891 3300025941 Bacteria 3003
265 Ga0207689_10019975 3300025942 Bacteria 5641
266 Ga0207661_10325022 3300025944 Bacteria 1384
267 Ga0207679_10125483 3300025945 Bacteria 2050
268 Ga0207667_10047878 3300025949 Bacteria 4522
269 Ga0207651_10016792 3300025960 Bacteria 4302
270 Ga0207712_10064411 3300025961 Bacteria 2614
271 Ga0207668_10317519 3300025972 Bacteria 1291
272 Ga0207640_10621223 3300025981 Bacteria 917
273 Ga0207658_10412509 3300025986 Bacteria 1189
274 Ga0207677_10661255 3300026023 Bacteria 923
275 Ga0207703_10019955 3300026035 Bacteria 5237
276 Ga0207678_10016727 3300026067 Bacteria 6442
277 Ga0207641_10047136 3300026088 Bacteria 3634
278 Ga0207648_10055198 3300026089 Bacteria 3468
279 Ga0207676_10112109 3300026095 Bacteria 2284
280 Ga0207676_10595707 3300026095 Bacteria 1061
281 Ga0207674_10030777 3300026116 Bacteria 5641
282 Ga0207675_100002006 3300026118 Bacteria 20298
283 Ga0207683_10011391 3300026121 Bacteria 7588
284 Ga0207683_10215087 3300026121 Bacteria 1750
285 Ga0209179_1025375 3300027512 Bacteria 1182
286 Ga0209179_1062947 3300027512 Bacteria 807
287 Ga0268266_10370718 3300028379 Bacteria 1348
288 Ga0268266_10622211 3300028379 Bacteria 1038
289 Ga0265338_10128621 3300028800 Bacteria 2005
290 Ga0265760_10022610 3300031090 Bacteria 1822
291 Ga0265325_10017266 3300031241 Bacteria 4012
292 Ga0265339_10000051 3300031249 Bacteria 101716
293 Ga0265316_10295202 3300031344 Bacteria 1182
294 Ga0265313_10000011 3300031595 Bacteria 166182
295 Ga0265342_10172460 3300031712 Bacteria 1189
296 Ga0307409_100463818 3300031995 Bacteria 1225
297 Ga0373938_0087635 3300034957 Bacteria 766
298 Ga0373926_0033952 3300035083 Bacteria 1805
299 Ga0373926_0064004 3300035083 Bacteria 1343
300 Ga0373926_0115669 3300035083 Bacteria 1009
301 Ga0373929_0013986 3300035085 Bacteria 1545
302 Ga0373944_0001073 3300035089 Bacteria 6771
303 Ga0373944_0041191 3300035089 Bacteria 1428
304 Ga0373944_0041764 3300035089 Bacteria 1420
305 Ga0373923_0033102 3300035111 Bacteria 2092
306 Ga0373923_0103889 3300035111 Bacteria 1256
307 Ga0373936_0059800 3300035113 Bacteria 1554
308 Ga0373945_0031376 3300035116 Bacteria 1877
309 Ga0373945_0046588 3300035116 Bacteria 1582
310 Ga0373945_0076814 3300035116 Bacteria 1273
311 Ga0373953_0052199 3300035117 Bacteria 1654
312 Ga0373953_0076504 3300035117 Bacteria 1387
313 Ga0373956_0031873 3300035119 Bacteria 2311
314 Ga0373956_0051234 3300035119 Bacteria 1855
315 Ga0373957_0019620 3300035120 Bacteria 2382
316 Ga0373957_0089275 3300035120 Bacteria 1224
317 Ga0373960_0104524 3300035121 Bacteria 922
318 Ga0373943_0000336 3300035170 Bacteria 19650
319 Ga0373943_0029596 3300035170 Bacteria 2588
320 Ga0373943_0088318 3300035170 Bacteria 1601
321 Ga0373943_0117755 3300035170 Bacteria 1409
322 Ga0373946_0010593 3300035171 Bacteria 3417
323 Ga0373946_0030202 3300035171 Bacteria 2162
324 Ga0373955_0088964 3300035172 Bacteria 1757
325 Ga0373955_0346315 3300035172 Bacteria 900
326 Ga0373962_0132300 3300035242 Bacteria 804
327 Ga0373924_0111912 3300035410 Bacteria 1180
328 Ga0373931_0279457 3300035691 Bacteria 1024
329 Ga0373935_0003893 3300035692 Bacteria 8708
330 Ga0373935_0057351 3300035692 Bacteria 2484
331 Ga0373935_0059859 3300035692 Bacteria 2436
332 Ga0373935_0070966 3300035692 Bacteria 2246
333 Ga0373935_0103465 3300035692 Bacteria 1880
334 Ga0373935_0391460 3300035692 Bacteria 997
335 Ga0373927_0018038 3300035695 Bacteria 4641
336 Ga0373927_0032166 3300035695 Bacteria 3416
337 Ga0373927_0453243 3300035695 Bacteria 847
338 Ga0373933_0056218 3300035724 Bacteria 2362
339 Ga0373933_0440167 3300035724 Bacteria 852
340 Ga0373947_0011727 3300035725 Bacteria 5022
341 Ga0373947_0034868 3300035725 Bacteria 2977
342 Ga0373947_0109398 3300035725 Bacteria 1745
343 Ga0373947_0351510 3300035725 Bacteria 989
344 Ga0373937_0007161 3300036401 Bacteria 9645
345 Ga0373937_0017955 3300036401 Bacteria 6312
346 Ga0373937_0123410 3300036401 Bacteria 2415
347 Ga0373937_0709035 3300036401 Bacteria 953
348 Ga0373937_1264991 3300036401 Bacteria 686
349 Ga0373925_0001035 3300037068 Bacteria 25221
350 Ga0373925_0002536 3300037068 Bacteria 14550
351 Ga0373925_0011850 3300037068 Bacteria 6310
352 Ga0373925_0183173 3300037068 Bacteria 1659
353 Ga0373925_0354197 3300037068 Bacteria 1192
354 Ga0373925_0416102 3300037068 Bacteria 1098
355 Ga0373925_0776692 3300037068 Bacteria 790
356 Ga0436364_0455852 3300037853 Bacteria 4321
357 Ga0436364_0655747 3300037853 Bacteria 2749
358 Ga0436365_0125354 3300039437 Bacteria 1443
359 Ga0436365_1053644 3300039437 Bacteria 2987
360 Ga0436365_1087797 3300039437 Bacteria 4235
361 Ga0436361_0281290 3300039447 Bacteria 852
362 Ga0436361_0422998 3300039447 Bacteria 9063
363 Ga0436363_0444090 3300039450 Bacteria 691
364 Ga0436363_1399477 3300039450 Bacteria 3238
365 Ga0466966_0428747 3300044684 Bacteria 795
366 Ga0466963_0289641 3300044694 Bacteria 1151
367 Ga0466967_0079519 3300045976 Bacteria 2956
368 Ga0495627_058081 3300046453 Bacteria 1150
369 Ga0495592_0037845 3300046454 Bacteria 3630
370 Ga0495592_0132612 3300046454 Bacteria 1741
371 Ga0495603_0080365 3300046455 Bacteria 1911
372 Ga0495590_0031619 3300046457 Bacteria 1853
373 Ga0495629_0080047 3300046459 Bacteria 2281
374 Ga0495629_0159668 3300046459 Bacteria 1566
375 Ga0495629_0245850 3300046459 Bacteria 1231
376 Ga0495629_0271996 3300046459 Bacteria 1164
377 Ga0495638_0073855 3300046460 Bacteria 2080
378 Ga0495651_0105017 3300046462 Bacteria 2096
379 Ga0495651_0203205 3300046462 Bacteria 1385
380 Ga0495653_0059341 3300046463 Bacteria 2904
381 Ga0495653_0207840 3300046463 Bacteria 1324
382 Ga0495580_0039737 3300046472 Bacteria 3366
383 Ga0495580_0045082 3300046472 Bacteria 3133
384 Ga0495580_0252078 3300046472 Bacteria 1208
385 Ga0495582_0082598 3300046473 Bacteria 1785
386 Ga0495582_0104024 3300046473 Bacteria 1591
387 Ga0495582_0401794 3300046473 Bacteria 790
388 Ga0495605_0171577 3300046474 Bacteria 958
389 Ga0495639_0015774 3300046475 Bacteria 3276
390 Ga0495639_0062884 3300046475 Bacteria 1703
391 Ga0495639_0178642 3300046475 Bacteria 1033
392 Ga0495662_0044446 3300046476 Bacteria 2144
393 Ga0495662_0216908 3300046476 Bacteria 943
394 Ga0495664_0000120 3300046477 Bacteria 39814
395 Ga0495664_0075431 3300046477 Bacteria 2018
396 Ga0495584_0036368 3300046491 Bacteria 2488
397 Ga0495584_0051033 3300046491 Bacteria 2083
398 Ga0495584_0058466 3300046491 Bacteria 1940
399 Ga0495584_0222802 3300046491 Bacteria 959
400 Ga0495585_0096196 3300046492 Bacteria 1589
401 Ga0495585_0151149 3300046492 Bacteria 1210
402 Ga0495594_0055829 3300046499 Bacteria 2178
403 Ga0495594_0127037 3300046499 Bacteria 1443
404 Ga0495596_0115179 3300046500 Bacteria 1044
405 Ga0495608_0017571 3300046511 Bacteria 4947
406 Ga0495616_0028595 3300046513 Bacteria 2951
407 Ga0495618_0005523 3300046514 Bacteria 7699
408 Ga0495618_0051354 3300046514 Bacteria 2605
409 Ga0495618_0204176 3300046514 Bacteria 1250
410 Ga0495628_0001017 3300046516 Bacteria 25597
411 Ga0495630_0010058 3300046517 Bacteria 6814
412 Ga0495630_0016771 3300046517 Bacteria 5359
413 Ga0495630_0392982 3300046517 Bacteria 1062
414 Ga0495631_0084238 3300046518 Bacteria 1370
415 Ga0495632_0183229 3300046519 Bacteria 959
416 Ga0495663_0024695 3300046525 Bacteria 1748
417 Ga0495652_0018292 3300046529 Bacteria 6250
418 Ga0495652_0111095 3300046529 Bacteria 2204
419 Ga0495652_0141755 3300046529 Bacteria 1889
420 Ga0495665_0012704 3300046531 Bacteria 4557
421 Ga0495665_0031211 3300046531 Bacteria 2851
422 Ga0495665_0093094 3300046531 Bacteria 1584
423 Ga0495640_0004293 3300046533 Bacteria 11379
424 Ga0495640_0105647 3300046533 Bacteria 1844
425 Ga0495640_0135641 3300046533 Bacteria 1590
426 Ga0495640_0142989 3300046533 Bacteria 1541
427 Ga0495640_0293192 3300046533 Bacteria 1011
428 Ga0495640_0425263 3300046533 Bacteria 813
429 Ga0495586_0039095 3300046535 Bacteria 2550
430 Ga0495587_0044036 3300046536 Bacteria 2655
431 Ga0495598_0009022 3300046537 Bacteria 2342
432 Ga0495598_0115616 3300046537 Bacteria 904
433 Ga0495645_0000755 3300046543 Bacteria 22120
434 Ga0495645_0007548 3300046543 Bacteria 7565
435 Ga0495667_0047645 3300046559 Bacteria 2831
436 Ga0495667_0088746 3300046559 Bacteria 2004
437 Ga0495656_0007560 3300046615 Bacteria 3845
438 Ga0495656_0073291 3300046615 Bacteria 1526
439 Ga0495656_0242227 3300046615 Bacteria 908
440 Ga0495668_0073927 3300046616 Bacteria 1872
441 Ga0495634_0009596 3300046642 Bacteria 7130
442 Ga0495634_0031970 3300046642 Bacteria 3621
443 Ga0495634_0210798 3300046642 Bacteria 1203
444 Ga0495635_0011446 3300046663 Bacteria 6221
445 Ga0495635_0136862 3300046663 Bacteria 1669
446 Ga0495635_0395960 3300046663 Bacteria 918
447 Ga0495659_0010287 3300046664 Bacteria 2998
448 Ga0495659_0114169 3300046664 Bacteria 1057
449 Ga0495659_0166995 3300046664 Bacteria 891
450 Ga0495661_0157463 3300046665 Bacteria 1222
451 Ga0495657_0066003 3300046675 Bacteria 2378
452 Ga0495657_0069857 3300046675 Bacteria 2297
453 Ga0495599_0022534 3300046678 Bacteria 3933
454 Ga0495599_0023249 3300046678 Bacteria 3873
455 Ga0495623_0036071 3300046679 Bacteria 3169
456 Ga0495623_0043430 3300046679 Bacteria 2860
457 Ga0495646_0075126 3300046680 Bacteria 1982
458 Ga0495646_0085487 3300046680 Bacteria 1831
459 Ga0495646_0220665 3300046680 Bacteria 1025
460 Ga0495647_0033851 3300046681 Bacteria 1911
461 Ga0495658_0021800 3300046683 Bacteria 3381
462 Ga0495658_0055176 3300046683 Bacteria 2263
463 Ga0495658_0092051 3300046683 Bacteria 1797
464 Ga0495658_0137552 3300046683 Bacteria 1492
465 Ga0495658_0249103 3300046683 Bacteria 1117
466 Ga0495613_0135338 3300046689 Bacteria 1763
467 Ga0495613_0287107 3300046689 Bacteria 1141
468 Ga0495624_0018677 3300046690 Bacteria 4635
469 Ga0495624_0273925 3300046690 Bacteria 1019
470 Ga0495670_0075909 3300046691 Bacteria 1707
471 Ga0495670_0162430 3300046691 Bacteria 1174
472 Ga0495671_0059351 3300046692 Bacteria 1891
473 Ga0495600_0308292 3300046809 Bacteria 997
474 Ga0495581_0052501 3300047315 Bacteria 2354
475 Ga0495581_0120893 3300047315 Bacteria 1524
476 Ga0495581_0229598 3300047315 Bacteria 1086
477 Ga0495581_0247078 3300047315 Bacteria 1043
478 Ga0495604_0001877 3300047317 Bacteria 17074
479 Ga0495674_0002324 3300047319 Bacteria 18675
480 Ga0495674_0334206 3300047319 Bacteria 1232
481 Ga0495674_0436158 3300047319 Bacteria 1054
482 Ga0495674_0730028 3300047319 Bacteria 775
483 Ga0495676_0087145 3300047321 Bacteria 2347
484 Ga0495676_0096105 3300047321 Bacteria 2203
485 Ga0495680_0009331 3300047322 Bacteria 8837
486 Ga0495680_0120374 3300047322 Bacteria 1939
487 Ga0495680_0194249 3300047322 Bacteria 1459
488 Ga0495683_0214671 3300047323 Bacteria 861
489 Ga0495675_0030388 3300047444 Bacteria 3447
490 Ga0495675_0165243 3300047444 Bacteria 1361
491 Ga0495673_0230337 3300047469 Bacteria 683
492 Ga0495684_0010444 3300047471 Bacteria 7180
493 Ga0495684_0055774 3300047471 Bacteria 3013
494 Ga0495684_0218236 3300047471 Bacteria 1399
495 Ga0495684_0401536 3300047471 Bacteria 962
496 Ga0495593_0015344 3300047673 Bacteria 4342
497 Ga0495593_0135461 3300047673 Bacteria 1249
498 Ga0495602_0004680 3300048088 Bacteria 14292
499 Ga0495602_0028483 3300048088 Bacteria 5343
500 Ga0495602_0065784 3300048088 Bacteria 3127
501 Ga0495602_0592064 3300048088 Bacteria 764
502 Ga0495614_0060132 3300048089 Bacteria 1633
503 Ga0495614_0260342 3300048089 Bacteria 795
504 Ga0496100_0066055 3300048903 Bacteria 2398
505 Ga0496100_0123553 3300048903 Bacteria 1814
506 Ga0496101_0008638 3300048904 Bacteria 6659
507 Ga0496101_0017034 3300048904 Bacteria 4921
508 Ga0496101_0102046 3300048904 Bacteria 2148
509 Ga0496102_0092181 3300048905 Bacteria 2805
510 Ga0496102_0290648 3300048905 Bacteria 1540
511 Ga0496102_0946421 3300048905 Bacteria 782
512 Ga0496103_0026782 3300048906 Bacteria 3489
513 Ga0496103_0159603 3300048906 Bacteria 1446
514 Ga0496104_0009679 3300048907 Bacteria 8586
515 Ga0496104_0019228 3300048907 Bacteria 6245
516 Ga0496104_0617336 3300048907 Bacteria 994
517 Ga0496104_0746765 3300048907 Bacteria 885
518 Ga0496104_1059508 3300048907 Bacteria 714
519 Ga0496105_0006188 3300048908 Bacteria 9176
520 Ga0496105_0200206 3300048908 Bacteria 1630
521 Ga0496105_0370233 3300048908 Bacteria 1142
522 Ga0496106_0065432 3300048909 Bacteria 2767
523 Ga0496106_0659891 3300048909 Bacteria 835
524 Ga0496107_0066071 3300048910 Bacteria 2622
525 Ga0496107_0072734 3300048910 Bacteria 2499
526 Ga0496107_0151606 3300048910 Bacteria 1715
527 Ga0496108_0010545 3300048911 Bacteria 7507
528 Ga0496108_0811923 3300048911 Bacteria 807
529 Ga0496109_0003915 3300048912 Bacteria 12438
530 Ga0496109_0185329 3300048912 Bacteria 1956
531 Ga0496110_0008900 3300048913 Bacteria 8092
532 Ga0496110_0149162 3300048913 Bacteria 2116
533 Ga0496110_0383418 3300048913 Bacteria 1281
534 Ga0496111_0001479 3300048914 Bacteria 13449
535 Ga0496111_0010409 3300048914 Bacteria 6240
536 Ga0496111_0033040 3300048914 Bacteria 3690
537 Ga0496112_0008782 3300048915 Bacteria 9067
538 Ga0496112_0244846 3300048915 Bacteria 1745
539 Ga0496112_0334523 3300048915 Bacteria 1458
540 Ga0496113_0007626 3300048916 Bacteria 6980
541 Ga0496113_0349749 3300048916 Bacteria 1185
542 Ga0496114_0115240 3300048917 Bacteria 2305
543 Ga0496114_0184502 3300048917 Bacteria 1823
544 Ga0496115_0019005 3300048918 Bacteria 5284
545 Ga0496115_0210703 3300048918 Bacteria 1605
546 Ga0496115_0241533 3300048918 Bacteria 1488
547 Ga0496115_0256179 3300048918 Bacteria 1440
548 Ga0496115_0312817 3300048918 Bacteria 1286
549 Ga0501033_0040611 3300049570 Bacteria 3473
550 Ga0501034_0010727 3300049571 Bacteria 9516
551 Ga0501036_0582654 3300049572 Bacteria 929
552 Ga0501038_0338493 3300049574 Bacteria 1174
553 Ga0501040_0585019 3300049576 Bacteria 806
554 Ga0501042_0307818 3300049578 Bacteria 1145
555 Ga0501042_0656294 3300049578 Bacteria 763
556 Ga0501043_0087119 3300049579 Bacteria 2454
557 Ga0501043_0288854 3300049579 Bacteria 1256
558 Ga0501047_0060458 3300049581 Bacteria 3656
559 Ga0501047_0149641 3300049581 Bacteria 2211
560 Ga0501047_0164624 3300049581 Bacteria 2089
561 Ga0501070_0287856 3300049586 Bacteria 1340
562 Ga0501070_0399032 3300049586 Bacteria 1112
563 Ga0501070_0492707 3300049586 Bacteria 985
564 Ga0501071_0129386 3300049587 Bacteria 1875
565 Ga0501072_0287579 3300049588 Bacteria 1307
566 Ga0501074_0354582 3300049590 Bacteria 1041
567 Ga0501075_0353411 3300049591 Bacteria 1120
568 Ga0501076_0216830 3300049592 Bacteria 1564
569 Ga0501077_0154806 3300049593 Bacteria 1455
570 Ga0501077_0189565 3300049593 Bacteria 1306
571 Ga0501077_0225017 3300049593 Bacteria 1192
572 Ga0501077_0497802 3300049593 Bacteria 781
573 Ga0501080_0086831 3300049742 Bacteria 2907
574 Ga0501080_0624320 3300049742 Bacteria 955
575 Ga0501081_0064464 3300049743 Bacteria 2545
576 Ga0501035_0156559 3300049822 Bacteria 1975
577 Ga0501044_0000457 3300049823 Bacteria 49748
578 Ga0501044_0011578 3300049823 Bacteria 9560
579 nmdc:mga03n38_66966_c1 3300050490 Bacteria 1651
580 nmdc:mga00v17_185515_c2 3300050491 Bacteria 602
581 nmdc:mga00v17_67156_c1 3300050491 Bacteria 2215
582 nmdc:mga0yw44_215290_c1 3300050492 Bacteria 1272
583 nmdc:mga0yw44_4866_c1 3300050492 Bacteria 6244
584 nmdc:mga05p37_104832_c1 3300050507 Bacteria 3479
585 nmdc:mga05p37_11094_c1 3300050507 Bacteria 10706
586 nmdc:mga05p37_140850_c1 3300050507 Bacteria 2955
587 nmdc:mga05p37_315978_c1 3300050507 Bacteria 1850
588 nmdc:mga09592_162655_c1 3300050508 Bacteria 1928
589 nmdc:mga09592_8496_c1 3300050508 Bacteria 8351
590 nmdc:mga0qj67_86119_c1 3300050509 Bacteria 2521
591 nmdc:mga06r32_166776_c1 3300050510 Bacteria 2185
592 nmdc:mga06r32_290783_c1 3300050510 Bacteria 1621
593 nmdc:mga06r32_63540_c1 3300050510 Bacteria 3559
594 nmdc:mga06r32_827928_c1 3300050510 Bacteria 885
595 nmdc:mga06r32_86736_c1 3300050510 Bacteria 3053
596 nmdc:mga06r32_885073_c1 3300050510 Bacteria 850
597 nmdc:mga06r32_925502_c1 3300050510 Bacteria 827
598 nmdc:mga08y16_1429331_c1 3300050511 Bacteria 654
599 nmdc:mga08y16_154103_c1 3300050511 Bacteria 2388
600 nmdc:mga08y16_203685_c1 3300050511 Bacteria 2050
601 nmdc:mga08y16_805345_c1 3300050511 Bacteria 932
602 nmdc:mga0n895_11090_c1 3300050512 Bacteria 8019
603 nmdc:mga0n895_14925_c1 3300050512 Bacteria 7075
604 nmdc:mga0n895_376006_c1 3300050512 Bacteria 1438
605 nmdc:mga0n895_450127_c1 3300050512 Bacteria 1300
606 nmdc:mga0n895_704572_c1 3300050512 Bacteria 1005
607 nmdc:mga0n895_92631_c1 3300050512 Bacteria 3025
608 nmdc:mga0rr50_219789_c1 3300050513 Bacteria 1568
609 nmdc:mga0rr50_240303_c1 3300050513 Bacteria 1501
610 nmdc:mga0rr50_374159_c1 3300050513 Bacteria 1200
611 nmdc:mga08x19_13285_c1 3300050514 Bacteria 4975
612 nmdc:mga08x19_161230_c1 3300050514 Bacteria 1523
613 nmdc:mga08x19_616576_c1 3300050514 Bacteria 769
614 nmdc:mga08x19_70955_c1 3300050514 Bacteria 2270
615 nmdc:mga0a205_147097_c1 3300050515 Bacteria 2256
616 nmdc:mga0a205_148336_c1 3300050515 Bacteria 2245
617 nmdc:mga0a205_452754_c1 3300050515 Bacteria 1143
618 Ga0495601_0000114 3300053077 Bacteria 44359
619 Ga0495601_0000596 3300053077 Bacteria 19200
620 Ga0495601_0063932 3300053077 Bacteria 2339
621 Ga0495612_0000056 3300053078 Bacteria 50144
622 Ga0495612_0001726 3300053078 Bacteria 8981
623 Ga0495655_0110809 3300053083 Bacteria 824
624 Ga0495595_0005799 3300053084 Bacteria 4999
625 Ga0495595_0157082 3300053084 Bacteria 1121
626 Ga0495619_0004683 3300053085 Bacteria 8715
627 Ga0495619_0004828 3300053085 Bacteria 8559
628 Ga0495619_0027619 3300053085 Bacteria 3657
629 Ga0495619_0036752 3300053085 Bacteria 3190
630 Ga0495619_0041493 3300053085 Bacteria 3010
631 Ga0495619_0747481 3300053085 Bacteria 663
632 Ga0500639_176405 3300053163 Bacteria 951
633 Ga0500657_163023 3300053728 Bacteria 805
634 Ga0501084_0047882 3300054114 Bacteria 3580
635 Ga0501084_0766147 3300054114 Bacteria 813
636 Ga0530510_0041348 3300061734 Bacteria 3328
637 Ga0373947_0108768
638 JGI24743J22301_10002841
639 JGI24748J21848_1003646
640 JGI24034J26672_10003107
641 JGI24742J22300_10003804
642 JGI24751J29686_10057246
643 JGI25405J52794_10013046
644 Ga0070683_100125993
645 Ga0070690_100020158
646 Ga0070670_101012216
647 Ga0068869_100021486
648 Ga0070666_10277517
649 Ga0070680_100030364
650 Ga0070680_100200918
651 Ga0070680_100963232
652 Ga0070682_100100958
653 Ga0070660_100138276
654 Ga0070660_100274609
655 Ga0070689_100043073
656 Ga0070689_100069805
657 Ga0070689_100934922
658 Ga0070691_10100586
659 Ga0070661_100286817
660 Ga0070669_100047588
661 Ga0070675_100015993
662 Ga0070671_100212251
663 Ga0070674_100106432
664 Ga0070673_100020247
665 Ga0070673_100102811
666 Ga0070659_100046457
667 Ga0070659_100062721
668 Ga0070667_100046241
669 Ga0070709_10002356
670 Ga0070714_100000516
671 Ga0070714_100032390
672 Ga0070714_100225140
673 Ga0070714_100305241
674 Ga0070713_100000228
675 Ga0070713_100042484
676 Ga0070713_100151159
677 Ga0070713_100420863
678 Ga0070713_100799543
679 Ga0070710_10000438
680 Ga0070710_10027608
681 Ga0070710_10041742
682 Ga0070711_100000998
683 Ga0070711_100022504
684 Ga0070711_100087626
685 Ga0070711_100309712
686 Ga0070705_100071243
687 Ga0070700_100015500
688 Ga0070694_100179707
689 Ga0070708_100170495
690 Ga0070663_100043993
691 Ga0070678_100038784
692 Ga0070678_100077082
693 Ga0070662_100715253
694 Ga0070681_10040092
695 Ga0070681_10133037
696 Ga0070681_10176764
697 Ga0070685_10098872
698 Ga0070699_100001660
699 Ga0070699_100107612
700 Ga0070679_100418344
701 Ga0070684_100096214
702 Ga0070684_100523915
703 Ga0070684_100976772
704 Ga0068853_100031218
705 Ga0070672_100031508
706 Ga0070686_100343805
707 Ga0070686_100367767
708 Ga0070696_100069040
709 Ga0070696_100538989
710 Ga0070693_100015829
711 Ga0070704_100191795
712 Ga0068855_100087918
713 Ga0068855_100687574
714 Ga0070664_100198971
715 Ga0068857_100104138
716 Ga0068856_100063610
717 Ga0068856_100145997
718 Ga0070702_100010590
719 Ga0068852_100028980
720 Ga0068859_100054914
721 Ga0068864_100029107
722 Ga0068866_10033138
723 Ga0068861_100548052
724 Ga0068870_10039220
725 Ga0068863_100022637
726 Ga0068863_100034649
727 Ga0068858_100520295
728 Ga0068860_100040135
729 Ga0081455_10005070
730 Ga0081455_10066301
731 Ga0081455_10094519
732 Ga0081455_10216197
733 Ga0081538_10043320
734 Ga0081538_10051969
735 Ga0081540_1002980
736 Ga0081540_1013731
737 Ga0081540_1039921
738 Ga0070717_10001451
739 Ga0070717_10037846
740 Ga0070717_10254847
741 Ga0070717_10879504
742 Ga0075365_10169317
743 Ga0075365_10360169
744 Ga0075365_10555440
745 Ga0075364_10124450
746 Ga0070715_10007582
747 Ga0070715_10351872
748 Ga0070716_100002431
749 Ga0070712_100005438
750 Ga0070712_100021532
751 Ga0070712_100033200
752 Ga0070712_100131046
753 Ga0070712_100324098
754 Ga0075362_10028795
755 Ga0097621_100239957
756 Ga0068871_100003229
757 Ga0068871_100034078
758 Ga0075428_100035411
759 Ga0075428_100130551
760 Ga0075428_100341916
761 Ga0075428_100456888
762 Ga0075430_100085006
763 Ga0075430_100114182
764 Ga0075430_100733612
765 Ga0075431_100089172
766 Ga0075431_100126853
767 Ga0075431_100209340
768 Ga0075431_100241399
769 Ga0075431_100261362
770 Ga0075431_100622792
771 Ga0075433_10059560
772 Ga0075433_10165094
773 Ga0075433_10573134
774 Ga0075434_100013888
775 Ga0075434_100025533
776 Ga0075434_100028232
777 Ga0075434_100037650
778 Ga0075434_100200178
779 Ga0075429_100019927
780 Ga0075429_100590517
781 Ga0068865_100055931
782 Ga0075436_100054731
783 Ga0075436_100056203
784 Ga0075436_100062547
785 Ga0075436_100149168
786 Ga0097620_100054916
787 Ga0075435_100075849
788 Ga0075435_100257310
789 Ga0075435_100334873
790 Ga0099795_10013769
791 Ga0099795_10038409
792 Ga0105244_10135109
793 Ga0105240_10008453
794 Ga0111539_10024989
795 Ga0111539_10046220
796 Ga0111539_10096871
797 Ga0111539_10611570
798 Ga0105245_10192033
799 Ga0105247_10010607
800 Ga0114129_10000935
801 Ga0114129_10004270
802 Ga0114129_10592075
803 Ga0114129_11168683
804 Ga0105243_10021908
805 Ga0105243_10353871
806 Ga0105242_10396208
807 Ga0105237_10263250
808 Ga0105237_11474697
809 Ga0105249_10111789
810 Ga0099796_10001237
811 Ga0099796_10020911
812 Ga0105239_10251176
813 Ga0105246_10921805
814 Ga0157371_10041979
815 Ga0157370_10015656
816 Ga0157370_10039908
817 Ga0157378_10045512
818 Ga0163162_10352622
819 Ga0163162_10713452
820 Ga0157375_10157997
821 Ga0157375_11502162
822 Ga0163163_10033817
823 Ga0163163_10174555
824 Ga0182008_10282054
825 Ga0157377_10001219
826 Ga0157379_10099971
827 Ga0157379_10991284
828 Ga0157376_10048866
829 Ga0157376_10887020
830 Ga0163161_10041464
831 Ga0206356_10872937
832 Ga0206354_10703793
833 Ga0206353_10634153
834 Ga0213876_10119202
835 Ga0213876_10216241
836 Ga0224572_1003288
837 Ga0224572_1032726
838 Ga0228598_1000571
839 Ga0228598_1019546
840 Ga0228598_1023532
841 Ga0207692_10002828
842 Ga0207710_10244645
843 Ga0207688_10000659
844 Ga0207685_10005621
845 Ga0207699_10010235
846 Ga0207645_10021226
847 Ga0207643_10002609
848 Ga0207684_10005466
849 Ga0207654_10133868
850 Ga0207707_10021522
851 Ga0207707_10082233
852 Ga0207707_10123221
853 Ga0207707_10490052
854 Ga0207695_10110239
855 Ga0207671_10255580
856 Ga0207693_10003700
857 Ga0207693_10009265
858 Ga0207693_10009485
859 Ga0207693_10018894
860 Ga0207693_10019210
861 Ga0207693_10079652
862 Ga0207663_10029311
863 Ga0207663_10079166
864 Ga0207663_10329768
865 Ga0207663_10428302
866 Ga0207660_10210520
867 Ga0207662_10053364
868 Ga0207657_10060159
869 Ga0207657_10293138
870 Ga0207649_10422866
871 Ga0207652_10011332
872 Ga0207652_10183073
873 Ga0207652_10774176
874 Ga0207646_10719294
875 Ga0207681_10115720
876 Ga0207650_10016019
877 Ga0207650_10038239
878 Ga0207650_10571988
879 Ga0207659_10448539
880 Ga0207687_10176754
881 Ga0207700_10000458
882 Ga0207700_10080940
883 Ga0207700_10082705
884 Ga0207700_10325806
885 Ga0207700_10477550
886 Ga0207664_10000692
887 Ga0207664_10436917
888 Ga0207644_10198890
889 Ga0207706_10003497
890 Ga0207709_10584461
891 Ga0207670_10020194
892 Ga0207669_10067393
893 Ga0207704_10411065
894 Ga0207665_10005548
895 Ga0207665_10152045
896 Ga0207665_10194478
897 Ga0207665_10453537
898 Ga0207665_10464056
899 Ga0207691_10002332
900 Ga0207711_10071891
901 Ga0207689_10019975
902 Ga0207661_10325022
903 Ga0207679_10125483
904 Ga0207667_10047878
905 Ga0207651_10016792
906 Ga0207712_10064411
907 Ga0207668_10317519
908 Ga0207640_10621223
909 Ga0207658_10412509
910 Ga0207677_10661255
911 Ga0207703_10019955
912 Ga0207678_10016727
913 Ga0207641_10047136
914 Ga0207648_10055198
915 Ga0207676_10112109
916 Ga0207676_10595707
917 Ga0207674_10030777
918 Ga0207675_100002006
919 Ga0207683_10011391
920 Ga0207683_10215087
921 Ga0209179_1025375
922 Ga0209179_1062947
923 Ga0268266_10370718
924 Ga0268266_10622211
925 Ga0265338_10128621
926 Ga0265760_10022610
927 Ga0265325_10017266
928 Ga0265339_10000051
929 Ga0265316_10295202
930 Ga0265313_10000011
931 Ga0265342_10172460
932 Ga0307409_100463818
933 Ga0373938_0087635
934 Ga0373926_0033952
935 Ga0373926_0064004
936 Ga0373926_0115669
937 Ga0373929_0013986
938 Ga0373944_0001073
939 Ga0373944_0041191
940 Ga0373944_0041764
941 Ga0373923_0033102
942 Ga0373923_0103889
943 Ga0373936_0059800
944 Ga0373945_0031376
945 Ga0373945_0046588
946 Ga0373945_0076814
947 Ga0373953_0052199
948 Ga0373953_0076504
949 Ga0373956_0031873
950 Ga0373956_0051234
951 Ga0373957_0019620
952 Ga0373957_0089275
953 Ga0373960_0104524
954 Ga0373943_0000336
955 Ga0373943_0029596
956 Ga0373943_0088318
957 Ga0373943_0117755
958 Ga0373946_0010593
959 Ga0373946_0030202
960 Ga0373955_0088964
961 Ga0373955_0346315
962 Ga0373962_0132300
963 Ga0373924_0111912
964 Ga0373931_0279457
965 Ga0373935_0003893
966 Ga0373935_0057351
967 Ga0373935_0059859
968 Ga0373935_0070966
969 Ga0373935_0103465
970 Ga0373935_0391460
971 Ga0373927_0018038
972 Ga0373927_0032166
973 Ga0373927_0453243
974 Ga0373933_0056218
975 Ga0373933_0440167
976 Ga0373947_0011727
977 Ga0373947_0034868
978 Ga0373947_0109398
979 Ga0373947_0351510
980 Ga0373937_0007161
981 Ga0373937_0017955
982 Ga0373937_0123410
983 Ga0373937_0709035
984 Ga0373937_1264991
985 Ga0373925_0001035
986 Ga0373925_0002536
987 Ga0373925_0011850
988 Ga0373925_0183173
989 Ga0373925_0354197
990 Ga0373925_0416102
991 Ga0373925_0776692
992 Ga0436364_0455852
993 Ga0436364_0655747
994 Ga0436365_0125354
995 Ga0436365_1053644
996 Ga0436365_1087797
997 Ga0436361_0281290
998 Ga0436361_0422998
999 Ga0436363_0444090
1000 Ga0436363_1399477
1001 Ga0466966_0428747
1002 Ga0466963_0289641
1003 Ga0466967_0079519
1004 Ga0495627_058081
1005 Ga0495592_0037845
1006 Ga0495592_0132612
1007 Ga0495603_0080365
1008 Ga0495590_0031619
1009 Ga0495629_0080047
1010 Ga0495629_0159668
1011 Ga0495629_0245850
1012 Ga0495629_0271996
1013 Ga0495638_0073855
1014 Ga0495651_0105017
1015 Ga0495651_0203205
1016 Ga0495653_0059341
1017 Ga0495653_0207840
1018 Ga0495580_0039737
1019 Ga0495580_0045082
1020 Ga0495580_0252078
1021 Ga0495582_0082598
1022 Ga0495582_0104024
1023 Ga0495582_0401794
1024 Ga0495605_0171577
1025 Ga0495639_0015774
1026 Ga0495639_0062884
1027 Ga0495639_0178642
1028 Ga0495662_0044446
1029 Ga0495662_0216908
1030 Ga0495664_0000120
1031 Ga0495664_0075431
1032 Ga0495584_0036368
1033 Ga0495584_0051033
1034 Ga0495584_0058466
1035 Ga0495584_0222802
1036 Ga0495585_0096196
1037 Ga0495585_0151149
1038 Ga0495594_0055829
1039 Ga0495594_0127037
1040 Ga0495596_0115179
1041 Ga0495608_0017571
1042 Ga0495616_0028595
1043 Ga0495618_0005523
1044 Ga0495618_0051354
1045 Ga0495618_0204176
1046 Ga0495628_0001017
1047 Ga0495630_0010058
1048 Ga0495630_0016771
1049 Ga0495630_0392982
1050 Ga0495631_0084238
1051 Ga0495632_0183229
1052 Ga0495663_0024695
1053 Ga0495652_0018292
1054 Ga0495652_0111095
1055 Ga0495652_0141755
1056 Ga0495665_0012704
1057 Ga0495665_0031211
1058 Ga0495665_0093094
1059 Ga0495640_0004293
1060 Ga0495640_0105647
1061 Ga0495640_0135641
1062 Ga0495640_0142989
1063 Ga0495640_0293192
1064 Ga0495640_0425263
1065 Ga0495586_0039095
1066 Ga0495587_0044036
1067 Ga0495598_0009022
1068 Ga0495598_0115616
1069 Ga0495645_0000755
1070 Ga0495645_0007548
1071 Ga0495667_0047645
1072 Ga0495667_0088746
1073 Ga0495656_0007560
1074 Ga0495656_0073291
1075 Ga0495656_0242227
1076 Ga0495668_0073927
1077 Ga0495634_0009596
1078 Ga0495634_0031970
1079 Ga0495634_0210798
1080 Ga0495635_0011446
1081 Ga0495635_0136862
1082 Ga0495635_0395960
1083 Ga0495659_0010287
1084 Ga0495659_0114169
1085 Ga0495659_0166995
1086 Ga0495661_0157463
1087 Ga0495657_0066003
1088 Ga0495657_0069857
1089 Ga0495599_0022534
1090 Ga0495599_0023249
1091 Ga0495623_0036071
1092 Ga0495623_0043430
1093 Ga0495646_0075126
1094 Ga0495646_0085487
1095 Ga0495646_0220665
1096 Ga0495647_0033851
1097 Ga0495658_0021800
1098 Ga0495658_0055176
1099 Ga0495658_0092051
1100 Ga0495658_0137552
1101 Ga0495658_0249103
1102 Ga0495613_0135338
1103 Ga0495613_0287107
1104 Ga0495624_0018677
1105 Ga0495624_0273925
1106 Ga0495670_0075909
1107 Ga0495670_0162430
1108 Ga0495671_0059351
1109 Ga0495600_0308292
1110 Ga0495581_0052501
1111 Ga0495581_0120893
1112 Ga0495581_0229598
1113 Ga0495581_0247078
1114 Ga0495604_0001877
1115 Ga0495674_0002324
1116 Ga0495674_0334206
1117 Ga0495674_0436158
1118 Ga0495674_0730028
1119 Ga0495676_0087145
1120 Ga0495676_0096105
1121 Ga0495680_0009331
1122 Ga0495680_0120374
1123 Ga0495680_0194249
1124 Ga0495683_0214671
1125 Ga0495675_0030388
1126 Ga0495675_0165243
1127 Ga0495673_0230337
1128 Ga0495684_0010444
1129 Ga0495684_0055774
1130 Ga0495684_0218236
1131 Ga0495684_0401536
1132 Ga0495593_0015344
1133 Ga0495593_0135461
1134 Ga0495602_0004680
1135 Ga0495602_0028483
1136 Ga0495602_0065784
1137 Ga0495602_0592064
1138 Ga0495614_0060132
1139 Ga0495614_0260342
1140 Ga0496100_0066055
1141 Ga0496100_0123553
1142 Ga0496101_0008638
1143 Ga0496101_0017034
1144 Ga0496101_0102046
1145 Ga0496102_0092181
1146 Ga0496102_0290648
1147 Ga0496102_0946421
1148 Ga0496103_0026782
1149 Ga0496103_0159603
1150 Ga0496104_0009679
1151 Ga0496104_0019228
1152 Ga0496104_0617336
1153 Ga0496104_0746765
1154 Ga0496104_1059508
1155 Ga0496105_0006188
1156 Ga0496105_0200206
1157 Ga0496105_0370233
1158 Ga0496106_0065432
1159 Ga0496106_0659891
1160 Ga0496107_0066071
1161 Ga0496107_0072734
1162 Ga0496107_0151606
1163 Ga0496108_0010545
1164 Ga0496108_0811923
1165 Ga0496109_0003915
1166 Ga0496109_0185329
1167 Ga0496110_0008900
1168 Ga0496110_0149162
1169 Ga0496110_0383418
1170 Ga0496111_0001479
1171 Ga0496111_0010409
1172 Ga0496111_0033040
1173 Ga0496112_0008782
1174 Ga0496112_0244846
1175 Ga0496112_0334523
1176 Ga0496113_0007626
1177 Ga0496113_0349749
1178 Ga0496114_0115240
1179 Ga0496114_0184502
1180 Ga0496115_0019005
1181 Ga0496115_0210703
1182 Ga0496115_0241533
1183 Ga0496115_0256179
1184 Ga0496115_0312817
1185 Ga0501033_0040611
1186 Ga0501034_0010727
1187 Ga0501036_0582654
1188 Ga0501038_0338493
1189 Ga0501040_0585019
1190 Ga0501042_0307818
1191 Ga0501042_0656294
1192 Ga0501043_0087119
1193 Ga0501043_0288854
1194 Ga0501047_0060458
1195 Ga0501047_0149641
1196 Ga0501047_0164624
1197 Ga0501070_0287856
1198 Ga0501070_0399032
1199 Ga0501070_0492707
1200 Ga0501071_0129386
1201 Ga0501072_0287579
1202 Ga0501074_0354582
1203 Ga0501075_0353411
1204 Ga0501076_0216830
1205 Ga0501077_0154806
1206 Ga0501077_0189565
1207 Ga0501077_0225017
1208 Ga0501077_0497802
1209 Ga0501080_0086831
1210 Ga0501080_0624320
1211 Ga0501081_0064464
1212 Ga0501035_0156559
1213 Ga0501044_0000457
1214 Ga0501044_0011578
1215 nmdc:mga03n38_66966_c1
1216 nmdc:mga00v17_185515_c2
1217 nmdc:mga00v17_67156_c1
1218 nmdc:mga0yw44_215290_c1
1219 nmdc:mga0yw44_4866_c1
1220 nmdc:mga05p37_104832_c1
1221 nmdc:mga05p37_11094_c1
1222 nmdc:mga05p37_140850_c1
1223 nmdc:mga05p37_315978_c1
1224 nmdc:mga09592_162655_c1
1225 nmdc:mga09592_8496_c1
1226 nmdc:mga0qj67_86119_c1
1227 nmdc:mga06r32_166776_c1
1228 nmdc:mga06r32_290783_c1
1229 nmdc:mga06r32_63540_c1
1230 nmdc:mga06r32_827928_c1
1231 nmdc:mga06r32_86736_c1
1232 nmdc:mga06r32_885073_c1
1233 nmdc:mga06r32_925502_c1
1234 nmdc:mga08y16_1429331_c1
1235 nmdc:mga08y16_154103_c1
1236 nmdc:mga08y16_203685_c1
1237 nmdc:mga08y16_805345_c1
1238 nmdc:mga0n895_11090_c1
1239 nmdc:mga0n895_14925_c1
1240 nmdc:mga0n895_376006_c1
1241 nmdc:mga0n895_450127_c1
1242 nmdc:mga0n895_704572_c1
1243 nmdc:mga0n895_92631_c1
1244 nmdc:mga0rr50_219789_c1
1245 nmdc:mga0rr50_240303_c1
1246 nmdc:mga0rr50_374159_c1
1247 nmdc:mga08x19_13285_c1
1248 nmdc:mga08x19_161230_c1
1249 nmdc:mga08x19_616576_c1
1250 nmdc:mga08x19_70955_c1
1251 nmdc:mga0a205_147097_c1
1252 nmdc:mga0a205_148336_c1
1253 nmdc:mga0a205_452754_c1
1254 Ga0495601_0000114
1255 Ga0495601_0000596
1256 Ga0495601_0063932
1257 Ga0495612_0000056
1258 Ga0495612_0001726
1259 Ga0495655_0110809
1260 Ga0495595_0005799
1261 Ga0495595_0157082
1262 Ga0495619_0004683
1263 Ga0495619_0004828
1264 Ga0495619_0027619
1265 Ga0495619_0036752
1266 Ga0495619_0041493
1267 Ga0495619_0747481
1268 Ga0500639_176405
1269 Ga0500657_163023
1270 Ga0501084_0047882
1271 Ga0501084_0766147
1272 Ga0530510_0041348

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01612

DNA_pol_A_exo1

3'-5' exonuclease

28

188

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7mpt-assembly2.cif.gz_B brucella melitensis nrnc with bound mg2+ 0.966 1 205
7mpt-assembly2.cif.gz_B brucella melitensis nrnc with bound mg2+ 0.9613 1 205
7mqf-assembly1.cif.gz_A bartonella henselae nrnc complexed with paaagg. d4 symmetry. 0.9604 1 205
7mqe-assembly1.cif.gz_K bartonella henselae nrnc complexed with pagg. c1 reconstruction. 0.9602 1 205
7mpr-assembly1.cif.gz_A brucella melitensis nrnc 0.9599 1 205
ID Description Score Start End Superfamily
1yt3A01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8962 14 189 3.30.420.10
af_Q8ILY1_1321_1641_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8697 19 188 3.30.420.10
af_A0A1D8PDF4_132_438_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8654 14 186 3.30.420.10
af_Q7XWZ1_19_204_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8513 20 165 3.30.420.10
af_C6T412_17_205_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8512 13 165 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A3D3SPQ2-F1-model_v4 deleted 0.9956 1 102
AF-A0A4R9VDI4-F1-model_v4 Ribonuclease D 0.9926 2 90 GO:0003676
GO:0006139
GO:0008408
AF-A0A3D3SPQ2-F1-model_v4 deleted 0.986 1 102
AF-A0A527IPP5-F1-model_v4 deleted 0.9703 1 58
AF-A0A3D5HY14-F1-model_v4 Ribonuclease D 0.9674 1 99 GO:0003676
GO:0006139
GO:0008408

Map