F471280

General Info

Members Datasets Scaffolds Average Seq Length
635 263 1270 100

Family's Representative Sequence

Representative Sequence 3300046475|Ga0495639_0120379|Ga0495639_0120379_34_393
Length 119
Sequence MAPRLTSKGEHASRFREGTLLHKTSRMAGYHLIADDGEVGHVDDFLVDEGTWTVRYLVVDTSNWIGGRSVLISAALVSGVDSSSRKIRARLTRAQLKDSPSIDEADIDLDETLPSIWIL

Samples

Sample ID Description Type Environment
1 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
2 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
113 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
164 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
165 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
166 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
167 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
168 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
169 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
170 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
171 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
172 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
174 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
176 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
177 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
178 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
179 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
180 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
181 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
182 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
183 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
184 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
185 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
186 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
187 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
189 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
190 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
191 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
194 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
195 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
196 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
197 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
198 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
199 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
200 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
201 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
202 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
203 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
204 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
205 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
206 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
207 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
208 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
209 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
210 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
211 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
212 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
213 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
214 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
215 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
216 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
217 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
218 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
219 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
220 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
221 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
222 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
223 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
224 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
225 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
226 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
227 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
228 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
229 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
230 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
231 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
232 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
233 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
234 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
235 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
236 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
237 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
238 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
242 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
243 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
244 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
245 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
246 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
247 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
248 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
249 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
251 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
252 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
253 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
254 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
255 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
256 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
257 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
258 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
259 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
260 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
261 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
262 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
263 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.74
Metatranscriptomes 1.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.15
Rhizosphere 96.06
Stem 0
Stem Tuber 0
Unclassified 32.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495639_0120379 3300046475 Unclassified 1252
2 Ga0006777J48905_1131418 3300003308 Unclassified 888
3 Ga0032354_1062552 3300003693 Unclassified 663
4 Ga0006780_1067982 3300003735 Unclassified 556
5 Ga0058863_11550020 3300004799 Unclassified 813
6 Ga0058863_11654415 3300004799 Bacteria 1393
7 Ga0058862_10105956 3300004803 Unclassified 762
8 Ga0058862_11843416 3300004803 Bacteria 703
9 Ga0058862_12851161 3300004803 Bacteria 1295
10 Ga0065712_10467987 3300005290 Bacteria 672
11 Ga0065715_10907546 3300005293 Bacteria 559
12 Ga0065715_11091117 3300005293 Unclassified 522
13 Ga0065707_10036018 3300005295 Bacteria 1378
14 Ga0065707_10184377 3300005295 Bacteria 1398
15 Ga0065707_10505689 3300005295 Bacteria 753
16 Ga0065707_10980374 3300005295 Unclassified 544
17 Ga0070658_10390273 3300005327 Bacteria 1195
18 Ga0070683_100154898 3300005329 Archaea 2173
19 Ga0070683_100324270 3300005329 Bacteria 1466
20 Ga0070690_100044951 3300005330 Bacteria 2805
21 Ga0070670_100124464 3300005331 Unclassified 2225
22 Ga0070677_10559223 3300005333 Unclassified 628
23 Ga0068869_101544445 3300005334 Bacteria 590
24 Ga0070666_10174212 3300005335 Bacteria 1507
25 Ga0070666_10505080 3300005335 Bacteria 877
26 Ga0070680_101691296 3300005336 Unclassified 548
27 Ga0070682_100194585 3300005337 Bacteria 1426
28 Ga0070682_101442350 3300005337 Bacteria 590
29 Ga0068868_100132033 3300005338 Bacteria 2044
30 Ga0068868_100760888 3300005338 Bacteria 871
31 Ga0068868_100803303 3300005338 Unclassified 849
32 Ga0068868_101583115 3300005338 Unclassified 615
33 Ga0068868_101758577 3300005338 Unclassified 585
34 Ga0068868_102014871 3300005338 Bacteria 548
35 Ga0070689_101835141 3300005340 Unclassified 553
36 Ga0070687_100211374 3300005343 Bacteria 1182
37 Ga0070661_100626547 3300005344 Unclassified 871
38 Ga0070661_100833598 3300005344 Bacteria 758
39 Ga0070669_100131782 3300005353 Bacteria 1919
40 Ga0070675_100475014 3300005354 Bacteria 1124
41 Ga0070675_100492686 3300005354 Bacteria 1103
42 Ga0070675_100913560 3300005354 Bacteria 805
43 Ga0070675_101000241 3300005354 Bacteria 768
44 Ga0070671_100020218 3300005355 Bacteria 5427
45 Ga0070671_100101528 3300005355 Bacteria 2413
46 Ga0070671_100943286 3300005355 Unclassified 755
47 Ga0070671_101227556 3300005355 Unclassified 660
48 Ga0070671_101243516 3300005355 Bacteria 656
49 Ga0070674_100094190 3300005356 Bacteria 2169
50 Ga0070674_100141163 3300005356 Unclassified 1808
51 Ga0070674_101154506 3300005356 Unclassified 686
52 Ga0070673_100095968 3300005364 Bacteria 2433
53 Ga0070673_100174204 3300005364 Unclassified 1838
54 Ga0070673_100268693 3300005364 Unclassified 1492
55 Ga0070673_100556725 3300005364 Bacteria 1042
56 Ga0070673_100983019 3300005364 Bacteria 785
57 Ga0070673_101156236 3300005364 Unclassified 724
58 Ga0070673_101247416 3300005364 Bacteria 697
59 Ga0070688_100226157 3300005365 Bacteria 1321
60 Ga0070688_101210159 3300005365 Unclassified 607
61 Ga0070688_101657851 3300005365 Unclassified 523
62 Ga0070659_100064528 3300005366 Bacteria 2898
63 Ga0070659_100551101 3300005366 Unclassified 987
64 Ga0070667_100005794 3300005367 Bacteria 10312
65 Ga0070667_102043386 3300005367 Bacteria 540
66 Ga0070709_10013842 3300005434 Bacteria 4547
67 Ga0070709_10743262 3300005434 Bacteria 766
68 Ga0070713_100274784 3300005436 Bacteria 1544
69 Ga0070710_10140157 3300005437 Bacteria 1482
70 Ga0070711_100320630 3300005439 Bacteria 1238
71 Ga0070711_100328790 3300005439 Unclassified 1223
72 Ga0070700_100345385 3300005441 Bacteria 1101
73 Ga0070700_100406256 3300005441 Unclassified 1025
74 Ga0070678_100035599 3300005456 Bacteria 3478
75 Ga0070678_100047200 3300005456 Bacteria 3093
76 Ga0070678_100057105 3300005456 Unclassified 2858
77 Ga0070678_100257043 3300005456 Bacteria 1467
78 Ga0070678_100739588 3300005456 Bacteria 889
79 Ga0070678_101379216 3300005456 Bacteria 657
80 Ga0070678_101740794 3300005456 Bacteria 587
81 Ga0070662_100460607 3300005457 Bacteria 1057
82 Ga0070662_101437991 3300005457 Bacteria 594
83 Ga0070662_101556127 3300005457 Unclassified 570
84 Ga0068867_100168029 3300005459 Bacteria 1735
85 Ga0068867_100347883 3300005459 Bacteria 1236
86 Ga0068867_100487265 3300005459 Unclassified 1057
87 Ga0070706_101185014 3300005467 Bacteria 702
88 Ga0070707_100092087 3300005468 Unclassified 2935
89 Ga0070707_100247154 3300005468 Bacteria 1736
90 Ga0070699_100111356 3300005518 Bacteria 2403
91 Ga0070699_100317293 3300005518 Bacteria 1400
92 Ga0070699_100587366 3300005518 Bacteria 1015
93 Ga0070679_100412505 3300005530 Unclassified 1296
94 Ga0070684_100006313 3300005535 Bacteria 9159
95 Ga0070684_101152017 3300005535 Bacteria 729
96 Ga0070697_100712519 3300005536 Unclassified 886
97 Ga0070697_100724262 3300005536 Unclassified 878
98 Ga0070697_100768566 3300005536 Bacteria 852
99 Ga0070697_100821334 3300005536 Unclassified 823
100 Ga0068853_101310965 3300005539 Unclassified 700
101 Ga0068853_101590771 3300005539 Unclassified 633
102 Ga0068853_101796402 3300005539 Unclassified 594
103 Ga0070672_100013225 3300005543 Bacteria 5821
104 Ga0070672_100086217 3300005543 Bacteria 2525
105 Ga0070672_100748021 3300005543 Unclassified 858
106 Ga0070686_100427030 3300005544 Bacteria 1014
107 Ga0070686_100458200 3300005544 Bacteria 982
108 Ga0070686_100729214 3300005544 Bacteria 793
109 Ga0070686_100816995 3300005544 Unclassified 752
110 Ga0070695_100450743 3300005545 Bacteria 986
111 Ga0070695_101069422 3300005545 Unclassified 659
112 Ga0070696_100242664 3300005546 Bacteria 1360
113 Ga0070693_100830928 3300005547 Bacteria 687
114 Ga0070665_100034985 3300005548 Bacteria 5053
115 Ga0070665_100045579 3300005548 Unclassified 4404
116 Ga0070665_100539217 3300005548 Bacteria 1179
117 Ga0070665_101083439 3300005548 Unclassified 813
118 Ga0070704_100559485 3300005549 Bacteria 1000
119 Ga0070704_101388320 3300005549 Bacteria 644
120 Ga0070664_100640766 3300005564 Unclassified 987
121 Ga0070664_101300877 3300005564 Bacteria 687
122 Ga0068854_100134775 3300005578 Bacteria 1890
123 Ga0068854_100182839 3300005578 Bacteria 1639
124 Ga0068856_102100051 3300005614 Unclassified 575
125 Ga0070702_100114030 3300005615 Bacteria 1681
126 Ga0070702_101056450 3300005615 Unclassified 646
127 Ga0070702_101367337 3300005615 Unclassified 578
128 Ga0068852_102254967 3300005616 Bacteria 566
129 Ga0068859_100227082 3300005617 Unclassified 1955
130 Ga0068859_100289768 3300005617 Bacteria 1730
131 Ga0068859_100318868 3300005617 Bacteria 1648
132 Ga0068864_100408872 3300005618 Unclassified 1291
133 Ga0068864_100487162 3300005618 Bacteria 1184
134 Ga0068864_100948421 3300005618 Unclassified 851
135 Ga0068866_10013850 3300005718 Unclassified 3547
136 Ga0068866_10609363 3300005718 Unclassified 738
137 Ga0068861_100044740 3300005719 Bacteria 3330
138 Ga0068861_100733734 3300005719 Bacteria 921
139 Ga0068861_101020318 3300005719 Unclassified 791
140 Ga0068861_101266722 3300005719 Unclassified 716
141 Ga0068851_10742392 3300005834 Unclassified 607
142 Ga0068851_10851560 3300005834 Bacteria 569
143 Ga0068870_10094569 3300005840 Bacteria 1677
144 Ga0068863_100008639 3300005841 Bacteria 9953
145 Ga0068863_101196819 3300005841 Unclassified 766
146 Ga0068858_100003770 3300005842 Bacteria 14981
147 Ga0068858_100016474 3300005842 Bacteria 6940
148 Ga0068858_100367550 3300005842 Unclassified 1379
149 Ga0068858_100490129 3300005842 Bacteria 1187
150 Ga0068860_100023121 3300005843 Bacteria 6010
151 Ga0068860_100072811 3300005843 Bacteria 3266
152 Ga0068860_100093824 3300005843 Unclassified 2861
153 Ga0068860_100241642 3300005843 Bacteria 1757
154 Ga0068860_100310438 3300005843 Unclassified 1546
155 Ga0068860_100455645 3300005843 Bacteria 1272
156 Ga0068860_100794003 3300005843 Bacteria 960
157 Ga0068862_101342053 3300005844 Bacteria 717
158 Ga0068862_102179905 3300005844 Unclassified 565
159 Ga0081455_10071680 3300005937 Unclassified 2871
160 Ga0081540_1290016 3300005983 Unclassified 563
161 Ga0070717_10040800 3300006028 Unclassified 3782
162 Ga0075432_10251045 3300006058 Bacteria 718
163 Ga0070715_10071519 3300006163 Unclassified 1551
164 Ga0070715_10133628 3300006163 Unclassified 1197
165 Ga0070716_100344660 3300006173 Bacteria 1052
166 Ga0070716_100681992 3300006173 Bacteria 783
167 Ga0097621_100014300 3300006237 Bacteria 5936
168 Ga0097621_100035767 3300006237 Bacteria 3970
169 Ga0097621_100047421 3300006237 Bacteria 3482
170 Ga0097621_100052689 3300006237 Bacteria 3315
171 Ga0097621_100160396 3300006237 Unclassified 1933
172 Ga0097621_100245269 3300006237 Bacteria 1567
173 Ga0097621_100885487 3300006237 Bacteria 831
174 Ga0097621_101127067 3300006237 Unclassified 737
175 Ga0097621_101257371 3300006237 Bacteria 698
176 Ga0097621_101899907 3300006237 Unclassified 568
177 Ga0068871_100000586 3300006358 Bacteria 25004
178 Ga0068871_100000804 3300006358 Bacteria 21099
179 Ga0068871_100022228 3300006358 Bacteria 4890
180 Ga0068871_100066849 3300006358 Bacteria 2947
181 Ga0068871_100083184 3300006358 Unclassified 2654
182 Ga0068871_100101837 3300006358 Unclassified 2407
183 Ga0068871_100127528 3300006358 Bacteria 2155
184 Ga0068871_100167950 3300006358 Bacteria 1879
185 Ga0068871_100207176 3300006358 Bacteria 1695
186 Ga0068871_100524900 3300006358 Bacteria 1070
187 Ga0068871_100800690 3300006358 Bacteria 869
188 Ga0068871_100864087 3300006358 Bacteria 837
189 Ga0068871_101033841 3300006358 Bacteria 766
190 Ga0068871_101640623 3300006358 Unclassified 609
191 Ga0075428_100036037 3300006844 Bacteria 5452
192 Ga0075428_100053851 3300006844 Bacteria 4409
193 Ga0075431_100039522 3300006847 Bacteria 4859
194 Ga0075431_100119850 3300006847 Bacteria 2715
195 Ga0075431_100521577 3300006847 Bacteria 1178
196 Ga0075433_10041462 3300006852 Bacteria 3989
197 Ga0075433_10059895 3300006852 Bacteria 3332
198 Ga0075433_10423466 3300006852 Bacteria 1174
199 Ga0075433_11732055 3300006852 Bacteria 538
200 Ga0075434_100017416 3300006871 Bacteria 6924
201 Ga0075434_100090196 3300006871 Bacteria 3067
202 Ga0075434_100393898 3300006871 Bacteria 1406
203 Ga0075434_100754156 3300006871 Unclassified 990
204 Ga0075434_100821215 3300006871 Bacteria 945
205 Ga0075434_100890080 3300006871 Unclassified 905
206 Ga0075434_101000165 3300006871 Unclassified 850
207 Ga0075434_101271227 3300006871 Unclassified 747
208 Ga0075429_100037658 3300006880 Bacteria 4211
209 Ga0075429_100215353 3300006880 Bacteria 1683
210 Ga0075429_100236511 3300006880 Bacteria 1600
211 Ga0068865_100082476 3300006881 Unclassified 2311
212 Ga0068865_100521750 3300006881 Bacteria 993
213 Ga0068865_100896760 3300006881 Unclassified 771
214 Ga0075436_100121011 3300006914 Unclassified 1831
215 Ga0075436_100157292 3300006914 Unclassified 1601
216 Ga0075436_100377302 3300006914 Bacteria 1025
217 Ga0097620_100227064 3300006931 Unclassified 1955
218 Ga0097620_100289809 3300006931 Bacteria 1730
219 Ga0097620_100318844 3300006931 Bacteria 1648
220 Ga0075435_100007064 3300007076 Bacteria 7971
221 Ga0075435_100008312 3300007076 Bacteria 7438
222 Ga0075435_100022344 3300007076 Bacteria 4881
223 Ga0075435_100078115 3300007076 Bacteria 2714
224 Ga0075435_100131732 3300007076 Bacteria 2092
225 Ga0075435_100209216 3300007076 Bacteria 1654
226 Ga0075435_100230377 3300007076 Unclassified 1574
227 Ga0075435_100286137 3300007076 Bacteria 1408
228 Ga0075435_100510139 3300007076 Bacteria 1040
229 Ga0075435_101285289 3300007076 Unclassified 641
230 Ga0105250_10531067 3300009092 Bacteria 537
231 Ga0105240_10088027 3300009093 Bacteria 3801
232 Ga0111539_10009567 3300009094 Bacteria 12231
233 Ga0105245_10032789 3300009098 Unclassified 4599
234 Ga0105245_10093140 3300009098 Bacteria 2776
235 Ga0105245_10219648 3300009098 Bacteria 1833
236 Ga0105245_11167973 3300009098 Unclassified 817
237 Ga0105245_11873348 3300009098 Unclassified 653
238 Ga0105247_11202710 3300009101 Bacteria 603
239 Ga0114129_10003350 3300009147 Bacteria 22510
240 Ga0114129_10040528 3300009147 Bacteria 6566
241 Ga0114129_10044392 3300009147 Bacteria 6252
242 Ga0114129_10136270 3300009147 Bacteria 3368
243 Ga0114129_10163113 3300009147 Bacteria 3043
244 Ga0114129_10302519 3300009147 Bacteria 2131
245 Ga0114129_10898963 3300009147 Bacteria 1122
246 Ga0114129_11486698 3300009147 Unclassified 833
247 Ga0114129_13002992 3300009147 Unclassified 555
248 Ga0105243_10597578 3300009148 Bacteria 1062
249 Ga0105243_12284386 3300009148 Bacteria 578
250 Ga0105242_10000631 3300009176 Bacteria 27615
251 Ga0105242_10020633 3300009176 Bacteria 5169
252 Ga0105242_10087794 3300009176 Bacteria 2611
253 Ga0105242_10479348 3300009176 Bacteria 1179
254 Ga0105248_10002729 3300009177 Bacteria 19614
255 Ga0105248_10008512 3300009177 Bacteria 11265
256 Ga0105248_10026945 3300009177 Bacteria 6391
257 Ga0105248_10039884 3300009177 Bacteria 5264
258 Ga0105248_10145113 3300009177 Bacteria 2678
259 Ga0105248_10237551 3300009177 Unclassified 2051
260 Ga0105248_10332749 3300009177 Bacteria 1710
261 Ga0105248_10352549 3300009177 Bacteria 1657
262 Ga0105248_10503845 3300009177 Bacteria 1365
263 Ga0105248_11033585 3300009177 Unclassified 928
264 Ga0105248_11977802 3300009177 Bacteria 662
265 Ga0105238_10316823 3300009551 Unclassified 1545
266 Ga0105238_10878376 3300009551 Unclassified 914
267 Ga0105238_11318452 3300009551 Unclassified 748
268 Ga0105249_10238403 3300009553 Bacteria 1797
269 Ga0105249_10974684 3300009553 Unclassified 916
270 Ga0105249_11152030 3300009553 Unclassified 846
271 Ga0105239_12904389 3300010375 Unclassified 559
272 Ga0105246_11487722 3300011119 Unclassified 635
273 Ga0157338_1060248 3300012515 Unclassified 568
274 Ga0157371_11185731 3300013102 Unclassified 588
275 Ga0157370_11298245 3300013104 Bacteria 656
276 Ga0157369_12147188 3300013105 Bacteria 566
277 Ga0157374_10408703 3300013296 Bacteria 1355
278 Ga0157374_10713051 3300013296 Bacteria 1017
279 Ga0157378_10005809 3300013297 Bacteria 10817
280 Ga0157378_10032192 3300013297 Bacteria 4633
281 Ga0157378_10719676 3300013297 Bacteria 1019
282 Ga0163162_10145953 3300013306 Unclassified 2482
283 Ga0163162_10279960 3300013306 Bacteria 1800
284 Ga0163162_10428553 3300013306 Bacteria 1455
285 Ga0163162_10563569 3300013306 Bacteria 1267
286 Ga0163162_12139589 3300013306 Unclassified 642
287 Ga0157372_10277133 3300013307 Bacteria 1950
288 Ga0157375_10294366 3300013308 Bacteria 1786
289 Ga0157375_10323923 3300013308 Bacteria 1706
290 Ga0157375_10478510 3300013308 Unclassified 1410
291 Ga0157375_10763303 3300013308 Bacteria 1118
292 Ga0163163_10108786 3300014325 Bacteria 2799
293 Ga0163163_10300884 3300014325 Unclassified 1656
294 Ga0163163_11001265 3300014325 Unclassified 899
295 Ga0163163_12149795 3300014325 Unclassified 617
296 Ga0157380_11635079 3300014326 Unclassified 700
297 Ga0157377_10514156 3300014745 Unclassified 839
298 Ga0157379_10017929 3300014968 Bacteria 6237
299 Ga0157379_10029916 3300014968 Unclassified 4844
300 Ga0157379_10054359 3300014968 Bacteria 3577
301 Ga0157379_11435956 3300014968 Bacteria 670
302 Ga0157376_10026203 3300014969 Bacteria 4604
303 Ga0157376_10059025 3300014969 Bacteria 3216
304 Ga0157376_10251418 3300014969 Bacteria 1651
305 Ga0157376_10383183 3300014969 Bacteria 1355
306 Ga0157376_10701771 3300014969 Unclassified 1017
307 Ga0157376_10848971 3300014969 Unclassified 928
308 Ga0157376_10965377 3300014969 Unclassified 873
309 Ga0157376_10986227 3300014969 Bacteria 864
310 Ga0157376_11529970 3300014969 Unclassified 700
311 Ga0157376_11766036 3300014969 Unclassified 654
312 Ga0182005_1121922 3300015265 Bacteria 743
313 Ga0213876_10275709 3300021384 Unclassified 894
314 Ga0207656_10178948 3300025321 Bacteria 1017
315 Ga0207682_10151153 3300025893 Bacteria 1047
316 Ga0207642_10498042 3300025899 Unclassified 745
317 Ga0207710_10139513 3300025900 Bacteria 1170
318 Ga0207710_10453423 3300025900 Unclassified 662
319 Ga0207688_10535750 3300025901 Bacteria 735
320 Ga0207680_10169450 3300025903 Bacteria 1470
321 Ga0207680_10252863 3300025903 Bacteria 1218
322 Ga0207685_10108585 3300025905 Unclassified 1199
323 Ga0207699_10149895 3300025906 Bacteria 1542
324 Ga0207643_10088426 3300025908 Bacteria 1803
325 Ga0207643_10517346 3300025908 Unclassified 764
326 Ga0207705_10213577 3300025909 Unclassified 1464
327 Ga0207695_10146581 3300025913 Bacteria 2304
328 Ga0207663_10287858 3300025916 Unclassified 1223
329 Ga0207649_10601013 3300025920 Bacteria 846
330 Ga0207652_10359752 3300025921 Unclassified 1314
331 Ga0207646_10242896 3300025922 Bacteria 1627
332 Ga0207646_10246792 3300025922 Bacteria 1613
333 Ga0207646_10683232 3300025922 Bacteria 918
334 Ga0207681_10327483 3300025923 Bacteria 1220
335 Ga0207681_11679608 3300025923 Unclassified 531
336 Ga0207650_10119997 3300025925 Bacteria 2046
337 Ga0207650_10327138 3300025925 Bacteria 1256
338 Ga0207650_10356872 3300025925 Unclassified 1204
339 Ga0207659_10613172 3300025926 Bacteria 928
340 Ga0207659_11430244 3300025926 Bacteria 592
341 Ga0207687_10173707 3300025927 Bacteria 1664
342 Ga0207687_10909143 3300025927 Bacteria 753
343 Ga0207687_11020456 3300025927 Bacteria 710
344 Ga0207700_10020373 3300025928 Unclassified 4503
345 Ga0207700_11676941 3300025928 Unclassified 561
346 Ga0207644_10235392 3300025931 Bacteria 1456
347 Ga0207644_10816996 3300025931 Unclassified 780
348 Ga0207644_11064019 3300025931 Unclassified 680
349 Ga0207644_11092371 3300025931 Unclassified 670
350 Ga0207690_10081448 3300025932 Bacteria 2262
351 Ga0207706_11182248 3300025933 Unclassified 636
352 Ga0207686_10005808 3300025934 Bacteria 6621
353 Ga0207686_10015730 3300025934 Unclassified 4236
354 Ga0207686_10132770 3300025934 Unclassified 1710
355 Ga0207686_10291986 3300025934 Bacteria 1208
356 Ga0207709_10249651 3300025935 Bacteria 1295
357 Ga0207669_10031615 3300025937 Unclassified 2960
358 Ga0207669_10579880 3300025937 Bacteria 909
359 Ga0207669_11183204 3300025937 Unclassified 647
360 Ga0207704_10004129 3300025938 Bacteria 6619
361 Ga0207704_10222716 3300025938 Bacteria 1397
362 Ga0207704_10350838 3300025938 Bacteria 1149
363 Ga0207665_10452738 3300025939 Bacteria 985
364 Ga0207691_10018945 3300025940 Bacteria 6520
365 Ga0207691_10038926 3300025940 Bacteria 4400
366 Ga0207711_10005622 3300025941 Bacteria 10601
367 Ga0207711_10029708 3300025941 Bacteria 4611
368 Ga0207711_10035605 3300025941 Bacteria 4221
369 Ga0207711_10207254 3300025941 Bacteria 1790
370 Ga0207711_10222992 3300025941 Bacteria 1725
371 Ga0207711_10281952 3300025941 Bacteria 1530
372 Ga0207711_10360071 3300025941 Bacteria 1348
373 Ga0207711_11066819 3300025941 Unclassified 748
374 Ga0207689_10340297 3300025942 Bacteria 1246
375 Ga0207661_10197253 3300025944 Bacteria 1768
376 Ga0207679_10506562 3300025945 Bacteria 1078
377 Ga0207679_11338129 3300025945 Bacteria 657
378 Ga0207651_10029234 3300025960 Bacteria 3489
379 Ga0207651_10047792 3300025960 Unclassified 2888
380 Ga0207651_10095508 3300025960 Bacteria 2189
381 Ga0207651_10179856 3300025960 Unclassified 1677
382 Ga0207651_10237574 3300025960 Bacteria 1483
383 Ga0207651_10809961 3300025960 Unclassified 831
384 Ga0207651_10812421 3300025960 Bacteria 829
385 Ga0207651_10922405 3300025960 Bacteria 778
386 Ga0207640_10201920 3300025981 Bacteria 1507
387 Ga0207640_10561992 3300025981 Bacteria 960
388 Ga0207640_11238465 3300025981 Unclassified 664
389 Ga0207658_10021338 3300025986 Bacteria 4495
390 Ga0207658_11161402 3300025986 Bacteria 706
391 Ga0207677_10370448 3300026023 Bacteria 1206
392 Ga0207677_10559581 3300026023 Bacteria 998
393 Ga0207677_10659715 3300026023 Unclassified 924
394 Ga0207677_10855718 3300026023 Unclassified 817
395 Ga0207677_11558700 3300026023 Unclassified 611
396 Ga0207677_11755282 3300026023 Unclassified 576
397 Ga0207703_10010012 3300026035 Bacteria 7432
398 Ga0207703_10134109 3300026035 Bacteria 2142
399 Ga0207703_10144745 3300026035 Bacteria 2066
400 Ga0207703_10421951 3300026035 Bacteria 1241
401 Ga0207639_10336356 3300026041 Bacteria 1345
402 Ga0207708_10262273 3300026075 Bacteria 1395
403 Ga0207708_10536273 3300026075 Unclassified 985
404 Ga0207708_11223262 3300026075 Unclassified 657
405 Ga0207641_10006482 3300026088 Bacteria 9855
406 Ga0207641_10260299 3300026088 Unclassified 1624
407 Ga0207648_10077624 3300026089 Bacteria 2896
408 Ga0207648_10236667 3300026089 Bacteria 1625
409 Ga0207648_10713008 3300026089 Bacteria 930
410 Ga0207648_10760278 3300026089 Bacteria 900
411 Ga0207676_10184053 3300026095 Bacteria 1832
412 Ga0207675_100510615 3300026118 Bacteria 1197
413 Ga0207675_100673861 3300026118 Unclassified 1041
414 Ga0207675_100776704 3300026118 Bacteria 970
415 Ga0207675_101132436 3300026118 Unclassified 802
416 Ga0207683_10067997 3300026121 Bacteria 3143
417 Ga0207683_10188714 3300026121 Unclassified 1871
418 Ga0207683_10233193 3300026121 Bacteria 1679
419 Ga0207683_10481814 3300026121 Bacteria 1145
420 Ga0207683_10485559 3300026121 Bacteria 1140
421 Ga0207683_10729455 3300026121 Bacteria 919
422 Ga0207683_10884208 3300026121 Unclassified 830
423 Ga0207698_12632277 3300026142 Bacteria 512
424 Ga0268266_10039913 3300028379 Bacteria 3999
425 Ga0268266_10082865 3300028379 Unclassified 2798
426 Ga0268266_10340517 3300028379 Bacteria 1408
427 Ga0268265_10195142 3300028380 Bacteria 1752
428 Ga0268265_11794575 3300028380 Unclassified 620
429 Ga0268264_10028298 3300028381 Bacteria 4583
430 Ga0268264_10057603 3300028381 Bacteria 3250
431 Ga0268264_10149980 3300028381 Unclassified 2089
432 Ga0268264_10165164 3300028381 Bacteria 1998
433 Ga0268264_10468434 3300028381 Bacteria 1223
434 Ga0268264_10630019 3300028381 Unclassified 1059
435 Ga0268264_11036735 3300028381 Bacteria 828
436 Ga0373950_0004435 3300034818 Bacteria 2055
437 Ga0373958_0030637 3300034819 Bacteria 1053
438 Ga0373959_0008030 3300034820 Bacteria 1785
439 Ga0373938_0001105 3300034957 Bacteria 4338
440 Ga0373929_0001053 3300035085 Bacteria 5351
441 Ga0373940_0008514 3300035088 Bacteria 2356
442 Ga0373944_0208816 3300035089 Bacteria 709
443 Ga0373949_0003331 3300035090 Bacteria 3857
444 Ga0373951_0000591 3300035091 Bacteria 9999
445 Ga0373923_0160708 3300035111 Bacteria 1025
446 Ga0373932_0001366 3300035112 Bacteria 6837
447 Ga0373932_0073427 3300035112 Bacteria 1066
448 Ga0373936_0032447 3300035113 Bacteria 2066
449 Ga0373936_0125073 3300035113 Unclassified 1101
450 Ga0373939_0000680 3300035114 Bacteria 8446
451 Ga0373941_0000118 3300035115 Bacteria 13479
452 Ga0373945_0095884 3300035116 Bacteria 1155
453 Ga0373953_0024944 3300035117 Bacteria 2279
454 Ga0373953_0366047 3300035117 Unclassified 633
455 Ga0373953_0540081 3300035117 Unclassified 518
456 Ga0373956_0071011 3300035119 Unclassified 1589
457 Ga0373956_0624990 3300035119 Bacteria 514
458 Ga0373957_0456064 3300035120 Bacteria 554
459 Ga0373946_0008434 3300035171 Bacteria 3780
460 Ga0373946_0011492 3300035171 Bacteria 3305
461 Ga0373955_0014873 3300035172 Unclassified 3797
462 Ga0373955_0039307 3300035172 Bacteria 2525
463 Ga0373955_0373426 3300035172 Bacteria 865
464 Ga0373955_0566840 3300035172 Bacteria 695
465 Ga0373955_0812812 3300035172 Unclassified 575
466 Ga0373942_0001342 3300035207 Bacteria 6377
467 Ga0373962_0012024 3300035242 Bacteria 2176
468 Ga0373924_0188666 3300035410 Bacteria 908
469 Ga0373931_0625937 3300035691 Bacteria 705
470 Ga0373935_0000564 3300035692 Bacteria 19309
471 Ga0373935_0038489 3300035692 Unclassified 2995
472 Ga0373935_0282965 3300035692 Bacteria 1168
473 Ga0373935_0659776 3300035692 Bacteria 768
474 Ga0373927_0197780 3300035695 Bacteria 1319
475 Ga0373933_0170772 3300035724 Bacteria 1384
476 Ga0373947_0010098 3300035725 Bacteria 5420
477 Ga0373947_0078477 3300035725 Bacteria 2038
478 Ga0373937_0064032 3300036401 Bacteria 3382
479 Ga0373937_0143110 3300036401 Unclassified 2238
480 Ga0373937_0207921 3300036401 Bacteria 1841
481 Ga0373937_0251304 3300036401 Bacteria 1667
482 Ga0373937_0361955 3300036401 Unclassified 1375
483 Ga0373925_0010981 3300037068 Bacteria 6575
484 Ga0373925_0046601 3300037068 Bacteria 3224
485 Ga0373925_0255713 3300037068 Bacteria 1406
486 Ga0373925_0702310 3300037068 Unclassified 834
487 Ga0242420_086993 3300038996 Unclassified 652
488 Ga0436365_0293774 3300039437 Bacteria 1376
489 Ga0436365_1567296 3300039437 Unclassified 526
490 Ga0451807_2192514 3300041486 Bacteria 868
491 Ga0451853_0062120 3300041512 Unclassified 509
492 Ga0451853_0698930 3300041512 Bacteria 730
493 Ga0439448_0252149 3300042005 Unclassified 623
494 Ga0439435_0013965 3300042436 Bacteria 1977
495 Ga0451576_0046764 3300045051 Bacteria 4555
496 Ga0495592_0163756 3300046454 Bacteria 1528
497 Ga0495592_0566463 3300046454 Unclassified 697
498 Ga0495603_0233663 3300046455 Bacteria 1060
499 Ga0495629_0034366 3300046459 Bacteria 3585
500 Ga0495629_0079221 3300046459 Bacteria 2294
501 Ga0495653_0459417 3300046463 Bacteria 800
502 Ga0495580_0024511 3300046472 Bacteria 4415
503 Ga0495580_0068851 3300046472 Bacteria 2474
504 Ga0495580_0124547 3300046472 Bacteria 1789
505 Ga0495580_0351098 3300046472 Bacteria 999
506 Ga0495582_0170970 3300046473 Bacteria 1237
507 Ga0495582_0171385 3300046473 Bacteria 1236
508 Ga0495639_0087908 3300046475 Bacteria 1455
509 Ga0495662_0611806 3300046476 Bacteria 533
510 Ga0495664_0340979 3300046477 Unclassified 903
511 Ga0495664_0468294 3300046477 Unclassified 754
512 Ga0495594_0283278 3300046499 Bacteria 944
513 Ga0495594_0632609 3300046499 Bacteria 606
514 Ga0495608_0013010 3300046511 Bacteria 5773
515 Ga0495608_0032170 3300046511 Bacteria 3545
516 Ga0495618_0289462 3300046514 Unclassified 1020
517 Ga0495628_0010417 3300046516 Bacteria 7897
518 Ga0495628_0029330 3300046516 Bacteria 4462
519 Ga0495628_0589578 3300046516 Unclassified 795
520 Ga0495630_0004794 3300046517 Bacteria 9490
521 Ga0495630_0059556 3300046517 Unclassified 2865
522 Ga0495630_0424112 3300046517 Bacteria 1019
523 Ga0495630_0662673 3300046517 Bacteria 799
524 Ga0495630_0806104 3300046517 Unclassified 717
525 Ga0495652_0705877 3300046529 Bacteria 678
526 Ga0495640_0386316 3300046533 Bacteria 861
527 Ga0495640_0587301 3300046533 Unclassified 673
528 Ga0495586_0069376 3300046535 Bacteria 1924
529 Ga0495586_0172555 3300046535 Bacteria 1222
530 Ga0495587_0040626 3300046536 Bacteria 2779
531 Ga0495645_0404271 3300046543 Bacteria 869
532 Ga0495645_0954066 3300046543 Bacteria 506
533 Ga0495667_0299776 3300046559 Bacteria 1018
534 Ga0495667_1029119 3300046559 Unclassified 501
535 Ga0495656_0491476 3300046615 Bacteria 650
536 Ga0495634_0807992 3300046642 Unclassified 534
537 Ga0495635_0337015 3300046663 Bacteria 1008
538 Ga0495635_0614036 3300046663 Unclassified 709
539 Ga0495635_0787412 3300046663 Unclassified 613
540 Ga0495657_0170466 3300046675 Unclassified 1341
541 Ga0495657_0182951 3300046675 Bacteria 1285
542 Ga0495657_0193914 3300046675 Bacteria 1241
543 Ga0495599_0108916 3300046678 Bacteria 1726
544 Ga0495599_0425839 3300046678 Unclassified 788
545 Ga0495623_0194504 3300046679 Bacteria 1170
546 Ga0495646_0440062 3300046680 Bacteria 674
547 Ga0495647_0480252 3300046681 Unclassified 577
548 Ga0495647_0490159 3300046681 Unclassified 571
549 Ga0495658_0155748 3300046683 Bacteria 1406
550 Ga0495658_0182430 3300046683 Bacteria 1303
551 Ga0495658_0233866 3300046683 Unclassified 1153
552 Ga0495669_0002699 3300046684 Bacteria 7275
553 Ga0495613_0000620 3300046689 Bacteria 28244
554 Ga0495613_0001497 3300046689 Bacteria 17775
555 Ga0495600_0669686 3300046809 Unclassified 626
556 Ga0495581_0131438 3300047315 Unclassified 1458
557 Ga0495604_0018574 3300047317 Bacteria 5570
558 Ga0495604_0067667 3300047317 Bacteria 2713
559 Ga0495674_0012205 3300047319 Bacteria 8095
560 Ga0495674_0046279 3300047319 Bacteria 3862
561 Ga0495680_0616452 3300047322 Unclassified 725
562 Ga0495680_0642407 3300047322 Unclassified 706
563 Ga0495684_0000424 3300047471 Bacteria 34540
564 Ga0495684_0001428 3300047471 Bacteria 19144
565 Ga0495602_0140185 3300048088 Unclassified 1915
566 Ga0495614_0492352 3300048089 Unclassified 583
567 Ga0496100_0002494 3300048903 Bacteria 9366
568 Ga0496101_0000737 3300048904 Bacteria 19491
569 Ga0496101_0272808 3300048904 Bacteria 1321
570 Ga0496102_0472069 3300048905 Unclassified 1176
571 Ga0496104_0001418 3300048907 Bacteria 20761
572 Ga0496104_0106185 3300048907 Unclassified 2691
573 Ga0496104_1424889 3300048907 Unclassified 596
574 Ga0496105_0113388 3300048908 Unclassified 2237
575 Ga0496105_0294429 3300048908 Bacteria 1306
576 Ga0496105_0435381 3300048908 Unclassified 1037
577 Ga0496106_0333889 3300048909 Bacteria 1217
578 Ga0496106_0521382 3300048909 Unclassified 954
579 Ga0496107_0101328 3300048910 Unclassified 2111
580 Ga0496107_0277306 3300048910 Bacteria 1248
581 Ga0496108_0424248 3300048911 Bacteria 1162
582 Ga0496109_0526304 3300048912 Bacteria 1116
583 Ga0496109_0893526 3300048912 Bacteria 826
584 Ga0496114_0000213 3300048917 Bacteria 42383
585 Ga0496114_0310539 3300048917 Bacteria 1393
586 Ga0501298_105476 3300049521 Bacteria 648
587 Ga0501036_0146073 3300049572 Bacteria 1995
588 Ga0501076_1164013 3300049592 Bacteria 635
589 Ga0501249_160920 3300049679 Bacteria 570
590 Ga0501081_1058948 3300049743 Bacteria 613
591 nmdc:mga05p37_103713_c1 3300050507 Bacteria 3499
592 nmdc:mga05p37_107114_c1 3300050507 Unclassified 3439
593 nmdc:mga05p37_11201_c1 3300050507 Bacteria 10660
594 nmdc:mga05p37_198603_c1 3300050507 Bacteria 1216
595 nmdc:mga05p37_288171_c1 3300050507 Bacteria 1955
596 nmdc:mga05p37_53896_c1 3300050507 Bacteria 4948
597 nmdc:mga09592_131213_c1 3300050508 Bacteria 2156
598 nmdc:mga09592_255197_c1 3300050508 Bacteria 1520
599 nmdc:mga09592_538937_c1 3300050508 Bacteria 1003
600 nmdc:mga09592_775914_c1 3300050508 Unclassified 812
601 nmdc:mga06r32_320580_c1 3300050510 Unclassified 1535
602 nmdc:mga06r32_471411_c1 3300050510 Unclassified 1234
603 nmdc:mga08y16_13061_c1 3300050511 Bacteria 8737
604 nmdc:mga0n895_1336347_c1 3300050512 Unclassified 687
605 nmdc:mga0n895_170935_c1 3300050512 Bacteria 2205
606 nmdc:mga0n895_303516_c1 3300050512 Bacteria 1618
607 nmdc:mga0n895_387724_c1 3300050512 Unclassified 1413
608 nmdc:mga0n895_455882_c1 3300050512 Bacteria 1291
609 nmdc:mga0n895_760380_c1 3300050512 Bacteria 961
610 nmdc:mga0n895_81313_c1 3300050512 Bacteria 3229
611 nmdc:mga0n895_890047_c1 3300050512 Unclassified 876
612 nmdc:mga0n895_95087_c1 3300050512 Bacteria 2984
613 nmdc:mga0rr50_1288339_c1 3300050513 Bacteria 620
614 nmdc:mga0rr50_16306_c1 3300050513 Bacteria 4930
615 nmdc:mga0rr50_235835_c1 3300050513 Bacteria 1515
616 nmdc:mga0rr50_320381_c1 3300050513 Bacteria 1300
617 nmdc:mga0rr50_8902_c1 3300050513 Bacteria 6271
618 nmdc:mga0rr50_911698_c1 3300050513 Bacteria 749
619 nmdc:mga0rr50_97477_c1 3300050513 Bacteria 2303
620 nmdc:mga08x19_15941_c1 3300050514 Bacteria 4578
621 nmdc:mga08x19_282311_c1 3300050514 Unclassified 1151
622 nmdc:mga08x19_52639_c1 3300050514 Bacteria 2619
623 nmdc:mga0a205_1093730_c1 3300050515 Bacteria 644
624 nmdc:mga0a205_110055_c1 3300050515 Bacteria 2653
625 nmdc:mga0a205_5856_c1 3300050515 Bacteria 11069
626 Ga0495601_0000732 3300053077 Bacteria 17669
627 Ga0495601_0001231 3300053077 Bacteria 14047
628 Ga0495601_0049682 3300053077 Bacteria 2645
629 Ga0495595_0060777 3300053084 Bacteria 1769
630 Ga0495595_0262024 3300053084 Bacteria 866
631 Ga0495619_0002028 3300053085 Bacteria 13458
632 Ga0495619_0003691 3300053085 Bacteria 9869
633 Ga0495619_0122894 3300053085 Bacteria 1780
634 Ga0495619_0209207 3300053085 Bacteria 1351
635 Ga0495619_0620068 3300053085 Bacteria 739
636 Ga0495639_0120379
637 Ga0006777J48905_1131418
638 Ga0032354_1062552
639 Ga0006780_1067982
640 Ga0058863_11550020
641 Ga0058863_11654415
642 Ga0058862_10105956
643 Ga0058862_11843416
644 Ga0058862_12851161
645 Ga0065712_10467987
646 Ga0065715_10907546
647 Ga0065715_11091117
648 Ga0065707_10036018
649 Ga0065707_10184377
650 Ga0065707_10505689
651 Ga0065707_10980374
652 Ga0070658_10390273
653 Ga0070683_100154898
654 Ga0070683_100324270
655 Ga0070690_100044951
656 Ga0070670_100124464
657 Ga0070677_10559223
658 Ga0068869_101544445
659 Ga0070666_10174212
660 Ga0070666_10505080
661 Ga0070680_101691296
662 Ga0070682_100194585
663 Ga0070682_101442350
664 Ga0068868_100132033
665 Ga0068868_100760888
666 Ga0068868_100803303
667 Ga0068868_101583115
668 Ga0068868_101758577
669 Ga0068868_102014871
670 Ga0070689_101835141
671 Ga0070687_100211374
672 Ga0070661_100626547
673 Ga0070661_100833598
674 Ga0070669_100131782
675 Ga0070675_100475014
676 Ga0070675_100492686
677 Ga0070675_100913560
678 Ga0070675_101000241
679 Ga0070671_100020218
680 Ga0070671_100101528
681 Ga0070671_100943286
682 Ga0070671_101227556
683 Ga0070671_101243516
684 Ga0070674_100094190
685 Ga0070674_100141163
686 Ga0070674_101154506
687 Ga0070673_100095968
688 Ga0070673_100174204
689 Ga0070673_100268693
690 Ga0070673_100556725
691 Ga0070673_100983019
692 Ga0070673_101156236
693 Ga0070673_101247416
694 Ga0070688_100226157
695 Ga0070688_101210159
696 Ga0070688_101657851
697 Ga0070659_100064528
698 Ga0070659_100551101
699 Ga0070667_100005794
700 Ga0070667_102043386
701 Ga0070709_10013842
702 Ga0070709_10743262
703 Ga0070713_100274784
704 Ga0070710_10140157
705 Ga0070711_100320630
706 Ga0070711_100328790
707 Ga0070700_100345385
708 Ga0070700_100406256
709 Ga0070678_100035599
710 Ga0070678_100047200
711 Ga0070678_100057105
712 Ga0070678_100257043
713 Ga0070678_100739588
714 Ga0070678_101379216
715 Ga0070678_101740794
716 Ga0070662_100460607
717 Ga0070662_101437991
718 Ga0070662_101556127
719 Ga0068867_100168029
720 Ga0068867_100347883
721 Ga0068867_100487265
722 Ga0070706_101185014
723 Ga0070707_100092087
724 Ga0070707_100247154
725 Ga0070699_100111356
726 Ga0070699_100317293
727 Ga0070699_100587366
728 Ga0070679_100412505
729 Ga0070684_100006313
730 Ga0070684_101152017
731 Ga0070697_100712519
732 Ga0070697_100724262
733 Ga0070697_100768566
734 Ga0070697_100821334
735 Ga0068853_101310965
736 Ga0068853_101590771
737 Ga0068853_101796402
738 Ga0070672_100013225
739 Ga0070672_100086217
740 Ga0070672_100748021
741 Ga0070686_100427030
742 Ga0070686_100458200
743 Ga0070686_100729214
744 Ga0070686_100816995
745 Ga0070695_100450743
746 Ga0070695_101069422
747 Ga0070696_100242664
748 Ga0070693_100830928
749 Ga0070665_100034985
750 Ga0070665_100045579
751 Ga0070665_100539217
752 Ga0070665_101083439
753 Ga0070704_100559485
754 Ga0070704_101388320
755 Ga0070664_100640766
756 Ga0070664_101300877
757 Ga0068854_100134775
758 Ga0068854_100182839
759 Ga0068856_102100051
760 Ga0070702_100114030
761 Ga0070702_101056450
762 Ga0070702_101367337
763 Ga0068852_102254967
764 Ga0068859_100227082
765 Ga0068859_100289768
766 Ga0068859_100318868
767 Ga0068864_100408872
768 Ga0068864_100487162
769 Ga0068864_100948421
770 Ga0068866_10013850
771 Ga0068866_10609363
772 Ga0068861_100044740
773 Ga0068861_100733734
774 Ga0068861_101020318
775 Ga0068861_101266722
776 Ga0068851_10742392
777 Ga0068851_10851560
778 Ga0068870_10094569
779 Ga0068863_100008639
780 Ga0068863_101196819
781 Ga0068858_100003770
782 Ga0068858_100016474
783 Ga0068858_100367550
784 Ga0068858_100490129
785 Ga0068860_100023121
786 Ga0068860_100072811
787 Ga0068860_100093824
788 Ga0068860_100241642
789 Ga0068860_100310438
790 Ga0068860_100455645
791 Ga0068860_100794003
792 Ga0068862_101342053
793 Ga0068862_102179905
794 Ga0081455_10071680
795 Ga0081540_1290016
796 Ga0070717_10040800
797 Ga0075432_10251045
798 Ga0070715_10071519
799 Ga0070715_10133628
800 Ga0070716_100344660
801 Ga0070716_100681992
802 Ga0097621_100014300
803 Ga0097621_100035767
804 Ga0097621_100047421
805 Ga0097621_100052689
806 Ga0097621_100160396
807 Ga0097621_100245269
808 Ga0097621_100885487
809 Ga0097621_101127067
810 Ga0097621_101257371
811 Ga0097621_101899907
812 Ga0068871_100000586
813 Ga0068871_100000804
814 Ga0068871_100022228
815 Ga0068871_100066849
816 Ga0068871_100083184
817 Ga0068871_100101837
818 Ga0068871_100127528
819 Ga0068871_100167950
820 Ga0068871_100207176
821 Ga0068871_100524900
822 Ga0068871_100800690
823 Ga0068871_100864087
824 Ga0068871_101033841
825 Ga0068871_101640623
826 Ga0075428_100036037
827 Ga0075428_100053851
828 Ga0075431_100039522
829 Ga0075431_100119850
830 Ga0075431_100521577
831 Ga0075433_10041462
832 Ga0075433_10059895
833 Ga0075433_10423466
834 Ga0075433_11732055
835 Ga0075434_100017416
836 Ga0075434_100090196
837 Ga0075434_100393898
838 Ga0075434_100754156
839 Ga0075434_100821215
840 Ga0075434_100890080
841 Ga0075434_101000165
842 Ga0075434_101271227
843 Ga0075429_100037658
844 Ga0075429_100215353
845 Ga0075429_100236511
846 Ga0068865_100082476
847 Ga0068865_100521750
848 Ga0068865_100896760
849 Ga0075436_100121011
850 Ga0075436_100157292
851 Ga0075436_100377302
852 Ga0097620_100227064
853 Ga0097620_100289809
854 Ga0097620_100318844
855 Ga0075435_100007064
856 Ga0075435_100008312
857 Ga0075435_100022344
858 Ga0075435_100078115
859 Ga0075435_100131732
860 Ga0075435_100209216
861 Ga0075435_100230377
862 Ga0075435_100286137
863 Ga0075435_100510139
864 Ga0075435_101285289
865 Ga0105250_10531067
866 Ga0105240_10088027
867 Ga0111539_10009567
868 Ga0105245_10032789
869 Ga0105245_10093140
870 Ga0105245_10219648
871 Ga0105245_11167973
872 Ga0105245_11873348
873 Ga0105247_11202710
874 Ga0114129_10003350
875 Ga0114129_10040528
876 Ga0114129_10044392
877 Ga0114129_10136270
878 Ga0114129_10163113
879 Ga0114129_10302519
880 Ga0114129_10898963
881 Ga0114129_11486698
882 Ga0114129_13002992
883 Ga0105243_10597578
884 Ga0105243_12284386
885 Ga0105242_10000631
886 Ga0105242_10020633
887 Ga0105242_10087794
888 Ga0105242_10479348
889 Ga0105248_10002729
890 Ga0105248_10008512
891 Ga0105248_10026945
892 Ga0105248_10039884
893 Ga0105248_10145113
894 Ga0105248_10237551
895 Ga0105248_10332749
896 Ga0105248_10352549
897 Ga0105248_10503845
898 Ga0105248_11033585
899 Ga0105248_11977802
900 Ga0105238_10316823
901 Ga0105238_10878376
902 Ga0105238_11318452
903 Ga0105249_10238403
904 Ga0105249_10974684
905 Ga0105249_11152030
906 Ga0105239_12904389
907 Ga0105246_11487722
908 Ga0157338_1060248
909 Ga0157371_11185731
910 Ga0157370_11298245
911 Ga0157369_12147188
912 Ga0157374_10408703
913 Ga0157374_10713051
914 Ga0157378_10005809
915 Ga0157378_10032192
916 Ga0157378_10719676
917 Ga0163162_10145953
918 Ga0163162_10279960
919 Ga0163162_10428553
920 Ga0163162_10563569
921 Ga0163162_12139589
922 Ga0157372_10277133
923 Ga0157375_10294366
924 Ga0157375_10323923
925 Ga0157375_10478510
926 Ga0157375_10763303
927 Ga0163163_10108786
928 Ga0163163_10300884
929 Ga0163163_11001265
930 Ga0163163_12149795
931 Ga0157380_11635079
932 Ga0157377_10514156
933 Ga0157379_10017929
934 Ga0157379_10029916
935 Ga0157379_10054359
936 Ga0157379_11435956
937 Ga0157376_10026203
938 Ga0157376_10059025
939 Ga0157376_10251418
940 Ga0157376_10383183
941 Ga0157376_10701771
942 Ga0157376_10848971
943 Ga0157376_10965377
944 Ga0157376_10986227
945 Ga0157376_11529970
946 Ga0157376_11766036
947 Ga0182005_1121922
948 Ga0213876_10275709
949 Ga0207656_10178948
950 Ga0207682_10151153
951 Ga0207642_10498042
952 Ga0207710_10139513
953 Ga0207710_10453423
954 Ga0207688_10535750
955 Ga0207680_10169450
956 Ga0207680_10252863
957 Ga0207685_10108585
958 Ga0207699_10149895
959 Ga0207643_10088426
960 Ga0207643_10517346
961 Ga0207705_10213577
962 Ga0207695_10146581
963 Ga0207663_10287858
964 Ga0207649_10601013
965 Ga0207652_10359752
966 Ga0207646_10242896
967 Ga0207646_10246792
968 Ga0207646_10683232
969 Ga0207681_10327483
970 Ga0207681_11679608
971 Ga0207650_10119997
972 Ga0207650_10327138
973 Ga0207650_10356872
974 Ga0207659_10613172
975 Ga0207659_11430244
976 Ga0207687_10173707
977 Ga0207687_10909143
978 Ga0207687_11020456
979 Ga0207700_10020373
980 Ga0207700_11676941
981 Ga0207644_10235392
982 Ga0207644_10816996
983 Ga0207644_11064019
984 Ga0207644_11092371
985 Ga0207690_10081448
986 Ga0207706_11182248
987 Ga0207686_10005808
988 Ga0207686_10015730
989 Ga0207686_10132770
990 Ga0207686_10291986
991 Ga0207709_10249651
992 Ga0207669_10031615
993 Ga0207669_10579880
994 Ga0207669_11183204
995 Ga0207704_10004129
996 Ga0207704_10222716
997 Ga0207704_10350838
998 Ga0207665_10452738
999 Ga0207691_10018945
1000 Ga0207691_10038926
1001 Ga0207711_10005622
1002 Ga0207711_10029708
1003 Ga0207711_10035605
1004 Ga0207711_10207254
1005 Ga0207711_10222992
1006 Ga0207711_10281952
1007 Ga0207711_10360071
1008 Ga0207711_11066819
1009 Ga0207689_10340297
1010 Ga0207661_10197253
1011 Ga0207679_10506562
1012 Ga0207679_11338129
1013 Ga0207651_10029234
1014 Ga0207651_10047792
1015 Ga0207651_10095508
1016 Ga0207651_10179856
1017 Ga0207651_10237574
1018 Ga0207651_10809961
1019 Ga0207651_10812421
1020 Ga0207651_10922405
1021 Ga0207640_10201920
1022 Ga0207640_10561992
1023 Ga0207640_11238465
1024 Ga0207658_10021338
1025 Ga0207658_11161402
1026 Ga0207677_10370448
1027 Ga0207677_10559581
1028 Ga0207677_10659715
1029 Ga0207677_10855718
1030 Ga0207677_11558700
1031 Ga0207677_11755282
1032 Ga0207703_10010012
1033 Ga0207703_10134109
1034 Ga0207703_10144745
1035 Ga0207703_10421951
1036 Ga0207639_10336356
1037 Ga0207708_10262273
1038 Ga0207708_10536273
1039 Ga0207708_11223262
1040 Ga0207641_10006482
1041 Ga0207641_10260299
1042 Ga0207648_10077624
1043 Ga0207648_10236667
1044 Ga0207648_10713008
1045 Ga0207648_10760278
1046 Ga0207676_10184053
1047 Ga0207675_100510615
1048 Ga0207675_100673861
1049 Ga0207675_100776704
1050 Ga0207675_101132436
1051 Ga0207683_10067997
1052 Ga0207683_10188714
1053 Ga0207683_10233193
1054 Ga0207683_10481814
1055 Ga0207683_10485559
1056 Ga0207683_10729455
1057 Ga0207683_10884208
1058 Ga0207698_12632277
1059 Ga0268266_10039913
1060 Ga0268266_10082865
1061 Ga0268266_10340517
1062 Ga0268265_10195142
1063 Ga0268265_11794575
1064 Ga0268264_10028298
1065 Ga0268264_10057603
1066 Ga0268264_10149980
1067 Ga0268264_10165164
1068 Ga0268264_10468434
1069 Ga0268264_10630019
1070 Ga0268264_11036735
1071 Ga0373950_0004435
1072 Ga0373958_0030637
1073 Ga0373959_0008030
1074 Ga0373938_0001105
1075 Ga0373929_0001053
1076 Ga0373940_0008514
1077 Ga0373944_0208816
1078 Ga0373949_0003331
1079 Ga0373951_0000591
1080 Ga0373923_0160708
1081 Ga0373932_0001366
1082 Ga0373932_0073427
1083 Ga0373936_0032447
1084 Ga0373936_0125073
1085 Ga0373939_0000680
1086 Ga0373941_0000118
1087 Ga0373945_0095884
1088 Ga0373953_0024944
1089 Ga0373953_0366047
1090 Ga0373953_0540081
1091 Ga0373956_0071011
1092 Ga0373956_0624990
1093 Ga0373957_0456064
1094 Ga0373946_0008434
1095 Ga0373946_0011492
1096 Ga0373955_0014873
1097 Ga0373955_0039307
1098 Ga0373955_0373426
1099 Ga0373955_0566840
1100 Ga0373955_0812812
1101 Ga0373942_0001342
1102 Ga0373962_0012024
1103 Ga0373924_0188666
1104 Ga0373931_0625937
1105 Ga0373935_0000564
1106 Ga0373935_0038489
1107 Ga0373935_0282965
1108 Ga0373935_0659776
1109 Ga0373927_0197780
1110 Ga0373933_0170772
1111 Ga0373947_0010098
1112 Ga0373947_0078477
1113 Ga0373937_0064032
1114 Ga0373937_0143110
1115 Ga0373937_0207921
1116 Ga0373937_0251304
1117 Ga0373937_0361955
1118 Ga0373925_0010981
1119 Ga0373925_0046601
1120 Ga0373925_0255713
1121 Ga0373925_0702310
1122 Ga0242420_086993
1123 Ga0436365_0293774
1124 Ga0436365_1567296
1125 Ga0451807_2192514
1126 Ga0451853_0062120
1127 Ga0451853_0698930
1128 Ga0439448_0252149
1129 Ga0439435_0013965
1130 Ga0451576_0046764
1131 Ga0495592_0163756
1132 Ga0495592_0566463
1133 Ga0495603_0233663
1134 Ga0495629_0034366
1135 Ga0495629_0079221
1136 Ga0495653_0459417
1137 Ga0495580_0024511
1138 Ga0495580_0068851
1139 Ga0495580_0124547
1140 Ga0495580_0351098
1141 Ga0495582_0170970
1142 Ga0495582_0171385
1143 Ga0495639_0087908
1144 Ga0495662_0611806
1145 Ga0495664_0340979
1146 Ga0495664_0468294
1147 Ga0495594_0283278
1148 Ga0495594_0632609
1149 Ga0495608_0013010
1150 Ga0495608_0032170
1151 Ga0495618_0289462
1152 Ga0495628_0010417
1153 Ga0495628_0029330
1154 Ga0495628_0589578
1155 Ga0495630_0004794
1156 Ga0495630_0059556
1157 Ga0495630_0424112
1158 Ga0495630_0662673
1159 Ga0495630_0806104
1160 Ga0495652_0705877
1161 Ga0495640_0386316
1162 Ga0495640_0587301
1163 Ga0495586_0069376
1164 Ga0495586_0172555
1165 Ga0495587_0040626
1166 Ga0495645_0404271
1167 Ga0495645_0954066
1168 Ga0495667_0299776
1169 Ga0495667_1029119
1170 Ga0495656_0491476
1171 Ga0495634_0807992
1172 Ga0495635_0337015
1173 Ga0495635_0614036
1174 Ga0495635_0787412
1175 Ga0495657_0170466
1176 Ga0495657_0182951
1177 Ga0495657_0193914
1178 Ga0495599_0108916
1179 Ga0495599_0425839
1180 Ga0495623_0194504
1181 Ga0495646_0440062
1182 Ga0495647_0480252
1183 Ga0495647_0490159
1184 Ga0495658_0155748
1185 Ga0495658_0182430
1186 Ga0495658_0233866
1187 Ga0495669_0002699
1188 Ga0495613_0000620
1189 Ga0495613_0001497
1190 Ga0495600_0669686
1191 Ga0495581_0131438
1192 Ga0495604_0018574
1193 Ga0495604_0067667
1194 Ga0495674_0012205
1195 Ga0495674_0046279
1196 Ga0495680_0616452
1197 Ga0495680_0642407
1198 Ga0495684_0000424
1199 Ga0495684_0001428
1200 Ga0495602_0140185
1201 Ga0495614_0492352
1202 Ga0496100_0002494
1203 Ga0496101_0000737
1204 Ga0496101_0272808
1205 Ga0496102_0472069
1206 Ga0496104_0001418
1207 Ga0496104_0106185
1208 Ga0496104_1424889
1209 Ga0496105_0113388
1210 Ga0496105_0294429
1211 Ga0496105_0435381
1212 Ga0496106_0333889
1213 Ga0496106_0521382
1214 Ga0496107_0101328
1215 Ga0496107_0277306
1216 Ga0496108_0424248
1217 Ga0496109_0526304
1218 Ga0496109_0893526
1219 Ga0496114_0000213
1220 Ga0496114_0310539
1221 Ga0501298_105476
1222 Ga0501036_0146073
1223 Ga0501076_1164013
1224 Ga0501249_160920
1225 Ga0501081_1058948
1226 nmdc:mga05p37_103713_c1
1227 nmdc:mga05p37_107114_c1
1228 nmdc:mga05p37_11201_c1
1229 nmdc:mga05p37_198603_c1
1230 nmdc:mga05p37_288171_c1
1231 nmdc:mga05p37_53896_c1
1232 nmdc:mga09592_131213_c1
1233 nmdc:mga09592_255197_c1
1234 nmdc:mga09592_538937_c1
1235 nmdc:mga09592_775914_c1
1236 nmdc:mga06r32_320580_c1
1237 nmdc:mga06r32_471411_c1
1238 nmdc:mga08y16_13061_c1
1239 nmdc:mga0n895_1336347_c1
1240 nmdc:mga0n895_170935_c1
1241 nmdc:mga0n895_303516_c1
1242 nmdc:mga0n895_387724_c1
1243 nmdc:mga0n895_455882_c1
1244 nmdc:mga0n895_760380_c1
1245 nmdc:mga0n895_81313_c1
1246 nmdc:mga0n895_890047_c1
1247 nmdc:mga0n895_95087_c1
1248 nmdc:mga0rr50_1288339_c1
1249 nmdc:mga0rr50_16306_c1
1250 nmdc:mga0rr50_235835_c1
1251 nmdc:mga0rr50_320381_c1
1252 nmdc:mga0rr50_8902_c1
1253 nmdc:mga0rr50_911698_c1
1254 nmdc:mga0rr50_97477_c1
1255 nmdc:mga08x19_15941_c1
1256 nmdc:mga08x19_282311_c1
1257 nmdc:mga08x19_52639_c1
1258 nmdc:mga0a205_1093730_c1
1259 nmdc:mga0a205_110055_c1
1260 nmdc:mga0a205_5856_c1
1261 Ga0495601_0000732
1262 Ga0495601_0001231
1263 Ga0495601_0049682
1264 Ga0495595_0060777
1265 Ga0495595_0262024
1266 Ga0495619_0002028
1267 Ga0495619_0003691
1268 Ga0495619_0122894
1269 Ga0495619_0209207
1270 Ga0495619_0620068

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05239

PRC

PRC-barrel domain

24

96

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5b5n-assembly2.cif.gz_t crystal structure of the ba-substituted lh1-rc complex from tch. tepidum 0.891 8 70
1pm3-assembly1.cif.gz_A mth1859 0.8596 1 71
7xxf-assembly1.cif.gz_H structure of photosynthetic lh1-rc super-complex of rhodopila globiformis 0.8474 8 82
4ac5-assembly1.cif.gz_H lipidic sponge phase crystal structure of the bl. viridis reaction centre solved using serial femtosecond crystallography 0.8446 9 77
7c9r-assembly1.cif.gz_H structure of photosynthetic lh1-rc super-complex of thiorhodovibrio strain 970 0.8415 8 83
ID Description Score Start End Superfamily
1pm3A00 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.8596 1 71 2.30.30.240
af_Q58326_3_78_2.30.30.240 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.8562 3 71 2.30.30.240
af_Q10LU9_128_201_2.30.30.240 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.8404 7 71 2.30.30.240
1pm3B00 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.84 1 71 2.30.30.240
af_Q58518_6_77_2.30.30.240 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.8358 6 73 2.30.30.240
ID Description Score Start End GO Terms
AF-A0A126Z8T5-F1-model_v4 PRC-barrel domain-containing protein 0.983 5 84 GO:0019684
GO:0030077
GO:0045156
AF-A0A521IEH7-F1-model_v4 PRC-barrel domain containing protein 0.9822 6 82 GO:0019684
GO:0030077
GO:0045156
AF-A0A7C5B1V4-F1-model_v4 PRC-barrel domain containing protein 0.982 5 81 GO:0019684
GO:0030077
GO:0045156
AF-A0A495J730-F1-model_v4 PRC-barrel domain protein 0.9771 5 82 GO:0019684
GO:0030077
GO:0045156
AF-A0A7W4BP35-F1-model_v4 PRC-barrel domain containing protein 0.9737 3 82 GO:0019684
GO:0030077
GO:0045156

Map