F471263
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 635 | 341 | 587 | 296 |
Family's Representative Sequence
| Representative Sequence | 3300021388|Ga0213875_10038893|Ga0213875_100388931 |
| Length | 343 |
| Sequence | VAGLRGKRQLIGPDREAEQTPPLPRCSSDRDRTTATPSFAARYADPMRPALSDYQHLASGKVRELYRIDGDYLLFVASDRISAFDHVLDGLIPDKGRILTAMSVFFFELVEAPNHLAGPPDDPRIPDEVLGRALVVRQLEMVPVECVARGYLTGSGLLDYEQTGKVCGISLPPGLCEASRFSSPLFTPATKAELGHHDQNISFVEVIKMVGGVRANQLRDRTLQTYVQAADHALKRGIIIADTKFEFGIDAHDNLVLADEIFTPDSSRYWPANNYRAGEVQVSFDKQFVRNWLTGPESGWDRKGSQPPPPLPENIIDATRARYINAYERISGLRFDDWIGPGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 2 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 3 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 4 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 5 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 6 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 7 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 8 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 9 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 10 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 11 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 12 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 13 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 14 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 15 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 16 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 17 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 18 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 19 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 20 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 21 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 22 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 23 | 2842888712 | Tsukamurella sp. R-71941 | Isolate | Unclassified |
| 24 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 25 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 26 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 27 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 28 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 29 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 30 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 31 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 32 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 33 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 34 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 35 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 36 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 37 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 38 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 39 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 40 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 41 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 42 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 43 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 44 | 2956939328 | Lolliginicoccus suaedae LNNU 331112 | Isolate | Rhizosphere |
| 45 | 2974315732 | Rhodococcus sp. SORGH_AS 301 | Isolate | Unclassified |
| 46 | 2984523437 | Rhodococcus sp. SORGH_AS303 | Isolate | Aerial Root |
| 47 | 3001119090 | Lolliginicoccus lacisalsi G463 | Isolate | Rhizosphere |
| 48 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 49 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 50 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 51 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 53 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 54 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 56 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 57 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 79 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 83 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 84 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 89 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 91 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 92 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 93 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 94 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 95 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 96 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 97 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 98 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 99 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 100 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 102 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 103 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 104 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 105 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 106 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 107 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 108 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 109 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 111 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 112 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 113 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 114 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 115 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 116 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 117 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 118 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 119 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 121 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 134 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 149 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 150 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 201 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 202 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 203 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 204 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 205 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 206 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 207 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 208 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 209 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 210 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 211 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 212 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 213 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 214 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 215 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 216 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 217 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 218 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 219 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 220 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 221 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 222 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 223 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 224 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 225 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 226 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 227 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 230 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 231 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 232 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 233 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 234 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 235 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 236 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 237 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 238 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 239 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 240 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 241 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 242 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 243 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 244 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 245 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 246 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 247 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 248 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 249 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 250 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 251 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 277 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 278 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 279 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 280 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 281 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 282 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 285 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 286 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 287 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 288 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 289 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 290 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 291 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 292 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 293 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 294 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 295 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 296 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 297 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 298 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 299 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 300 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 301 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 316 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 317 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 318 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 319 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 320 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 321 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 331 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 333 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 334 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 335 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 336 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 337 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 338 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 339 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 340 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 341 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.44 |
| Metatranscriptomes | 0 |
| Isolates | 7.56 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.16 |
| Bulb | 0 |
| Endosphere | 11.97 |
| Nodule | 0.16 |
| Rhizoplane | 11.34 |
| Rhizosphere | 62.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24744J21845_10000674 | 3300002077 | Bacteria | 6251 |
| 2 | JGI24744J21845_10009096 | 3300002077 | Bacteria | 2041 |
| 3 | JGI24742J22300_10001092 | 3300002244 | Bacteria | 4204 |
| 4 | Ga0055540_1000071 | 3300003792 | Bacteria | 117607 |
| 5 | Ga0055540_1001892 | 3300003792 | Bacteria | 11725 |
| 6 | Ga0055540_1004083 | 3300003792 | Bacteria | 6766 |
| 7 | Ga0055540_1006412 | 3300003792 | Bacteria | 4678 |
| 8 | Ga0070683_100126889 | 3300005329 | Bacteria | 2412 |
| 9 | Ga0070690_100189339 | 3300005330 | Bacteria | 1426 |
| 10 | Ga0068869_100023810 | 3300005334 | Bacteria | 4236 |
| 11 | Ga0070682_100024647 | 3300005337 | Bacteria | 3583 |
| 12 | Ga0068868_100000247 | 3300005338 | Bacteria | 36780 |
| 13 | Ga0068868_100212692 | 3300005338 | Bacteria | 1616 |
| 14 | Ga0070689_100035103 | 3300005340 | Bacteria | 3830 |
| 15 | Ga0070689_100035692 | 3300005340 | Bacteria | 3800 |
| 16 | Ga0070687_100101596 | 3300005343 | Bacteria | 1611 |
| 17 | Ga0070692_10031155 | 3300005345 | Bacteria | 2672 |
| 18 | Ga0070668_100001215 | 3300005347 | Bacteria | 18315 |
| 19 | Ga0070668_100005003 | 3300005347 | Bacteria | 9819 |
| 20 | Ga0070669_100005981 | 3300005353 | Bacteria | 8779 |
| 21 | Ga0070669_100071087 | 3300005353 | Bacteria | 2574 |
| 22 | Ga0070675_100030390 | 3300005354 | Bacteria | 4362 |
| 23 | Ga0070671_100000923 | 3300005355 | Bacteria | 21454 |
| 24 | Ga0070671_100148547 | 3300005355 | Bacteria | 1979 |
| 25 | Ga0070674_100001479 | 3300005356 | Bacteria | 12527 |
| 26 | Ga0070674_100017589 | 3300005356 | Bacteria | 4502 |
| 27 | Ga0070673_100159190 | 3300005364 | Bacteria | 1919 |
| 28 | Ga0070667_100000535 | 3300005367 | Bacteria | 37853 |
| 29 | Ga0070667_100001027 | 3300005367 | Bacteria | 25488 |
| 30 | Ga0070667_100008266 | 3300005367 | Bacteria | 8624 |
| 31 | Ga0070709_10061049 | 3300005434 | Bacteria | 2398 |
| 32 | Ga0070714_100001783 | 3300005435 | Bacteria | 15668 |
| 33 | Ga0070714_100139451 | 3300005435 | Bacteria | 2175 |
| 34 | Ga0070713_100062771 | 3300005436 | Bacteria | 3112 |
| 35 | Ga0070710_10000045 | 3300005437 | Bacteria | 57765 |
| 36 | Ga0070710_10013147 | 3300005437 | Bacteria | 4136 |
| 37 | Ga0070701_10000386 | 3300005438 | Bacteria | 14839 |
| 38 | Ga0070711_100227277 | 3300005439 | Bacteria | 1453 |
| 39 | Ga0070711_100273759 | 3300005439 | Bacteria | 1333 |
| 40 | Ga0070705_100017328 | 3300005440 | Bacteria | 3760 |
| 41 | Ga0070700_100002202 | 3300005441 | Bacteria | 9906 |
| 42 | Ga0070694_100014961 | 3300005444 | Bacteria | 4861 |
| 43 | Ga0070708_100352123 | 3300005445 | Bacteria | 1388 |
| 44 | Ga0070663_100027896 | 3300005455 | Bacteria | 3839 |
| 45 | Ga0070662_100025252 | 3300005457 | Bacteria | 4101 |
| 46 | Ga0068867_100036729 | 3300005459 | Bacteria | 3558 |
| 47 | Ga0070706_100018794 | 3300005467 | Bacteria | 6372 |
| 48 | Ga0070706_100095369 | 3300005467 | Bacteria | 2761 |
| 49 | Ga0070698_100032141 | 3300005471 | Bacteria | 5437 |
| 50 | Ga0070697_100341626 | 3300005536 | Bacteria | 1292 |
| 51 | Ga0068853_100001631 | 3300005539 | Bacteria | 16398 |
| 52 | Ga0068853_100006430 | 3300005539 | Bacteria | 9337 |
| 53 | Ga0070686_100282491 | 3300005544 | Bacteria | 1225 |
| 54 | Ga0070695_100003191 | 3300005545 | Bacteria | 9567 |
| 55 | Ga0070696_100066824 | 3300005546 | Bacteria | 2522 |
| 56 | Ga0070665_100020021 | 3300005548 | Bacteria | 6719 |
| 57 | Ga0070665_100029960 | 3300005548 | Bacteria | 5477 |
| 58 | Ga0070665_100085885 | 3300005548 | Bacteria | 3152 |
| 59 | Ga0070704_100003757 | 3300005549 | Bacteria | 8741 |
| 60 | Ga0068854_100005222 | 3300005578 | Bacteria | 8191 |
| 61 | Ga0070702_100002393 | 3300005615 | Bacteria | 8076 |
| 62 | Ga0070702_100011901 | 3300005615 | Bacteria | 4340 |
| 63 | Ga0068852_100098908 | 3300005616 | Bacteria | 2628 |
| 64 | Ga0068859_100001716 | 3300005617 | Bacteria | 22359 |
| 65 | Ga0068859_100002325 | 3300005617 | Bacteria | 19318 |
| 66 | Ga0068859_100313470 | 3300005617 | Bacteria | 1662 |
| 67 | Ga0068864_100275426 | 3300005618 | Bacteria | 1569 |
| 68 | Ga0068866_10000253 | 3300005718 | Bacteria | 25012 |
| 69 | Ga0068866_10019371 | 3300005718 | Bacteria | 3096 |
| 70 | Ga0068866_10090344 | 3300005718 | Bacteria | 1666 |
| 71 | Ga0068861_100077078 | 3300005719 | Bacteria | 2599 |
| 72 | Ga0068863_100000143 | 3300005841 | Bacteria | 75127 |
| 73 | Ga0068863_100004971 | 3300005841 | Bacteria | 13106 |
| 74 | Ga0068858_100002178 | 3300005842 | Bacteria | 19860 |
| 75 | Ga0068858_100004006 | 3300005842 | Bacteria | 14538 |
| 76 | Ga0068858_100024382 | 3300005842 | Bacteria | 5636 |
| 77 | Ga0068860_100000079 | 3300005843 | Bacteria | 170752 |
| 78 | Ga0068860_100003457 | 3300005843 | Bacteria | 16245 |
| 79 | Ga0068860_100249927 | 3300005843 | Bacteria | 1727 |
| 80 | Ga0068862_100000093 | 3300005844 | Bacteria | 106838 |
| 81 | Ga0081455_10176697 | 3300005937 | Bacteria | 1621 |
| 82 | Ga0081455_10322534 | 3300005937 | Bacteria | 1100 |
| 83 | Ga0070717_10061722 | 3300006028 | Bacteria | 3107 |
| 84 | Ga0075365_10011313 | 3300006038 | Bacteria | 5242 |
| 85 | Ga0075365_10013099 | 3300006038 | Bacteria | 4946 |
| 86 | Ga0075365_10022237 | 3300006038 | Bacteria | 3971 |
| 87 | Ga0075365_10027954 | 3300006038 | Bacteria | 3592 |
| 88 | Ga0075365_10029657 | 3300006038 | Bacteria | 3499 |
| 89 | Ga0075365_10038215 | 3300006038 | Bacteria | 3119 |
| 90 | Ga0075365_10327337 | 3300006038 | Bacteria | 1079 |
| 91 | Ga0075363_100001910 | 3300006048 | Bacteria | 8247 |
| 92 | Ga0075363_100016373 | 3300006048 | Bacteria | 3662 |
| 93 | Ga0075363_100031557 | 3300006048 | Bacteria | 2748 |
| 94 | Ga0075363_100121744 | 3300006048 | Bacteria | 1457 |
| 95 | Ga0075364_10002940 | 3300006051 | Bacteria | 9607 |
| 96 | Ga0075364_10003555 | 3300006051 | Bacteria | 8873 |
| 97 | Ga0075364_10005526 | 3300006051 | Bacteria | 7356 |
| 98 | Ga0075364_10035612 | 3300006051 | Bacteria | 3217 |
| 99 | Ga0075364_10105021 | 3300006051 | Bacteria | 1882 |
| 100 | Ga0075364_10145323 | 3300006051 | Bacteria | 1597 |
| 101 | Ga0070716_100017229 | 3300006173 | Bacteria | 3741 |
| 102 | Ga0070716_100105601 | 3300006173 | Bacteria | 1736 |
| 103 | Ga0070716_100166035 | 3300006173 | Bacteria | 1435 |
| 104 | Ga0070712_100000630 | 3300006175 | Bacteria | 20763 |
| 105 | Ga0070712_100541810 | 3300006175 | Bacteria | 980 |
| 106 | Ga0075362_10005065 | 3300006177 | Bacteria | 4790 |
| 107 | Ga0075362_10042218 | 3300006177 | Bacteria | 2015 |
| 108 | Ga0075367_10012202 | 3300006178 | Bacteria | 4571 |
| 109 | Ga0075367_10027541 | 3300006178 | Bacteria | 3234 |
| 110 | Ga0075369_10000029 | 3300006186 | Bacteria | 39213 |
| 111 | Ga0075369_10010587 | 3300006186 | Bacteria | 3610 |
| 112 | Ga0075369_10046806 | 3300006186 | Bacteria | 1864 |
| 113 | Ga0075369_10118654 | 3300006186 | Bacteria | 1196 |
| 114 | Ga0097621_100021985 | 3300006237 | Bacteria | 4944 |
| 115 | Ga0075370_10001915 | 3300006353 | Bacteria | 9369 |
| 116 | Ga0075370_10005336 | 3300006353 | Bacteria | 6373 |
| 117 | Ga0075370_10032492 | 3300006353 | Bacteria | 2918 |
| 118 | Ga0075370_10056162 | 3300006353 | Bacteria | 2237 |
| 119 | Ga0075370_10118426 | 3300006353 | Bacteria | 1540 |
| 120 | Ga0075428_100045160 | 3300006844 | Bacteria | 4841 |
| 121 | Ga0075428_100203898 | 3300006844 | Bacteria | 2137 |
| 122 | Ga0075430_100060490 | 3300006846 | Bacteria | 3183 |
| 123 | Ga0075431_100135176 | 3300006847 | Bacteria | 2542 |
| 124 | Ga0075431_100169521 | 3300006847 | Bacteria | 2243 |
| 125 | Ga0075431_100203785 | 3300006847 | Bacteria | 2023 |
| 126 | Ga0075433_10018760 | 3300006852 | Bacteria | 5755 |
| 127 | Ga0075434_100007719 | 3300006871 | Bacteria | 9959 |
| 128 | Ga0075429_100072153 | 3300006880 | Bacteria | 3006 |
| 129 | Ga0068865_100147800 | 3300006881 | Bacteria | 1779 |
| 130 | Ga0075436_100012006 | 3300006914 | Bacteria | 5941 |
| 131 | Ga0097620_100001716 | 3300006931 | Bacteria | 22359 |
| 132 | Ga0097620_100002325 | 3300006931 | Bacteria | 19318 |
| 133 | Ga0097620_100313470 | 3300006931 | Bacteria | 1662 |
| 134 | Ga0075435_100110658 | 3300007076 | Bacteria | 2284 |
| 135 | Ga0105240_10369152 | 3300009093 | Bacteria | 1623 |
| 136 | Ga0111539_10131363 | 3300009094 | Bacteria | 2932 |
| 137 | Ga0105245_10002753 | 3300009098 | Bacteria | 15803 |
| 138 | Ga0105247_10001591 | 3300009101 | Bacteria | 16075 |
| 139 | Ga0105247_10001633 | 3300009101 | Bacteria | 15845 |
| 140 | Ga0105247_10005195 | 3300009101 | Bacteria | 8231 |
| 141 | Ga0105247_10178849 | 3300009101 | Bacteria | 1414 |
| 142 | Ga0114129_10237213 | 3300009147 | Bacteria | 2453 |
| 143 | Ga0114129_10259178 | 3300009147 | Bacteria | 2332 |
| 144 | Ga0114129_10314203 | 3300009147 | Bacteria | 2085 |
| 145 | Ga0114129_10594745 | 3300009147 | Bacteria | 1434 |
| 146 | Ga0105243_10000274 | 3300009148 | Bacteria | 57534 |
| 147 | Ga0105243_10014300 | 3300009148 | Bacteria | 6006 |
| 148 | Ga0105243_10303977 | 3300009148 | Bacteria | 1447 |
| 149 | Ga0105243_10532952 | 3300009148 | Bacteria | 1119 |
| 150 | Ga0105241_10209310 | 3300009174 | Bacteria | 1633 |
| 151 | Ga0105242_10002125 | 3300009176 | Bacteria | 15631 |
| 152 | Ga0105248_10000641 | 3300009177 | Bacteria | 39742 |
| 153 | Ga0105248_10061664 | 3300009177 | Bacteria | 4211 |
| 154 | Ga0105248_10073423 | 3300009177 | Bacteria | 3845 |
| 155 | Ga0105237_10004429 | 3300009545 | Bacteria | 16276 |
| 156 | Ga0105237_10062163 | 3300009545 | Bacteria | 3733 |
| 157 | Ga0105237_10178490 | 3300009545 | Bacteria | 2124 |
| 158 | Ga0105237_10286734 | 3300009545 | Bacteria | 1649 |
| 159 | Ga0105238_10112010 | 3300009551 | Bacteria | 2708 |
| 160 | Ga0105238_10743548 | 3300009551 | Bacteria | 994 |
| 161 | Ga0105249_10000049 | 3300009553 | Bacteria | 169899 |
| 162 | Ga0105249_10003002 | 3300009553 | Bacteria | 14553 |
| 163 | Ga0105249_10183872 | 3300009553 | Bacteria | 2035 |
| 164 | Ga0099796_10018706 | 3300010159 | Bacteria | 2086 |
| 165 | Ga0105239_10007880 | 3300010375 | Bacteria | 12176 |
| 166 | Ga0105239_10051513 | 3300010375 | Bacteria | 4513 |
| 167 | Ga0105239_10079875 | 3300010375 | Bacteria | 3599 |
| 168 | Ga0105246_10069726 | 3300011119 | Bacteria | 2470 |
| 169 | Ga0105246_10180894 | 3300011119 | Bacteria | 1623 |
| 170 | Ga0105246_10184791 | 3300011119 | Bacteria | 1608 |
| 171 | Ga0157369_10054360 | 3300013105 | Bacteria | 4324 |
| 172 | Ga0157374_10007942 | 3300013296 | Bacteria | 9063 |
| 173 | Ga0157378_10002404 | 3300013297 | Bacteria | 16640 |
| 174 | Ga0157378_10217696 | 3300013297 | Bacteria | 1814 |
| 175 | Ga0157378_10379988 | 3300013297 | Bacteria | 1387 |
| 176 | Ga0163162_10057493 | 3300013306 | Bacteria | 3918 |
| 177 | Ga0157372_10000917 | 3300013307 | Bacteria | 32072 |
| 178 | Ga0157375_10000573 | 3300013308 | Bacteria | 32942 |
| 179 | Ga0157375_10712178 | 3300013308 | Bacteria | 1157 |
| 180 | Ga0163163_10014803 | 3300014325 | Bacteria | 7181 |
| 181 | Ga0163163_10079911 | 3300014325 | Bacteria | 3269 |
| 182 | Ga0157380_10001337 | 3300014326 | Bacteria | 16040 |
| 183 | Ga0157380_10234721 | 3300014326 | Bacteria | 1650 |
| 184 | Ga0157377_10323220 | 3300014745 | Bacteria | 1026 |
| 185 | Ga0157379_10035516 | 3300014968 | Bacteria | 4444 |
| 186 | Ga0157376_10214156 | 3300014969 | Bacteria | 1780 |
| 187 | Ga0163161_10009207 | 3300017792 | Bacteria | 6828 |
| 188 | Ga0213876_10007007 | 3300021384 | Bacteria | 6147 |
| 189 | Ga0213876_10010598 | 3300021384 | Bacteria | 4938 |
| 190 | Ga0213876_10021820 | 3300021384 | Bacteria | 3386 |
| 191 | Ga0213875_10012224 | 3300021388 | Bacteria | 4246 |
| 192 | Ga0213875_10015347 | 3300021388 | Bacteria | 3728 |
| 193 | Ga0213875_10038893 | 3300021388 | Bacteria | 2242 |
| 194 | Ga0209758_1000815 | 3300025297 | Bacteria | 43876 |
| 195 | Ga0209051_1000033 | 3300025303 | Bacteria | 380540 |
| 196 | Ga0209051_1000775 | 3300025303 | Bacteria | 33951 |
| 197 | Ga0209051_1007091 | 3300025303 | Bacteria | 6196 |
| 198 | Ga0209051_1007985 | 3300025303 | Bacteria | 5682 |
| 199 | Ga0209051_1032945 | 3300025303 | Bacteria | 1968 |
| 200 | Ga0207653_10008494 | 3300025885 | Bacteria | 3200 |
| 201 | Ga0207692_10005720 | 3300025898 | Bacteria | 4998 |
| 202 | Ga0207692_10061619 | 3300025898 | Bacteria | 1945 |
| 203 | Ga0207642_10000191 | 3300025899 | Bacteria | 17844 |
| 204 | Ga0207642_10070184 | 3300025899 | Bacteria | 1664 |
| 205 | Ga0207710_10000350 | 3300025900 | Bacteria | 33273 |
| 206 | Ga0207710_10000908 | 3300025900 | Bacteria | 15831 |
| 207 | Ga0207647_10090023 | 3300025904 | Bacteria | 1831 |
| 208 | Ga0207645_10017918 | 3300025907 | Bacteria | 4671 |
| 209 | Ga0207684_10026260 | 3300025910 | Bacteria | 4965 |
| 210 | Ga0207684_10047727 | 3300025910 | Bacteria | 3632 |
| 211 | Ga0207654_10178804 | 3300025911 | Bacteria | 1383 |
| 212 | Ga0207671_10009509 | 3300025914 | Bacteria | 8120 |
| 213 | Ga0207693_10000197 | 3300025915 | Bacteria | 54675 |
| 214 | Ga0207693_10000771 | 3300025915 | Bacteria | 28766 |
| 215 | Ga0207663_10001796 | 3300025916 | Bacteria | 10120 |
| 216 | Ga0207663_10094352 | 3300025916 | Bacteria | 1994 |
| 217 | Ga0207662_10070465 | 3300025918 | Bacteria | 2115 |
| 218 | Ga0207646_10151154 | 3300025922 | Bacteria | 2094 |
| 219 | Ga0207681_10016662 | 3300025923 | Bacteria | 4602 |
| 220 | Ga0207694_10166166 | 3300025924 | Bacteria | 1785 |
| 221 | Ga0207687_10031639 | 3300025927 | Bacteria | 3577 |
| 222 | Ga0207700_10123926 | 3300025928 | Bacteria | 2099 |
| 223 | Ga0207664_10008997 | 3300025929 | Bacteria | 6990 |
| 224 | Ga0207664_10123324 | 3300025929 | Bacteria | 2172 |
| 225 | Ga0207690_10086666 | 3300025932 | Bacteria | 2201 |
| 226 | Ga0207706_10013062 | 3300025933 | Bacteria | 7557 |
| 227 | Ga0207706_10265013 | 3300025933 | Bacteria | 1500 |
| 228 | Ga0207686_10218679 | 3300025934 | Bacteria | 1374 |
| 229 | Ga0207709_10001002 | 3300025935 | Bacteria | 20938 |
| 230 | Ga0207709_10311802 | 3300025935 | Bacteria | 1174 |
| 231 | Ga0207670_10024097 | 3300025936 | Bacteria | 3800 |
| 232 | Ga0207670_10029869 | 3300025936 | Bacteria | 3476 |
| 233 | Ga0207669_10004626 | 3300025937 | Bacteria | 6076 |
| 234 | Ga0207704_10000448 | 3300025938 | Bacteria | 18392 |
| 235 | Ga0207665_10007076 | 3300025939 | Bacteria | 7428 |
| 236 | Ga0207691_10016548 | 3300025940 | Bacteria | 7003 |
| 237 | Ga0207711_10002851 | 3300025941 | Bacteria | 15167 |
| 238 | Ga0207711_10129967 | 3300025941 | Bacteria | 2257 |
| 239 | Ga0207689_10009089 | 3300025942 | Bacteria | 8603 |
| 240 | Ga0207661_10170923 | 3300025944 | Bacteria | 1892 |
| 241 | Ga0207667_10183960 | 3300025949 | Bacteria | 2145 |
| 242 | Ga0207651_10027395 | 3300025960 | Bacteria | 3579 |
| 243 | Ga0207712_10000038 | 3300025961 | Bacteria | 192762 |
| 244 | Ga0207712_10010767 | 3300025961 | Bacteria | 5814 |
| 245 | Ga0207712_10247623 | 3300025961 | Bacteria | 1439 |
| 246 | Ga0207668_10000838 | 3300025972 | Bacteria | 18580 |
| 247 | Ga0207668_10001862 | 3300025972 | Bacteria | 12311 |
| 248 | Ga0207668_10100060 | 3300025972 | Bacteria | 2152 |
| 249 | Ga0207640_10059883 | 3300025981 | Bacteria | 2514 |
| 250 | Ga0207658_10001213 | 3300025986 | Bacteria | 20454 |
| 251 | Ga0207658_10002007 | 3300025986 | Bacteria | 15172 |
| 252 | Ga0207658_10002028 | 3300025986 | Bacteria | 15117 |
| 253 | Ga0207658_10006634 | 3300025986 | Bacteria | 7883 |
| 254 | Ga0207658_10040484 | 3300025986 | Bacteria | 3369 |
| 255 | Ga0207703_10015904 | 3300026035 | Bacteria | 5868 |
| 256 | Ga0207703_10028817 | 3300026035 | Bacteria | 4381 |
| 257 | Ga0207639_10013506 | 3300026041 | Bacteria | 5718 |
| 258 | Ga0207639_10107907 | 3300026041 | Bacteria | 2262 |
| 259 | Ga0207678_10013351 | 3300026067 | Bacteria | 7209 |
| 260 | Ga0207678_10016619 | 3300026067 | Bacteria | 6465 |
| 261 | Ga0207678_10078476 | 3300026067 | Bacteria | 2828 |
| 262 | Ga0207708_10001480 | 3300026075 | Bacteria | 17558 |
| 263 | Ga0207708_10009483 | 3300026075 | Bacteria | 7210 |
| 264 | Ga0207702_10637400 | 3300026078 | Bacteria | 1047 |
| 265 | Ga0207641_10000232 | 3300026088 | Bacteria | 71885 |
| 266 | Ga0207641_10187414 | 3300026088 | Bacteria | 1899 |
| 267 | Ga0207648_10001458 | 3300026089 | Bacteria | 26029 |
| 268 | Ga0207676_10285713 | 3300026095 | Bacteria | 1500 |
| 269 | Ga0207676_10365804 | 3300026095 | Bacteria | 1338 |
| 270 | Ga0207683_10000996 | 3300026121 | Bacteria | 25929 |
| 271 | Ga0207683_10029948 | 3300026121 | Bacteria | 4715 |
| 272 | Ga0207683_10304224 | 3300026121 | Bacteria | 1459 |
| 273 | Ga0268266_10006941 | 3300028379 | Bacteria | 10300 |
| 274 | Ga0268266_10108023 | 3300028379 | Bacteria | 2461 |
| 275 | Ga0268266_10228292 | 3300028379 | Bacteria | 1714 |
| 276 | Ga0268265_10000053 | 3300028380 | Bacteria | 170215 |
| 277 | Ga0268264_10000017 | 3300028381 | Bacteria | 498037 |
| 278 | Ga0268264_10038818 | 3300028381 | Bacteria | 3931 |
| 279 | Ga0307517_10058934 | 3300028786 | Bacteria | 3687 |
| 280 | Ga0316176_1024040 | 3300030732 | Bacteria | 2462 |
| 281 | Ga0316180_1017200 | 3300030736 | Bacteria | 2573 |
| 282 | Ga0265327_10000004 | 3300031251 | Bacteria | 803973 |
| 283 | Ga0265327_10000131 | 3300031251 | Bacteria | 164189 |
| 284 | Ga0265327_10005208 | 3300031251 | Bacteria | 10976 |
| 285 | Ga0265327_10009131 | 3300031251 | Bacteria | 7212 |
| 286 | Ga0265316_10000176 | 3300031344 | Bacteria | 72297 |
| 287 | Ga0307509_10372912 | 3300031507 | Bacteria | 1143 |
| 288 | Ga0307518_10001252 | 3300031838 | Bacteria | 19089 |
| 289 | Ga0307410_10184337 | 3300031852 | Bacteria | 1583 |
| 290 | Ga0307406_10433186 | 3300031901 | Bacteria | 1051 |
| 291 | Ga0307409_100187805 | 3300031995 | Bacteria | 1836 |
| 292 | Ga0307416_100272869 | 3300032002 | Bacteria | 1662 |
| 293 | Ga0307411_10050680 | 3300032005 | Bacteria | 2705 |
| 294 | Ga0307415_100049110 | 3300032126 | Bacteria | 2851 |
| 295 | Ga0373960_0065301 | 3300035121 | Bacteria | 1113 |
| 296 | Ga0373943_0027530 | 3300035170 | Bacteria | 2672 |
| 297 | Ga0373931_0121486 | 3300035691 | Bacteria | 1493 |
| 298 | Ga0373931_0151868 | 3300035691 | Bacteria | 1351 |
| 299 | Ga0373947_0100566 | 3300035725 | Bacteria | 1817 |
| 300 | Ga0436364_0222313 | 3300037853 | Bacteria | 14411 |
| 301 | Ga0436364_0437152 | 3300037853 | Bacteria | 1843 |
| 302 | Ga0436364_1361024 | 3300037853 | Bacteria | 14087 |
| 303 | Ga0436364_1486811 | 3300037853 | Bacteria | 3025 |
| 304 | Ga0436365_0219282 | 3300039437 | Bacteria | 3131 |
| 305 | Ga0436365_0271296 | 3300039437 | Bacteria | 39035 |
| 306 | Ga0436365_0716503 | 3300039437 | Bacteria | 5300 |
| 307 | Ga0436365_0892446 | 3300039437 | Bacteria | 1226 |
| 308 | Ga0436365_1781365 | 3300039437 | Bacteria | 36167 |
| 309 | Ga0436361_0588918 | 3300039447 | Bacteria | 1493 |
| 310 | Ga0436363_0356295 | 3300039450 | Bacteria | 3847 |
| 311 | Ga0436362_1086447 | 3300039453 | Bacteria | 1231 |
| 312 | Ga0439461_0001905 | 3300041410 | Bacteria | 3288 |
| 313 | Ga0439466_0008886 | 3300041411 | Bacteria | 3778 |
| 314 | Ga0439466_0014516 | 3300041411 | Bacteria | 2867 |
| 315 | Ga0439465_0001890 | 3300041413 | Bacteria | 6858 |
| 316 | Ga0451793_0047961 | 3300041452 | Bacteria | 1311 |
| 317 | Ga0451797_1249120 | 3300041453 | Bacteria | 6339 |
| 318 | Ga0451795_1089617 | 3300041456 | Bacteria | 1915 |
| 319 | Ga0451802_0218464 | 3300041460 | Bacteria | 1563 |
| 320 | Ga0451833_1139607 | 3300041491 | Bacteria | 2681 |
| 321 | Ga0451837_0618149 | 3300041494 | Bacteria | 3059 |
| 322 | Ga0451839_0744362 | 3300041496 | Bacteria | 1021 |
| 323 | Ga0451841_0208188 | 3300041498 | Bacteria | 5122 |
| 324 | Ga0451843_0146450 | 3300041509 | Bacteria | 5063 |
| 325 | Ga0439431_0000474 | 3300041997 | Bacteria | 8514 |
| 326 | Ga0439445_0009947 | 3300042004 | Bacteria | 2246 |
| 327 | Ga0439459_0012479 | 3300042438 | Bacteria | 1514 |
| 328 | Ga0466972_0029290 | 3300044658 | Bacteria | 2711 |
| 329 | Ga0466972_0036732 | 3300044658 | Bacteria | 2395 |
| 330 | Ga0466972_0037866 | 3300044658 | Bacteria | 2356 |
| 331 | Ga0466972_0041291 | 3300044658 | Bacteria | 2246 |
| 332 | Ga0466972_0045810 | 3300044658 | Bacteria | 2119 |
| 333 | Ga0466972_0065963 | 3300044658 | Bacteria | 1731 |
| 334 | Ga0466965_0003197 | 3300044683 | Bacteria | 7156 |
| 335 | Ga0466965_0005322 | 3300044683 | Bacteria | 5790 |
| 336 | Ga0466965_0027851 | 3300044683 | Bacteria | 2743 |
| 337 | Ga0466966_0009750 | 3300044684 | Bacteria | 6364 |
| 338 | Ga0466966_0018116 | 3300044684 | Bacteria | 4648 |
| 339 | Ga0466961_0016050 | 3300044693 | Bacteria | 4808 |
| 340 | Ga0466961_0067126 | 3300044693 | Bacteria | 2278 |
| 341 | Ga0466963_0087879 | 3300044694 | Bacteria | 2114 |
| 342 | Ga0466963_0128468 | 3300044694 | Bacteria | 1749 |
| 343 | Ga0466964_0067387 | 3300044706 | Bacteria | 1505 |
| 344 | Ga0466971_0034221 | 3300044719 | Bacteria | 2277 |
| 345 | Ga0466968_0000435 | 3300044735 | Bacteria | 13981 |
| 346 | Ga0466968_0006528 | 3300044735 | Bacteria | 4402 |
| 347 | Ga0466968_0073689 | 3300044735 | Bacteria | 1490 |
| 348 | Ga0466970_0018344 | 3300044765 | Bacteria | 3620 |
| 349 | Ga0466970_0034589 | 3300044765 | Bacteria | 2675 |
| 350 | Ga0466957_0006105 | 3300044842 | Bacteria | 6801 |
| 351 | Ga0466957_0012121 | 3300044842 | Bacteria | 4987 |
| 352 | Ga0466957_0097697 | 3300044842 | Bacteria | 1847 |
| 353 | Ga0466957_0119690 | 3300044842 | Bacteria | 1677 |
| 354 | Ga0466960_0000170 | 3300044901 | Bacteria | 22220 |
| 355 | Ga0466960_0001245 | 3300044901 | Bacteria | 9221 |
| 356 | Ga0466960_0188595 | 3300044901 | Bacteria | 1121 |
| 357 | Ga0466959_0042779 | 3300045049 | Bacteria | 3341 |
| 358 | Ga0466959_0049302 | 3300045049 | Bacteria | 3093 |
| 359 | Ga0466959_0149566 | 3300045049 | Bacteria | 1646 |
| 360 | Ga0466959_0261992 | 3300045049 | Bacteria | 1190 |
| 361 | Ga0466959_0286943 | 3300045049 | Bacteria | 1129 |
| 362 | Ga0466958_0000545 | 3300045836 | Bacteria | 16027 |
| 363 | Ga0466958_0026151 | 3300045836 | Bacteria | 3448 |
| 364 | Ga0466958_0049686 | 3300045836 | Bacteria | 2538 |
| 365 | Ga0466958_0107582 | 3300045836 | Bacteria | 1739 |
| 366 | Ga0466967_0004219 | 3300045976 | Bacteria | 9640 |
| 367 | Ga0466967_0024083 | 3300045976 | Bacteria | 4999 |
| 368 | Ga0466967_0058809 | 3300045976 | Bacteria | 3399 |
| 369 | Ga0466967_0124714 | 3300045976 | Bacteria | 2384 |
| 370 | Ga0466967_0417035 | 3300045976 | Bacteria | 1308 |
| 371 | Ga0466967_0634920 | 3300045976 | Bacteria | 1055 |
| 372 | Ga0495638_0008416 | 3300046460 | Bacteria | 7317 |
| 373 | Ga0495638_0030768 | 3300046460 | Bacteria | 3452 |
| 374 | Ga0495580_0322565 | 3300046472 | Bacteria | 1050 |
| 375 | Ga0495582_0072803 | 3300046473 | Bacteria | 1902 |
| 376 | Ga0495606_0057597 | 3300046507 | Bacteria | 2502 |
| 377 | Ga0495632_0057946 | 3300046519 | Bacteria | 1889 |
| 378 | Ga0495643_0098744 | 3300046522 | Bacteria | 1499 |
| 379 | Ga0495648_0018539 | 3300046524 | Bacteria | 4922 |
| 380 | Ga0495665_0010417 | 3300046531 | Bacteria | 5030 |
| 381 | Ga0495668_0011712 | 3300046616 | Bacteria | 5236 |
| 382 | Ga0495634_0158752 | 3300046642 | Bacteria | 1427 |
| 383 | Ga0495611_0032734 | 3300046648 | Bacteria | 2292 |
| 384 | Ga0495625_0059991 | 3300046660 | Bacteria | 2697 |
| 385 | Ga0495588_0014586 | 3300046674 | Bacteria | 3763 |
| 386 | Ga0495647_0043574 | 3300046681 | Bacteria | 1717 |
| 387 | Ga0495658_0006659 | 3300046683 | Bacteria | 5679 |
| 388 | Ga0495624_0033254 | 3300046690 | Bacteria | 3340 |
| 389 | Ga0495600_0102149 | 3300046809 | Bacteria | 1869 |
| 390 | Ga0495581_0045567 | 3300047315 | Bacteria | 2535 |
| 391 | Ga0495672_0002524 | 3300047320 | Bacteria | 16717 |
| 392 | Ga0495672_0014046 | 3300047320 | Bacteria | 5500 |
| 393 | Ga0495672_0096088 | 3300047320 | Bacteria | 1616 |
| 394 | Ga0495676_0032697 | 3300047321 | Bacteria | 4388 |
| 395 | Ga0495673_0001014 | 3300047469 | Bacteria | 24774 |
| 396 | Ga0495686_0021340 | 3300047472 | Bacteria | 4303 |
| 397 | Ga0495686_0115405 | 3300047472 | Bacteria | 1606 |
| 398 | Ga0495593_0006211 | 3300047673 | Bacteria | 7024 |
| 399 | Ga0496100_0000029 | 3300048903 | Bacteria | 110710 |
| 400 | Ga0496100_0000780 | 3300048903 | Bacteria | 15181 |
| 401 | Ga0496100_0001560 | 3300048903 | Bacteria | 11268 |
| 402 | Ga0496100_0052366 | 3300048903 | Bacteria | 2653 |
| 403 | Ga0496100_0080938 | 3300048903 | Bacteria | 2193 |
| 404 | Ga0496100_0373163 | 3300048903 | Bacteria | 1082 |
| 405 | Ga0496101_0000015 | 3300048904 | Bacteria | 252368 |
| 406 | Ga0496101_0000031 | 3300048904 | Bacteria | 195195 |
| 407 | Ga0496101_0000717 | 3300048904 | Bacteria | 19800 |
| 408 | Ga0496101_0015234 | 3300048904 | Bacteria | 5176 |
| 409 | Ga0496101_0093441 | 3300048904 | Bacteria | 2240 |
| 410 | Ga0496102_0000065 | 3300048905 | Bacteria | 161370 |
| 411 | Ga0496102_0000559 | 3300048905 | Bacteria | 39807 |
| 412 | Ga0496102_0002030 | 3300048905 | Bacteria | 17497 |
| 413 | Ga0496102_0028265 | 3300048905 | Bacteria | 5008 |
| 414 | Ga0496102_0053608 | 3300048905 | Bacteria | 3676 |
| 415 | Ga0496102_0062848 | 3300048905 | Bacteria | 3399 |
| 416 | Ga0496102_0121604 | 3300048905 | Bacteria | 2439 |
| 417 | Ga0496103_0000048 | 3300048906 | Bacteria | 160911 |
| 418 | Ga0496103_0000556 | 3300048906 | Bacteria | 29725 |
| 419 | Ga0496103_0003067 | 3300048906 | Bacteria | 10268 |
| 420 | Ga0496103_0005902 | 3300048906 | Bacteria | 7318 |
| 421 | Ga0496103_0090296 | 3300048906 | Bacteria | 1933 |
| 422 | Ga0496103_0147519 | 3300048906 | Bacteria | 1506 |
| 423 | Ga0496104_0001343 | 3300048907 | Bacteria | 21285 |
| 424 | Ga0496104_0015016 | 3300048907 | Bacteria | 7006 |
| 425 | Ga0496104_0074763 | 3300048907 | Bacteria | 3226 |
| 426 | Ga0496105_0006560 | 3300048908 | Bacteria | 8952 |
| 427 | Ga0496105_0045395 | 3300048908 | Bacteria | 3625 |
| 428 | Ga0496106_0000396 | 3300048909 | Bacteria | 31087 |
| 429 | Ga0496106_0001046 | 3300048909 | Bacteria | 20352 |
| 430 | Ga0496106_0026006 | 3300048909 | Bacteria | 4355 |
| 431 | Ga0496106_0092337 | 3300048909 | Bacteria | 2338 |
| 432 | Ga0496106_0100390 | 3300048909 | Bacteria | 2244 |
| 433 | Ga0496107_0000330 | 3300048910 | Bacteria | 25647 |
| 434 | Ga0496107_0001096 | 3300048910 | Bacteria | 16279 |
| 435 | Ga0496107_0015942 | 3300048910 | Bacteria | 5272 |
| 436 | Ga0496108_0001084 | 3300048911 | Bacteria | 21234 |
| 437 | Ga0496108_0003464 | 3300048911 | Bacteria | 12661 |
| 438 | Ga0496108_0033538 | 3300048911 | Bacteria | 4265 |
| 439 | Ga0496108_0036517 | 3300048911 | Bacteria | 4089 |
| 440 | Ga0496109_0000134 | 3300048912 | Bacteria | 75662 |
| 441 | Ga0496109_0004328 | 3300048912 | Bacteria | 11860 |
| 442 | Ga0496109_0062738 | 3300048912 | Bacteria | 3399 |
| 443 | Ga0496109_0064939 | 3300048912 | Bacteria | 3341 |
| 444 | Ga0496109_0109215 | 3300048912 | Bacteria | 2571 |
| 445 | Ga0496110_0096293 | 3300048913 | Bacteria | 2652 |
| 446 | Ga0496110_0098094 | 3300048913 | Bacteria | 2625 |
| 447 | Ga0496110_0105294 | 3300048913 | Bacteria | 2531 |
| 448 | Ga0496111_0136588 | 3300048914 | Bacteria | 1816 |
| 449 | Ga0496112_0018109 | 3300048915 | Bacteria | 6628 |
| 450 | Ga0496112_0024386 | 3300048915 | Bacteria | 5790 |
| 451 | Ga0496112_0034944 | 3300048915 | Bacteria | 4892 |
| 452 | Ga0496112_0152329 | 3300048915 | Bacteria | 2279 |
| 453 | Ga0496112_0202472 | 3300048915 | Bacteria | 1944 |
| 454 | Ga0496113_0030325 | 3300048916 | Bacteria | 3915 |
| 455 | Ga0496113_0125919 | 3300048916 | Bacteria | 2006 |
| 456 | Ga0496113_0284331 | 3300048916 | Bacteria | 1323 |
| 457 | Ga0496113_0285821 | 3300048916 | Bacteria | 1319 |
| 458 | Ga0496114_0001231 | 3300048917 | Bacteria | 19347 |
| 459 | Ga0496114_0001627 | 3300048917 | Bacteria | 17045 |
| 460 | Ga0496114_0004867 | 3300048917 | Bacteria | 10462 |
| 461 | Ga0496114_0082109 | 3300048917 | Bacteria | 2724 |
| 462 | Ga0496114_0126522 | 3300048917 | Bacteria | 2203 |
| 463 | Ga0496114_0453977 | 3300048917 | Bacteria | 1135 |
| 464 | Ga0496115_0002005 | 3300048918 | Bacteria | 14559 |
| 465 | Ga0496115_0003450 | 3300048918 | Bacteria | 11356 |
| 466 | Ga0496115_0018149 | 3300048918 | Bacteria | 5395 |
| 467 | Ga0496116_0000125 | 3300048919 | Bacteria | 160885 |
| 468 | Ga0496116_0018374 | 3300048919 | Bacteria | 5392 |
| 469 | Ga0496116_0019255 | 3300048919 | Bacteria | 5230 |
| 470 | Ga0496117_0000111 | 3300048920 | Bacteria | 184570 |
| 471 | Ga0496117_0055066 | 3300048920 | Bacteria | 2782 |
| 472 | Ga0496117_0093875 | 3300048920 | Bacteria | 1922 |
| 473 | Ga0496118_0000083 | 3300048921 | Bacteria | 184570 |
| 474 | Ga0496118_0000272 | 3300048921 | Bacteria | 91016 |
| 475 | Ga0496118_0004348 | 3300048921 | Bacteria | 16865 |
| 476 | Ga0496118_0119452 | 3300048921 | Bacteria | 1723 |
| 477 | Ga0496119_0003439 | 3300048922 | Bacteria | 16441 |
| 478 | Ga0496119_0014096 | 3300048922 | Bacteria | 6290 |
| 479 | Ga0496119_0090523 | 3300048922 | Bacteria | 1739 |
| 480 | Ga0496119_0191666 | 3300048922 | Bacteria | 1064 |
| 481 | Ga0496120_0013454 | 3300048923 | Bacteria | 5506 |
| 482 | Ga0496120_0050017 | 3300048923 | Bacteria | 2395 |
| 483 | Ga0496120_0052147 | 3300048923 | Bacteria | 2331 |
| 484 | Ga0496120_0091148 | 3300048923 | Bacteria | 1628 |
| 485 | Ga0496120_0175791 | 3300048923 | Bacteria | 1055 |
| 486 | Ga0496121_0000004 | 3300048924 | Bacteria | 1139011 |
| 487 | Ga0496121_0000728 | 3300048924 | Bacteria | 60874 |
| 488 | Ga0496121_0047878 | 3300048924 | Bacteria | 3642 |
| 489 | Ga0496122_0000138 | 3300048925 | Bacteria | 169434 |
| 490 | Ga0496122_0054949 | 3300048925 | Bacteria | 2984 |
| 491 | Ga0496123_0007235 | 3300048926 | Bacteria | 10535 |
| 492 | Ga0496123_0063893 | 3300048926 | Bacteria | 2349 |
| 493 | Ga0496124_0000012 | 3300048927 | Bacteria | 512581 |
| 494 | Ga0496124_0105947 | 3300048927 | Bacteria | 2270 |
| 495 | Ga0496125_0000003 | 3300048928 | Bacteria | 1189767 |
| 496 | Ga0496125_0042302 | 3300048928 | Bacteria | 3882 |
| 497 | Ga0496125_0049925 | 3300048928 | Bacteria | 3469 |
| 498 | Ga0496126_0000001 | 3300048929 | Bacteria | 1139011 |
| 499 | Ga0496126_0000220 | 3300048929 | Bacteria | 124547 |
| 500 | Ga0496126_0005652 | 3300048929 | Bacteria | 14206 |
| 501 | Ga0496126_0019389 | 3300048929 | Bacteria | 6699 |
| 502 | Ga0496126_0093219 | 3300048929 | Bacteria | 2644 |
| 503 | Ga0501032_0001328 | 3300049569 | Bacteria | 19718 |
| 504 | Ga0501032_0004435 | 3300049569 | Bacteria | 10579 |
| 505 | Ga0501034_0001406 | 3300049571 | Bacteria | 32322 |
| 506 | Ga0501034_0008577 | 3300049571 | Bacteria | 10786 |
| 507 | Ga0501036_0001872 | 3300049572 | Bacteria | 16318 |
| 508 | Ga0501036_0041340 | 3300049572 | Bacteria | 3901 |
| 509 | Ga0501037_0000401 | 3300049573 | Bacteria | 36095 |
| 510 | Ga0501038_0007683 | 3300049574 | Bacteria | 9941 |
| 511 | Ga0501039_0003187 | 3300049575 | Bacteria | 12267 |
| 512 | Ga0501043_0000058 | 3300049579 | Bacteria | 102030 |
| 513 | Ga0501043_0001795 | 3300049579 | Bacteria | 18430 |
| 514 | Ga0501043_0007935 | 3300049579 | Bacteria | 8389 |
| 515 | Ga0501046_0000051 | 3300049580 | Bacteria | 133545 |
| 516 | Ga0501046_0000302 | 3300049580 | Bacteria | 49738 |
| 517 | Ga0501047_0000003 | 3300049581 | Bacteria | 508375 |
| 518 | Ga0501047_0001510 | 3300049581 | Bacteria | 22700 |
| 519 | Ga0501047_0008489 | 3300049581 | Bacteria | 9689 |
| 520 | Ga0501047_0223693 | 3300049581 | Bacteria | 1737 |
| 521 | Ga0501047_0374947 | 3300049581 | Bacteria | 1258 |
| 522 | Ga0501047_0558145 | 3300049581 | Bacteria | 969 |
| 523 | Ga0501048_0001358 | 3300049582 | Bacteria | 18540 |
| 524 | Ga0501048_0010014 | 3300049582 | Bacteria | 7095 |
| 525 | Ga0501070_0000731 | 3300049586 | Bacteria | 30025 |
| 526 | Ga0501070_0012220 | 3300049586 | Bacteria | 7244 |
| 527 | Ga0501070_0051180 | 3300049586 | Bacteria | 3429 |
| 528 | Ga0501080_0199315 | 3300049742 | Bacteria | 1838 |
| 529 | Ga0501035_0000665 | 3300049822 | Bacteria | 37870 |
| 530 | Ga0501035_0000742 | 3300049822 | Bacteria | 35160 |
| 531 | Ga0501044_0000313 | 3300049823 | Bacteria | 61310 |
| 532 | Ga0501044_0001249 | 3300049823 | Bacteria | 30175 |
| 533 | Ga0501044_0005938 | 3300049823 | Bacteria | 13523 |
| 534 | Ga0501044_0015786 | 3300049823 | Bacteria | 8130 |
| 535 | nmdc:mga03683_1900_c1 | 3300050489 | Bacteria | 5668 |
| 536 | nmdc:mga03n38_1249_c1 | 3300050490 | Bacteria | 7150 |
| 537 | nmdc:mga03n38_149256_c1 | 3300050490 | Bacteria | 1175 |
| 538 | nmdc:mga03n38_77537_c1 | 3300050490 | Bacteria | 1553 |
| 539 | nmdc:mga00v17_142225_c1 | 3300050491 | Bacteria | 1539 |
| 540 | nmdc:mga00v17_218881_c1 | 3300050491 | Bacteria | 1233 |
| 541 | nmdc:mga00v17_22402_c1 | 3300050491 | Bacteria | 3645 |
| 542 | nmdc:mga00v17_709_c1 | 3300050491 | Bacteria | 18242 |
| 543 | nmdc:mga00v17_7262_c1 | 3300050491 | Bacteria | 5903 |
| 544 | nmdc:mga00v17_81797_c1 | 3300050491 | Bacteria | 2018 |
| 545 | nmdc:mga0yw44_210429_c1 | 3300050492 | Bacteria | 1286 |
| 546 | nmdc:mga0yw44_235372_c1 | 3300050492 | Bacteria | 1216 |
| 547 | nmdc:mga0yw44_57115_c1 | 3300050492 | Bacteria | 2380 |
| 548 | nmdc:mga0yw44_68000_c1 | 3300050492 | Bacteria | 2202 |
| 549 | nmdc:mga0yw44_68042_c1 | 3300050492 | Bacteria | 2202 |
| 550 | nmdc:mga0yw44_8098_c1 | 3300050492 | Bacteria | 5218 |
| 551 | nmdc:mga0yw44_84262_c1 | 3300050492 | Bacteria | 1998 |
| 552 | nmdc:mga04h51_5850_c1 | 3300050495 | Bacteria | 3153 |
| 553 | nmdc:mga07m45_12814_c1 | 3300050496 | Bacteria | 4436 |
| 554 | nmdc:mga07m45_29227_c1 | 3300050496 | Bacteria | 2529 |
| 555 | nmdc:mga07m45_38813_c1 | 3300050496 | Bacteria | 2659 |
| 556 | nmdc:mga05p37_138110_c1 | 3300050507 | Bacteria | 2987 |
| 557 | nmdc:mga05p37_202951_c1 | 3300050507 | Bacteria | 2400 |
| 558 | nmdc:mga05p37_209453_c1 | 3300050507 | Bacteria | 2357 |
| 559 | nmdc:mga05p37_327495_c1 | 3300050507 | Bacteria | 1811 |
| 560 | nmdc:mga09592_32884_c1 | 3300050508 | Bacteria | 4325 |
| 561 | nmdc:mga0qj67_38699_c1 | 3300050509 | Bacteria | 3742 |
| 562 | nmdc:mga06r32_116982_c1 | 3300050510 | Bacteria | 2627 |
| 563 | nmdc:mga06r32_318514_c1 | 3300050510 | Bacteria | 1541 |
| 564 | nmdc:mga06r32_523876_c1 | 3300050510 | Bacteria | 1161 |
| 565 | nmdc:mga06r32_67274_c1 | 3300050510 | Bacteria | 3459 |
| 566 | nmdc:mga06r32_70938_c1 | 3300050510 | Bacteria | 3371 |
| 567 | nmdc:mga08y16_192265_c1 | 3300050511 | Bacteria | 2116 |
| 568 | nmdc:mga0n895_30558_c1 | 3300050512 | Bacteria | 5151 |
| 569 | nmdc:mga0rr50_12854_c1 | 3300050513 | Bacteria | 5427 |
| 570 | nmdc:mga08x19_16434_c1 | 3300050514 | Bacteria | 4515 |
| 571 | nmdc:mga0a205_6365_c1 | 3300050515 | Bacteria | 10666 |
| 572 | nmdc:mga0sz30_168625_c1 | 3300050516 | Bacteria | 971 |
| 573 | nmdc:mga0sz30_338_c1 | 3300050516 | Bacteria | 17911 |
| 574 | nmdc:mga0sz30_35904_c1 | 3300050516 | Bacteria | 2070 |
| 575 | nmdc:mga0sz30_40125_c1 | 3300050516 | Bacteria | 1967 |
| 576 | Ga0495601_0058651 | 3300053077 | Bacteria | 2440 |
| 577 | Ga0500643_003262 | 3300053087 | Bacteria | 7902 |
| 578 | Ga0500643_018464 | 3300053087 | Bacteria | 2313 |
| 579 | Ga0500562_001188 | 3300053108 | Bacteria | 6427 |
| 580 | Ga0500628_002231 | 3300053129 | Bacteria | 3231 |
| 581 | Ga0500652_025550 | 3300053131 | Bacteria | 2264 |
| 582 | Ga0500568_0006967 | 3300053139 | Bacteria | 5601 |
| 583 | Ga0500577_0007324 | 3300053142 | Bacteria | 3087 |
| 584 | Ga0500604_0006704 | 3300053151 | Bacteria | 3047 |
| 585 | Ga0500622_0000198 | 3300053156 | Bacteria | 63633 |
| 586 | Ga0500645_000056 | 3300053730 | Bacteria | 92126 |
| 587 | Ga0500645_014341 | 3300053730 | Bacteria | 2527 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048906 | Ga0496103_0005902 | Ga0496103_0005902_6557_7291 | 240 |
| 2 | 3300048921 | Ga0496118_0119452 | Ga0496118_0119452_28_762 | 240 |
| 3 | 3300046472 | Ga0495580_0322565 | Ga0495580_0322565_189_1031 | 260 |
| 4 | 3300025935 | Ga0207709_10311802 | Ga0207709_103118022 | 267 |
| 5 | 3300025914 | Ga0207671_10009509 | Ga0207671_100095094 | 271 |
| 6 | 3300053730 | Ga0500645_014341 | Ga0500645_014341_1630_2484 | 274 |
| 7 | 3300009545 | Ga0105237_10004429 | Ga0105237_100044295 | 279 |
| 8 | 3300009551 | Ga0105238_10743548 | Ga0105238_107435481 | 279 |
| 9 | 3300010375 | Ga0105239_10007880 | Ga0105239_100078802 | 279 |
| 10 | 3300048922 | Ga0496119_0090523 | Ga0496119_0090523_74_964 | 279 |
| 11 | 3300048923 | Ga0496120_0175791 | Ga0496120_0175791_103_993 | 279 |
| 12 | 3300046507 | Ga0495606_0057597 | Ga0495606_0057597_713_1615 | 280 |
| 13 | 3300047472 | Ga0495686_0115405 | Ga0495686_0115405_162_1064 | 280 |
| 14 | 3300048905 | Ga0496102_0000065 | Ga0496102_0000065_82765_83667 | 280 |
| 15 | 3300048906 | Ga0496103_0000048 | Ga0496103_0000048_82306_83208 | 280 |
| 16 | 3300048919 | Ga0496116_0000125 | Ga0496116_0000125_77704_78606 | 280 |
| 17 | 3300048920 | Ga0496117_0000111 | Ga0496117_0000111_77704_78606 | 280 |
| 18 | 3300048921 | Ga0496118_0000083 | Ga0496118_0000083_77704_78606 | 280 |
| 19 | 3300048929 | Ga0496126_0000220 | Ga0496126_0000220_40238_41140 | 280 |
| 20 | 3300048907 | Ga0496104_0074763 | Ga0496104_0074763_1173_2072 | 281 |
| 21 | 3300048917 | Ga0496114_0001627 | Ga0496114_0001627_12743_13642 | 281 |
| 22 | 3300053077 | Ga0495601_0058651 | Ga0495601_0058651_614_1495 | 281 |
| 23 | 3300005445 | Ga0070708_100352123 | Ga0070708_1003521232 | 284 |
| 24 | 3300005455 | Ga0070663_100027896 | Ga0070663_1000278962 | 284 |
| 25 | 3300005467 | Ga0070706_100018794 | Ga0070706_1000187943 | 284 |
| 26 | 3300005467 | Ga0070706_100095369 | Ga0070706_1000953691 | 284 |
| 27 | 3300005471 | Ga0070698_100032141 | Ga0070698_1000321414 | 284 |
| 28 | 3300005937 | Ga0081455_10176697 | Ga0081455_101766972 | 284 |
| 29 | 3300006844 | Ga0075428_100203898 | Ga0075428_1002038982 | 284 |
| 30 | 3300006846 | Ga0075430_100060490 | Ga0075430_1000604903 | 284 |
| 31 | 3300006847 | Ga0075431_100169521 | Ga0075431_1001695212 | 284 |
| 32 | 3300006847 | Ga0075431_100203785 | Ga0075431_1002037852 | 284 |
| 33 | 3300006852 | Ga0075433_10018760 | Ga0075433_100187603 | 284 |
| 34 | 3300006871 | Ga0075434_100007719 | Ga0075434_10000771910 | 284 |
| 35 | 3300006880 | Ga0075429_100072153 | Ga0075429_1000721532 | 284 |
| 36 | 3300006914 | Ga0075436_100012006 | Ga0075436_1000120063 | 284 |
| 37 | 3300007076 | Ga0075435_100110658 | Ga0075435_1001106582 | 284 |
| 38 | 3300009094 | Ga0111539_10131363 | Ga0111539_101313634 | 284 |
| 39 | 3300009147 | Ga0114129_10259178 | Ga0114129_102591782 | 284 |
| 40 | 3300009147 | Ga0114129_10314203 | Ga0114129_103142032 | 284 |
| 41 | 3300009147 | Ga0114129_10594745 | Ga0114129_105947452 | 284 |
| 42 | 3300025297 | Ga0209758_1000815 | Ga0209758_100081521 | 284 |
| 43 | 3300025910 | Ga0207684_10026260 | Ga0207684_100262602 | 284 |
| 44 | 3300025910 | Ga0207684_10047727 | Ga0207684_100477272 | 284 |
| 45 | 3300028786 | Ga0307517_10058934 | Ga0307517_100589343 | 284 |
| 46 | 3300046460 | Ga0495638_0030768 | Ga0495638_0030768_1986_2891 | 284 |
| 47 | 3300046519 | Ga0495632_0057946 | Ga0495632_0057946_639_1544 | 284 |
| 48 | 3300046681 | Ga0495647_0043574 | Ga0495647_0043574_12_926 | 284 |
| 49 | 3300049579 | Ga0501043_0000058 | Ga0501043_0000058_36632_37540 | 284 |
| 50 | 3300049580 | Ga0501046_0000051 | Ga0501046_0000051_64538_65446 | 284 |
| 51 | 3300049581 | Ga0501047_0000003 | Ga0501047_0000003_442958_443866 | 284 |
| 52 | 3300049582 | Ga0501048_0001358 | Ga0501048_0001358_3362_4270 | 284 |
| 53 | 3300050507 | nmdc:mga05p37_209453_c1 | nmdc:mga05p37_209453_c1_237_1151 | 284 |
| 54 | 3300050507 | nmdc:mga05p37_327495_c1 | nmdc:mga05p37_327495_c1_819_1733 | 284 |
| 55 | 3300050508 | nmdc:mga09592_32884_c1 | nmdc:mga09592_32884_c1_2503_3417 | 284 |
| 56 | 3300050510 | nmdc:mga06r32_116982_c1 | nmdc:mga06r32_116982_c1_1153_2067 | 284 |
| 57 | 3300050510 | nmdc:mga06r32_318514_c1 | nmdc:mga06r32_318514_c1_292_1206 | 284 |
| 58 | 3300050510 | nmdc:mga06r32_523876_c1 | nmdc:mga06r32_523876_c1_162_1076 | 284 |
| 59 | 3300050511 | nmdc:mga08y16_192265_c1 | nmdc:mga08y16_192265_c1_403_1317 | 284 |
| 60 | 3300050512 | nmdc:mga0n895_30558_c1 | nmdc:mga0n895_30558_c1_896_1810 | 284 |
| 61 | 3300050513 | nmdc:mga0rr50_12854_c1 | nmdc:mga0rr50_12854_c1_1305_2219 | 284 |
| 62 | 3300050514 | nmdc:mga08x19_16434_c1 | nmdc:mga08x19_16434_c1_782_1696 | 284 |
| 63 | 3300050515 | nmdc:mga0a205_6365_c1 | nmdc:mga0a205_6365_c1_9061_9975 | 284 |
| 64 | 3300053129 | Ga0500628_002231 | Ga0500628_002231_1520_2425 | 284 |
| 65 | 3300053139 | Ga0500568_0006967 | Ga0500568_0006967_2524_3429 | 284 |
| 66 | 3300053142 | Ga0500577_0007324 | Ga0500577_0007324_608_1513 | 284 |
| 67 | 3300053151 | Ga0500604_0006704 | Ga0500604_0006704_851_1756 | 284 |
| 68 | 3300053156 | Ga0500622_0000198 | Ga0500622_0000198_58309_59214 | 284 |
| 69 | iso_pu_bacteria | 2585428057 | 2587725945 | 284 |
| 70 | iso_pu_bacteria | 2588253510 | 2588292842 | 284 |
| 71 | iso_pu_bacteria | 2643221592 | 2643967951 | 284 |
| 72 | iso_pu_bacteria | 2643221625 | 2644143149 | 284 |
| 73 | iso_pu_bacteria | 2643221648 | 2644271763 | 284 |
| 74 | 3300009148 | Ga0105243_10532952 | Ga0105243_105329522 | 285 |
| 75 | 3300010375 | Ga0105239_10079875 | Ga0105239_100798754 | 285 |
| 76 | 3300011119 | Ga0105246_10180894 | Ga0105246_101808942 | 285 |
| 77 | 3300048913 | Ga0496110_0105294 | Ga0496110_0105294_489_1382 | 285 |
| 78 | 3300048915 | Ga0496112_0024386 | Ga0496112_0024386_2717_3610 | 285 |
| 79 | 3300050490 | nmdc:mga03n38_149256_c1 | nmdc:mga03n38_149256_c1_76_969 | 285 |
| 80 | 3300050507 | nmdc:mga05p37_138110_c1 | nmdc:mga05p37_138110_c1_1414_2328 | 285 |
| 81 | iso_pu_bacteria | 2585427649 | 2586065409 | 285 |
| 82 | iso_pu_bacteria | 2808606522 | 2809593801 | 285 |
| 83 | iso_pu_bacteria | 2915768154 | 2915773014 | 285 |
| 84 | 3300013308 | Ga0157375_10712178 | Ga0157375_107121782 | 286 |
| 85 | 3300031344 | Ga0265316_10000176 | Ga0265316_1000017653 | 286 |
| 86 | 3300042438 | Ga0439459_0012479 | Ga0439459_0012479_22_912 | 286 |
| 87 | 3300053087 | Ga0500643_018464 | Ga0500643_018464_299_1189 | 286 |
| 88 | iso_pu_bacteria | 2795385470 | 2795781080 | 286 |
| 89 | iso_pu_bacteria | 2899359706 | 2899369135 | 286 |
| 90 | iso_pu_bacteria | 2917736166 | 2917744038 | 286 |
| 91 | iso_pu_bacteria | 8056207758 | 8056214015 | 286 |
| 92 | 3300026121 | Ga0207683_10304224 | Ga0207683_103042241 | 287 |
| 93 | 3300046522 | Ga0495643_0098744 | Ga0495643_0098744_407_1300 | 287 |
| 94 | 3300046524 | Ga0495648_0018539 | Ga0495648_0018539_3542_4444 | 287 |
| 95 | 3300046648 | Ga0495611_0032734 | Ga0495611_0032734_693_1595 | 287 |
| 96 | 3300047320 | Ga0495672_0002524 | Ga0495672_0002524_4678_5580 | 287 |
| 97 | 3300047469 | Ga0495673_0001014 | Ga0495673_0001014_17555_18457 | 287 |
| 98 | 3300048915 | Ga0496112_0202472 | Ga0496112_0202472_629_1525 | 287 |
| 99 | 3300053131 | Ga0500652_025550 | Ga0500652_025550_691_1584 | 288 |
| 100 | iso_pu_bacteria | 2795385472 | 2795793990 | 288 |
| 101 | iso_pu_bacteria | 2863067949 | 2863070038 | 288 |
| 102 | 3300031838 | Ga0307518_10001252 | Ga0307518_100012524 | 289 |
| 103 | 3300032002 | Ga0307416_100272869 | Ga0307416_1002728692 | 289 |
| 104 | 3300030732 | Ga0316176_1024040 | Ga0316176_10240403 | 290 |
| 105 | 3300030736 | Ga0316180_1017200 | Ga0316180_10172003 | 290 |
| 106 | 3300031507 | Ga0307509_10372912 | Ga0307509_103729122 | 290 |
| 107 | 3300041452 | Ga0451793_0047961 | Ga0451793_0047961_358_1239 | 290 |
| 108 | 3300041453 | Ga0451797_1249120 | Ga0451797_1249120_1105_1986 | 290 |
| 109 | 3300041456 | Ga0451795_1089617 | Ga0451795_1089617_260_1141 | 290 |
| 110 | 3300041460 | Ga0451802_0218464 | Ga0451802_0218464_283_1164 | 290 |
| 111 | 3300041491 | Ga0451833_1139607 | Ga0451833_1139607_334_1215 | 290 |
| 112 | 3300041494 | Ga0451837_0618149 | Ga0451837_0618149_2102_2983 | 290 |
| 113 | 3300041496 | Ga0451839_0744362 | Ga0451839_0744362_41_922 | 290 |
| 114 | 3300041498 | Ga0451841_0208188 | Ga0451841_0208188_3449_4330 | 290 |
| 115 | 3300041509 | Ga0451843_0146450 | Ga0451843_0146450_3560_4441 | 290 |
| 116 | 3300044683 | Ga0466965_0003197 | Ga0466965_0003197_2433_3308 | 290 |
| 117 | 3300044683 | Ga0466965_0027851 | Ga0466965_0027851_1481_2356 | 290 |
| 118 | 3300046809 | Ga0495600_0102149 | Ga0495600_0102149_378_1259 | 290 |
| 119 | 3300048905 | Ga0496102_0053608 | Ga0496102_0053608_1357_2238 | 290 |
| 120 | 3300048917 | Ga0496114_0082109 | Ga0496114_0082109_450_1331 | 290 |
| 121 | iso_pu_bacteria | 2738543034 | 2739364515 | 290 |
| 122 | iso_pu_bacteria | 2842888712 | 2842890005 | 290 |
| 123 | iso_pu_bacteria | 2902792274 | 2902797185 | 290 |
| 124 | iso_pu_bacteria | 2904765812 | 2904766791 | 290 |
| 125 | iso_pu_bacteria | 2904770941 | 2904775197 | 290 |
| 126 | iso_pu_bacteria | 2908811453 | 2908814485 | 290 |
| 127 | iso_pu_bacteria | 2919420072 | 2919420773 | 290 |
| 128 | iso_pu_bacteria | 2919432681 | 2919433469 | 290 |
| 129 | iso_pu_bacteria | 2928142448 | 2928145461 | 290 |
| 130 | iso_pu_bacteria | 2974315732 | 2974318781 | 290 |
| 131 | iso_pu_bacteria | 2984523437 | 2984527055 | 290 |
| 132 | 3300005435 | Ga0070714_100001783 | Ga0070714_10000178313 | 291 |
| 133 | 3300005437 | Ga0070710_10000045 | Ga0070710_1000004547 | 291 |
| 134 | 3300006028 | Ga0070717_10061722 | Ga0070717_100617223 | 291 |
| 135 | 3300025929 | Ga0207664_10008997 | Ga0207664_100089974 | 291 |
| 136 | 3300044658 | Ga0466972_0037866 | Ga0466972_0037866_1257_2174 | 291 |
| 137 | 3300045049 | Ga0466959_0286943 | Ga0466959_0286943_80_997 | 291 |
| 138 | 3300045976 | Ga0466967_0058809 | Ga0466967_0058809_1534_2433 | 291 |
| 139 | iso_pu_bacteria | 2565956761 | 2566996168 | 291 |
| 140 | iso_pu_bacteria | 2643221687 | 2644491276 | 291 |
| 141 | iso_pu_bacteria | 2643221715 | 2644636543 | 291 |
| 142 | iso_pu_bacteria | 2738541264 | 2738667362 | 291 |
| 143 | iso_pu_bacteria | 2738541274 | 2738706355 | 291 |
| 144 | iso_pu_bacteria | 2738541308 | 2738888735 | 291 |
| 145 | iso_pu_bacteria | 2738541356 | 2739146205 | 291 |
| 146 | iso_pu_bacteria | 2738543011 | 2739237873 | 291 |
| 147 | iso_pu_bacteria | 2738543028 | 2739328845 | 291 |
| 148 | iso_pu_bacteria | 2751185725 | 2753038816 | 291 |
| 149 | iso_pu_bacteria | 2751185792 | 2753327464 | 291 |
| 150 | iso_pu_bacteria | 2842134933 | 2842139491 | 291 |
| 151 | iso_pu_bacteria | 2889300758 | 2889303615 | 291 |
| 152 | iso_pu_bacteria | 2902810491 | 2902814505 | 291 |
| 153 | iso_pu_bacteria | 2902837492 | 2902839221 | 291 |
| 154 | iso_pu_bacteria | 2904535858 | 2904540804 | 291 |
| 155 | iso_pu_bacteria | 2922554459 | 2922554895 | 291 |
| 156 | iso_pu_bacteria | 2929212328 | 2929217913 | 291 |
| 157 | iso_pu_bacteria | 2939582691 | 2939585139 | 291 |
| 158 | iso_pu_bacteria | 2939743619 | 2939747400 | 291 |
| 159 | iso_pu_bacteria | 3001119090 | 3001119469 | 291 |
| 160 | 3300050510 | nmdc:mga06r32_67274_c1 | nmdc:mga06r32_67274_c1_405_1289 | 292 |
| 161 | 3300050510 | nmdc:mga06r32_70938_c1 | nmdc:mga06r32_70938_c1_2171_3055 | 292 |
| 162 | iso_pu_bacteria | 2902799365 | 2902804135 | 292 |
| 163 | 3300005329 | Ga0070683_100126889 | Ga0070683_1001268893 | 294 |
| 164 | 3300005435 | Ga0070714_100139451 | Ga0070714_1001394512 | 294 |
| 165 | 3300025929 | Ga0207664_10123324 | Ga0207664_101233243 | 294 |
| 166 | 3300025944 | Ga0207661_10170923 | Ga0207661_101709232 | 294 |
| 167 | 3300031251 | Ga0265327_10000004 | Ga0265327_10000004415 | 294 |
| 168 | 3300044842 | Ga0466957_0097697 | Ga0466957_0097697_767_1657 | 294 |
| 169 | 3300044901 | Ga0466960_0001245 | Ga0466960_0001245_7895_8785 | 294 |
| 170 | 3300045836 | Ga0466958_0049686 | Ga0466958_0049686_54_944 | 294 |
| 171 | 3300045976 | Ga0466967_0004219 | Ga0466967_0004219_2500_3390 | 294 |
| 172 | 3300045976 | Ga0466967_0124714 | Ga0466967_0124714_901_1791 | 294 |
| 173 | 3300046531 | Ga0495665_0010417 | Ga0495665_0010417_478_1362 | 294 |
| 174 | 3300046674 | Ga0495588_0014586 | Ga0495588_0014586_468_1352 | 294 |
| 175 | 3300048903 | Ga0496100_0000780 | Ga0496100_0000780_7956_8858 | 294 |
| 176 | 3300048904 | Ga0496101_0000031 | Ga0496101_0000031_36202_37104 | 294 |
| 177 | 3300048904 | Ga0496101_0093441 | Ga0496101_0093441_370_1254 | 294 |
| 178 | 3300048909 | Ga0496106_0092337 | Ga0496106_0092337_766_1668 | 294 |
| 179 | 3300048917 | Ga0496114_0453977 | Ga0496114_0453977_126_1010 | 294 |
| 180 | 3300048920 | Ga0496117_0055066 | Ga0496117_0055066_1260_2150 | 294 |
| 181 | 3300048921 | Ga0496118_0000272 | Ga0496118_0000272_12364_13254 | 294 |
| 182 | 3300048922 | Ga0496119_0191666 | Ga0496119_0191666_89_991 | 294 |
| 183 | 3300048923 | Ga0496120_0052147 | Ga0496120_0052147_103_1005 | 294 |
| 184 | 3300048924 | Ga0496121_0000728 | Ga0496121_0000728_13363_14265 | 294 |
| 185 | 3300049569 | Ga0501032_0004435 | Ga0501032_0004435_836_1726 | 294 |
| 186 | 3300049571 | Ga0501034_0001406 | Ga0501034_0001406_17688_18578 | 294 |
| 187 | 3300049572 | Ga0501036_0041340 | Ga0501036_0041340_2062_2952 | 294 |
| 188 | 3300049579 | Ga0501043_0007935 | Ga0501043_0007935_3178_4068 | 294 |
| 189 | 3300049580 | Ga0501046_0000302 | Ga0501046_0000302_20426_21316 | 294 |
| 190 | 3300049581 | Ga0501047_0001510 | Ga0501047_0001510_7938_8828 | 294 |
| 191 | 3300049581 | Ga0501047_0374947 | Ga0501047_0374947_58_948 | 294 |
| 192 | 3300049582 | Ga0501048_0010014 | Ga0501048_0010014_3744_4634 | 294 |
| 193 | 3300049586 | Ga0501070_0000731 | Ga0501070_0000731_17422_18312 | 294 |
| 194 | 3300049822 | Ga0501035_0000665 | Ga0501035_0000665_28639_29529 | 294 |
| 195 | 3300049823 | Ga0501044_0001249 | Ga0501044_0001249_6947_7837 | 294 |
| 196 | 3300050491 | nmdc:mga00v17_218881_c1 | nmdc:mga00v17_218881_c1_10_894 | 294 |
| 197 | iso_pu_bacteria | 2956939328 | 2956942118 | 294 |
| 198 | 3300002077 | JGI24744J21845_10000674 | JGI24744J21845_100006746 | 295 |
| 199 | 3300002077 | JGI24744J21845_10009096 | JGI24744J21845_100090962 | 295 |
| 200 | 3300002244 | JGI24742J22300_10001092 | JGI24742J22300_100010922 | 295 |
| 201 | 3300003792 | Ga0055540_1000071 | Ga0055540_100007184 | 295 |
| 202 | 3300003792 | Ga0055540_1001892 | Ga0055540_10018928 | 295 |
| 203 | 3300003792 | Ga0055540_1004083 | Ga0055540_10040834 | 295 |
| 204 | 3300003792 | Ga0055540_1006412 | Ga0055540_10064122 | 295 |
| 205 | 3300005330 | Ga0070690_100189339 | Ga0070690_1001893392 | 295 |
| 206 | 3300005334 | Ga0068869_100023810 | Ga0068869_1000238102 | 295 |
| 207 | 3300005337 | Ga0070682_100024647 | Ga0070682_1000246471 | 295 |
| 208 | 3300005338 | Ga0068868_100000247 | Ga0068868_10000024723 | 295 |
| 209 | 3300005338 | Ga0068868_100212692 | Ga0068868_1002126922 | 295 |
| 210 | 3300005340 | Ga0070689_100035103 | Ga0070689_1000351033 | 295 |
| 211 | 3300005340 | Ga0070689_100035692 | Ga0070689_1000356922 | 295 |
| 212 | 3300005343 | Ga0070687_100101596 | Ga0070687_1001015962 | 295 |
| 213 | 3300005345 | Ga0070692_10031155 | Ga0070692_100311552 | 295 |
| 214 | 3300005347 | Ga0070668_100001215 | Ga0070668_10000121512 | 295 |
| 215 | 3300005347 | Ga0070668_100005003 | Ga0070668_1000050039 | 295 |
| 216 | 3300005353 | Ga0070669_100005981 | Ga0070669_10000598110 | 295 |
| 217 | 3300005353 | Ga0070669_100071087 | Ga0070669_1000710873 | 295 |
| 218 | 3300005354 | Ga0070675_100030390 | Ga0070675_1000303905 | 295 |
| 219 | 3300005355 | Ga0070671_100000923 | Ga0070671_10000092312 | 295 |
| 220 | 3300005355 | Ga0070671_100148547 | Ga0070671_1001485472 | 295 |
| 221 | 3300005356 | Ga0070674_100001479 | Ga0070674_1000014796 | 295 |
| 222 | 3300005356 | Ga0070674_100017589 | Ga0070674_1000175892 | 295 |
| 223 | 3300005364 | Ga0070673_100159190 | Ga0070673_1001591902 | 295 |
| 224 | 3300005367 | Ga0070667_100000535 | Ga0070667_10000053516 | 295 |
| 225 | 3300005367 | Ga0070667_100001027 | Ga0070667_10000102717 | 295 |
| 226 | 3300005367 | Ga0070667_100008266 | Ga0070667_1000082665 | 295 |
| 227 | 3300005434 | Ga0070709_10061049 | Ga0070709_100610494 | 295 |
| 228 | 3300005436 | Ga0070713_100062771 | Ga0070713_1000627712 | 295 |
| 229 | 3300005437 | Ga0070710_10013147 | Ga0070710_100131474 | 295 |
| 230 | 3300005438 | Ga0070701_10000386 | Ga0070701_100003865 | 295 |
| 231 | 3300005439 | Ga0070711_100227277 | Ga0070711_1002272771 | 295 |
| 232 | 3300005439 | Ga0070711_100273759 | Ga0070711_1002737592 | 295 |
| 233 | 3300005440 | Ga0070705_100017328 | Ga0070705_1000173283 | 295 |
| 234 | 3300005441 | Ga0070700_100002202 | Ga0070700_1000022024 | 295 |
| 235 | 3300005444 | Ga0070694_100014961 | Ga0070694_1000149613 | 295 |
| 236 | 3300005457 | Ga0070662_100025252 | Ga0070662_1000252523 | 295 |
| 237 | 3300005459 | Ga0068867_100036729 | Ga0068867_1000367292 | 295 |
| 238 | 3300005536 | Ga0070697_100341626 | Ga0070697_1003416262 | 295 |
| 239 | 3300005539 | Ga0068853_100001631 | Ga0068853_10000163113 | 295 |
| 240 | 3300005539 | Ga0068853_100006430 | Ga0068853_1000064304 | 295 |
| 241 | 3300005544 | Ga0070686_100282491 | Ga0070686_1002824912 | 295 |
| 242 | 3300005545 | Ga0070695_100003191 | Ga0070695_1000031919 | 295 |
| 243 | 3300005546 | Ga0070696_100066824 | Ga0070696_1000668243 | 295 |
| 244 | 3300005548 | Ga0070665_100020021 | Ga0070665_1000200212 | 295 |
| 245 | 3300005548 | Ga0070665_100029960 | Ga0070665_1000299604 | 295 |
| 246 | 3300005548 | Ga0070665_100085885 | Ga0070665_1000858853 | 295 |
| 247 | 3300005549 | Ga0070704_100003757 | Ga0070704_1000037579 | 295 |
| 248 | 3300005578 | Ga0068854_100005222 | Ga0068854_1000052222 | 295 |
| 249 | 3300005615 | Ga0070702_100002393 | Ga0070702_1000023936 | 295 |
| 250 | 3300005615 | Ga0070702_100011901 | Ga0070702_1000119011 | 295 |
| 251 | 3300005616 | Ga0068852_100098908 | Ga0068852_1000989082 | 295 |
| 252 | 3300005617 | Ga0068859_100001716 | Ga0068859_1000017169 | 295 |
| 253 | 3300005617 | Ga0068859_100002325 | Ga0068859_1000023256 | 295 |
| 254 | 3300005617 | Ga0068859_100313470 | Ga0068859_1003134702 | 295 |
| 255 | 3300005618 | Ga0068864_100275426 | Ga0068864_1002754262 | 295 |
| 256 | 3300005718 | Ga0068866_10000253 | Ga0068866_100002536 | 295 |
| 257 | 3300005718 | Ga0068866_10019371 | Ga0068866_100193712 | 295 |
| 258 | 3300005718 | Ga0068866_10090344 | Ga0068866_100903442 | 295 |
| 259 | 3300005719 | Ga0068861_100077078 | Ga0068861_1000770783 | 295 |
| 260 | 3300005841 | Ga0068863_100000143 | Ga0068863_10000014367 | 295 |
| 261 | 3300005841 | Ga0068863_100004971 | Ga0068863_1000049712 | 295 |
| 262 | 3300005842 | Ga0068858_100002178 | Ga0068858_1000021783 | 295 |
| 263 | 3300005842 | Ga0068858_100004006 | Ga0068858_10000400616 | 295 |
| 264 | 3300005842 | Ga0068858_100024382 | Ga0068858_1000243822 | 295 |
| 265 | 3300005843 | Ga0068860_100000079 | Ga0068860_100000079133 | 295 |
| 266 | 3300005843 | Ga0068860_100003457 | Ga0068860_1000034577 | 295 |
| 267 | 3300005843 | Ga0068860_100249927 | Ga0068860_1002499272 | 295 |
| 268 | 3300005844 | Ga0068862_100000093 | Ga0068862_10000009317 | 295 |
| 269 | 3300005937 | Ga0081455_10322534 | Ga0081455_103225341 | 295 |
| 270 | 3300006038 | Ga0075365_10011313 | Ga0075365_100113135 | 295 |
| 271 | 3300006038 | Ga0075365_10013099 | Ga0075365_100130994 | 295 |
| 272 | 3300006038 | Ga0075365_10022237 | Ga0075365_100222375 | 295 |
| 273 | 3300006038 | Ga0075365_10027954 | Ga0075365_100279542 | 295 |
| 274 | 3300006038 | Ga0075365_10029657 | Ga0075365_100296572 | 295 |
| 275 | 3300006038 | Ga0075365_10038215 | Ga0075365_100382153 | 295 |
| 276 | 3300006038 | Ga0075365_10327337 | Ga0075365_103273371 | 295 |
| 277 | 3300006048 | Ga0075363_100001910 | Ga0075363_1000019106 | 295 |
| 278 | 3300006048 | Ga0075363_100016373 | Ga0075363_1000163732 | 295 |
| 279 | 3300006048 | Ga0075363_100031557 | Ga0075363_1000315573 | 295 |
| 280 | 3300006048 | Ga0075363_100121744 | Ga0075363_1001217442 | 295 |
| 281 | 3300006051 | Ga0075364_10002940 | Ga0075364_100029408 | 295 |
| 282 | 3300006051 | Ga0075364_10003555 | Ga0075364_100035551 | 295 |
| 283 | 3300006051 | Ga0075364_10005526 | Ga0075364_100055262 | 295 |
| 284 | 3300006051 | Ga0075364_10035612 | Ga0075364_100356122 | 295 |
| 285 | 3300006051 | Ga0075364_10105021 | Ga0075364_101050212 | 295 |
| 286 | 3300006051 | Ga0075364_10145323 | Ga0075364_101453232 | 295 |
| 287 | 3300006173 | Ga0070716_100017229 | Ga0070716_1000172294 | 295 |
| 288 | 3300006173 | Ga0070716_100105601 | Ga0070716_1001056012 | 295 |
| 289 | 3300006173 | Ga0070716_100166035 | Ga0070716_1001660352 | 295 |
| 290 | 3300006175 | Ga0070712_100000630 | Ga0070712_1000006308 | 295 |
| 291 | 3300006175 | Ga0070712_100541810 | Ga0070712_1005418102 | 295 |
| 292 | 3300006177 | Ga0075362_10005065 | Ga0075362_100050655 | 295 |
| 293 | 3300006177 | Ga0075362_10042218 | Ga0075362_100422181 | 295 |
| 294 | 3300006178 | Ga0075367_10012202 | Ga0075367_100122022 | 295 |
| 295 | 3300006178 | Ga0075367_10027541 | Ga0075367_100275412 | 295 |
| 296 | 3300006186 | Ga0075369_10000029 | Ga0075369_1000002930 | 295 |
| 297 | 3300006186 | Ga0075369_10010587 | Ga0075369_100105873 | 295 |
| 298 | 3300006186 | Ga0075369_10046806 | Ga0075369_100468062 | 295 |
| 299 | 3300006186 | Ga0075369_10118654 | Ga0075369_101186542 | 295 |
| 300 | 3300006237 | Ga0097621_100021985 | Ga0097621_1000219855 | 295 |
| 301 | 3300006353 | Ga0075370_10001915 | Ga0075370_100019152 | 295 |
| 302 | 3300006353 | Ga0075370_10005336 | Ga0075370_100053362 | 295 |
| 303 | 3300006353 | Ga0075370_10032492 | Ga0075370_100324922 | 295 |
| 304 | 3300006353 | Ga0075370_10056162 | Ga0075370_100561624 | 295 |
| 305 | 3300006353 | Ga0075370_10118426 | Ga0075370_101184262 | 295 |
| 306 | 3300006844 | Ga0075428_100045160 | Ga0075428_1000451602 | 295 |
| 307 | 3300006847 | Ga0075431_100135176 | Ga0075431_1001351762 | 295 |
| 308 | 3300006881 | Ga0068865_100147800 | Ga0068865_1001478002 | 295 |
| 309 | 3300006931 | Ga0097620_100001716 | Ga0097620_1000017169 | 295 |
| 310 | 3300006931 | Ga0097620_100002325 | Ga0097620_1000023256 | 295 |
| 311 | 3300006931 | Ga0097620_100313470 | Ga0097620_1003134702 | 295 |
| 312 | 3300009093 | Ga0105240_10369152 | Ga0105240_103691522 | 295 |
| 313 | 3300009098 | Ga0105245_10002753 | Ga0105245_1000275317 | 295 |
| 314 | 3300009101 | Ga0105247_10001591 | Ga0105247_1000159113 | 295 |
| 315 | 3300009101 | Ga0105247_10001633 | Ga0105247_1000163316 | 295 |
| 316 | 3300009101 | Ga0105247_10005195 | Ga0105247_100051955 | 295 |
| 317 | 3300009101 | Ga0105247_10178849 | Ga0105247_101788492 | 295 |
| 318 | 3300009147 | Ga0114129_10237213 | Ga0114129_102372133 | 295 |
| 319 | 3300009148 | Ga0105243_10000274 | Ga0105243_1000027430 | 295 |
| 320 | 3300009148 | Ga0105243_10014300 | Ga0105243_100143005 | 295 |
| 321 | 3300009148 | Ga0105243_10303977 | Ga0105243_103039772 | 295 |
| 322 | 3300009174 | Ga0105241_10209310 | Ga0105241_102093102 | 295 |
| 323 | 3300009176 | Ga0105242_10002125 | Ga0105242_1000212517 | 295 |
| 324 | 3300009177 | Ga0105248_10000641 | Ga0105248_1000064118 | 295 |
| 325 | 3300009177 | Ga0105248_10061664 | Ga0105248_100616645 | 295 |
| 326 | 3300009177 | Ga0105248_10073423 | Ga0105248_100734233 | 295 |
| 327 | 3300009545 | Ga0105237_10062163 | Ga0105237_100621632 | 295 |
| 328 | 3300009545 | Ga0105237_10178490 | Ga0105237_101784902 | 295 |
| 329 | 3300009545 | Ga0105237_10286734 | Ga0105237_102867342 | 295 |
| 330 | 3300009551 | Ga0105238_10112010 | Ga0105238_101120104 | 295 |
| 331 | 3300009553 | Ga0105249_10000049 | Ga0105249_10000049131 | 295 |
| 332 | 3300009553 | Ga0105249_10003002 | Ga0105249_1000300217 | 295 |
| 333 | 3300009553 | Ga0105249_10183872 | Ga0105249_101838722 | 295 |
| 334 | 3300010159 | Ga0099796_10018706 | Ga0099796_100187062 | 295 |
| 335 | 3300010375 | Ga0105239_10051513 | Ga0105239_100515132 | 295 |
| 336 | 3300011119 | Ga0105246_10069726 | Ga0105246_100697262 | 295 |
| 337 | 3300011119 | Ga0105246_10184791 | Ga0105246_101847912 | 295 |
| 338 | 3300013105 | Ga0157369_10054360 | Ga0157369_100543602 | 295 |
| 339 | 3300013296 | Ga0157374_10007942 | Ga0157374_100079428 | 295 |
| 340 | 3300013297 | Ga0157378_10002404 | Ga0157378_100024046 | 295 |
| 341 | 3300013297 | Ga0157378_10217696 | Ga0157378_102176962 | 295 |
| 342 | 3300013297 | Ga0157378_10379988 | Ga0157378_103799882 | 295 |
| 343 | 3300013306 | Ga0163162_10057493 | Ga0163162_100574934 | 295 |
| 344 | 3300013307 | Ga0157372_10000917 | Ga0157372_1000091719 | 295 |
| 345 | 3300013308 | Ga0157375_10000573 | Ga0157375_1000057316 | 295 |
| 346 | 3300014325 | Ga0163163_10014803 | Ga0163163_100148032 | 295 |
| 347 | 3300014325 | Ga0163163_10079911 | Ga0163163_100799112 | 295 |
| 348 | 3300014326 | Ga0157380_10001337 | Ga0157380_100013377 | 295 |
| 349 | 3300014326 | Ga0157380_10234721 | Ga0157380_102347212 | 295 |
| 350 | 3300014745 | Ga0157377_10323220 | Ga0157377_103232202 | 295 |
| 351 | 3300014968 | Ga0157379_10035516 | Ga0157379_100355163 | 295 |
| 352 | 3300014969 | Ga0157376_10214156 | Ga0157376_102141562 | 295 |
| 353 | 3300017792 | Ga0163161_10009207 | Ga0163161_100092074 | 295 |
| 354 | 3300021384 | Ga0213876_10007007 | Ga0213876_100070077 | 295 |
| 355 | 3300021384 | Ga0213876_10010598 | Ga0213876_100105985 | 295 |
| 356 | 3300021384 | Ga0213876_10021820 | Ga0213876_100218204 | 295 |
| 357 | 3300021388 | Ga0213875_10012224 | Ga0213875_100122244 | 295 |
| 358 | 3300021388 | Ga0213875_10015347 | Ga0213875_100153472 | 295 |
| 359 | 3300021388 | Ga0213875_10038893 | Ga0213875_100388931 | 295 |
| 360 | 3300025303 | Ga0209051_1000033 | Ga0209051_1000033317 | 295 |
| 361 | 3300025303 | Ga0209051_1000775 | Ga0209051_10007752 | 295 |
| 362 | 3300025303 | Ga0209051_1007091 | Ga0209051_10070915 | 295 |
| 363 | 3300025303 | Ga0209051_1007985 | Ga0209051_10079853 | 295 |
| 364 | 3300025303 | Ga0209051_1032945 | Ga0209051_10329452 | 295 |
| 365 | 3300025885 | Ga0207653_10008494 | Ga0207653_100084942 | 295 |
| 366 | 3300025898 | Ga0207692_10005720 | Ga0207692_100057202 | 295 |
| 367 | 3300025898 | Ga0207692_10061619 | Ga0207692_100616192 | 295 |
| 368 | 3300025899 | Ga0207642_10000191 | Ga0207642_100001919 | 295 |
| 369 | 3300025899 | Ga0207642_10070184 | Ga0207642_100701842 | 295 |
| 370 | 3300025900 | Ga0207710_10000350 | Ga0207710_1000035023 | 295 |
| 371 | 3300025900 | Ga0207710_10000908 | Ga0207710_1000090816 | 295 |
| 372 | 3300025904 | Ga0207647_10090023 | Ga0207647_100900232 | 295 |
| 373 | 3300025907 | Ga0207645_10017918 | Ga0207645_100179182 | 295 |
| 374 | 3300025911 | Ga0207654_10178804 | Ga0207654_101788042 | 295 |
| 375 | 3300025915 | Ga0207693_10000197 | Ga0207693_1000019742 | 295 |
| 376 | 3300025915 | Ga0207693_10000771 | Ga0207693_1000077124 | 295 |
| 377 | 3300025916 | Ga0207663_10001796 | Ga0207663_1000179611 | 295 |
| 378 | 3300025916 | Ga0207663_10094352 | Ga0207663_100943522 | 295 |
| 379 | 3300025918 | Ga0207662_10070465 | Ga0207662_100704652 | 295 |
| 380 | 3300025922 | Ga0207646_10151154 | Ga0207646_101511542 | 295 |
| 381 | 3300025923 | Ga0207681_10016662 | Ga0207681_100166623 | 295 |
| 382 | 3300025924 | Ga0207694_10166166 | Ga0207694_101661662 | 295 |
| 383 | 3300025927 | Ga0207687_10031639 | Ga0207687_100316394 | 295 |
| 384 | 3300025928 | Ga0207700_10123926 | Ga0207700_101239262 | 295 |
| 385 | 3300025932 | Ga0207690_10086666 | Ga0207690_100866662 | 295 |
| 386 | 3300025933 | Ga0207706_10013062 | Ga0207706_100130625 | 295 |
| 387 | 3300025933 | Ga0207706_10265013 | Ga0207706_102650132 | 295 |
| 388 | 3300025934 | Ga0207686_10218679 | Ga0207686_102186792 | 295 |
| 389 | 3300025935 | Ga0207709_10001002 | Ga0207709_1000100219 | 295 |
| 390 | 3300025936 | Ga0207670_10024097 | Ga0207670_100240973 | 295 |
| 391 | 3300025936 | Ga0207670_10029869 | Ga0207670_100298694 | 295 |
| 392 | 3300025937 | Ga0207669_10004626 | Ga0207669_100046264 | 295 |
| 393 | 3300025938 | Ga0207704_10000448 | Ga0207704_100004486 | 295 |
| 394 | 3300025939 | Ga0207665_10007076 | Ga0207665_100070768 | 295 |
| 395 | 3300025940 | Ga0207691_10016548 | Ga0207691_100165482 | 295 |
| 396 | 3300025941 | Ga0207711_10002851 | Ga0207711_1000285110 | 295 |
| 397 | 3300025941 | Ga0207711_10129967 | Ga0207711_101299672 | 295 |
| 398 | 3300025942 | Ga0207689_10009089 | Ga0207689_100090892 | 295 |
| 399 | 3300025949 | Ga0207667_10183960 | Ga0207667_101839602 | 295 |
| 400 | 3300025960 | Ga0207651_10027395 | Ga0207651_100273952 | 295 |
| 401 | 3300025961 | Ga0207712_10000038 | Ga0207712_10000038145 | 295 |
| 402 | 3300025961 | Ga0207712_10010767 | Ga0207712_100107673 | 295 |
| 403 | 3300025961 | Ga0207712_10247623 | Ga0207712_102476232 | 295 |
| 404 | 3300025972 | Ga0207668_10000838 | Ga0207668_100008387 | 295 |
| 405 | 3300025972 | Ga0207668_10001862 | Ga0207668_100018629 | 295 |
| 406 | 3300025972 | Ga0207668_10100060 | Ga0207668_101000602 | 295 |
| 407 | 3300025981 | Ga0207640_10059883 | Ga0207640_100598832 | 295 |
| 408 | 3300025986 | Ga0207658_10001213 | Ga0207658_1000121315 | 295 |
| 409 | 3300025986 | Ga0207658_10002007 | Ga0207658_1000200713 | 295 |
| 410 | 3300025986 | Ga0207658_10002028 | Ga0207658_1000202814 | 295 |
| 411 | 3300025986 | Ga0207658_10006634 | Ga0207658_100066348 | 295 |
| 412 | 3300025986 | Ga0207658_10040484 | Ga0207658_100404842 | 295 |
| 413 | 3300026035 | Ga0207703_10015904 | Ga0207703_100159045 | 295 |
| 414 | 3300026035 | Ga0207703_10028817 | Ga0207703_100288173 | 295 |
| 415 | 3300026041 | Ga0207639_10013506 | Ga0207639_100135064 | 295 |
| 416 | 3300026041 | Ga0207639_10107907 | Ga0207639_101079072 | 295 |
| 417 | 3300026067 | Ga0207678_10013351 | Ga0207678_100133514 | 295 |
| 418 | 3300026067 | Ga0207678_10016619 | Ga0207678_100166192 | 295 |
| 419 | 3300026067 | Ga0207678_10078476 | Ga0207678_100784763 | 295 |
| 420 | 3300026075 | Ga0207708_10001480 | Ga0207708_1000148017 | 295 |
| 421 | 3300026075 | Ga0207708_10009483 | Ga0207708_100094836 | 295 |
| 422 | 3300026078 | Ga0207702_10637400 | Ga0207702_106374002 | 295 |
| 423 | 3300026088 | Ga0207641_10000232 | Ga0207641_1000023216 | 295 |
| 424 | 3300026088 | Ga0207641_10187414 | Ga0207641_101874142 | 295 |
| 425 | 3300026089 | Ga0207648_10001458 | Ga0207648_100014586 | 295 |
| 426 | 3300026095 | Ga0207676_10285713 | Ga0207676_102857132 | 295 |
| 427 | 3300026095 | Ga0207676_10365804 | Ga0207676_103658042 | 295 |
| 428 | 3300026121 | Ga0207683_10000996 | Ga0207683_1000099626 | 295 |
| 429 | 3300026121 | Ga0207683_10029948 | Ga0207683_100299483 | 295 |
| 430 | 3300028379 | Ga0268266_10006941 | Ga0268266_100069417 | 295 |
| 431 | 3300028379 | Ga0268266_10108023 | Ga0268266_101080232 | 295 |
| 432 | 3300028379 | Ga0268266_10228292 | Ga0268266_102282922 | 295 |
| 433 | 3300028380 | Ga0268265_10000053 | Ga0268265_1000005317 | 295 |
| 434 | 3300028381 | Ga0268264_10000017 | Ga0268264_10000017131 | 295 |
| 435 | 3300028381 | Ga0268264_10038818 | Ga0268264_100388184 | 295 |
| 436 | 3300031251 | Ga0265327_10000131 | Ga0265327_10000131138 | 295 |
| 437 | 3300031251 | Ga0265327_10005208 | Ga0265327_1000520810 | 295 |
| 438 | 3300031251 | Ga0265327_10009131 | Ga0265327_100091315 | 295 |
| 439 | 3300031852 | Ga0307410_10184337 | Ga0307410_101843372 | 295 |
| 440 | 3300031901 | Ga0307406_10433186 | Ga0307406_104331862 | 295 |
| 441 | 3300031995 | Ga0307409_100187805 | Ga0307409_1001878052 | 295 |
| 442 | 3300032005 | Ga0307411_10050680 | Ga0307411_100506802 | 295 |
| 443 | 3300032126 | Ga0307415_100049110 | Ga0307415_1000491102 | 295 |
| 444 | 3300035121 | Ga0373960_0065301 | Ga0373960_0065301_102_995 | 295 |
| 445 | 3300035170 | Ga0373943_0027530 | Ga0373943_0027530_1088_1981 | 295 |
| 446 | 3300035691 | Ga0373931_0121486 | Ga0373931_0121486_202_1089 | 295 |
| 447 | 3300035691 | Ga0373931_0151868 | Ga0373931_0151868_407_1300 | 295 |
| 448 | 3300035725 | Ga0373947_0100566 | Ga0373947_0100566_243_1136 | 295 |
| 449 | 3300037853 | Ga0436364_0222313 | Ga0436364_0222313_1342_2247 | 295 |
| 450 | 3300037853 | Ga0436364_0437152 | Ga0436364_0437152_555_1448 | 295 |
| 451 | 3300037853 | Ga0436364_1361024 | Ga0436364_1361024_4227_5120 | 295 |
| 452 | 3300037853 | Ga0436364_1486811 | Ga0436364_1486811_1860_2891 | 295 |
| 453 | 3300039437 | Ga0436365_0219282 | Ga0436365_0219282_1819_2712 | 295 |
| 454 | 3300039437 | Ga0436365_0271296 | Ga0436365_0271296_19504_20397 | 295 |
| 455 | 3300039437 | Ga0436365_0716503 | Ga0436365_0716503_1694_2587 | 295 |
| 456 | 3300039437 | Ga0436365_0892446 | Ga0436365_0892446_47_1078 | 295 |
| 457 | 3300039437 | Ga0436365_1781365 | Ga0436365_1781365_12380_13285 | 295 |
| 458 | 3300039447 | Ga0436361_0588918 | Ga0436361_0588918_509_1405 | 295 |
| 459 | 3300039450 | Ga0436363_0356295 | Ga0436363_0356295_1817_2704 | 295 |
| 460 | 3300039453 | Ga0436362_1086447 | Ga0436362_1086447_13_906 | 295 |
| 461 | 3300041410 | Ga0439461_0001905 | Ga0439461_0001905_2054_2941 | 295 |
| 462 | 3300041411 | Ga0439466_0008886 | Ga0439466_0008886_1970_2857 | 295 |
| 463 | 3300041411 | Ga0439466_0014516 | Ga0439466_0014516_1715_2602 | 295 |
| 464 | 3300041413 | Ga0439465_0001890 | Ga0439465_0001890_5325_6212 | 295 |
| 465 | 3300041997 | Ga0439431_0000474 | Ga0439431_0000474_3953_4840 | 295 |
| 466 | 3300042004 | Ga0439445_0009947 | Ga0439445_0009947_976_1863 | 295 |
| 467 | 3300044658 | Ga0466972_0029290 | Ga0466972_0029290_1736_2647 | 295 |
| 468 | 3300044658 | Ga0466972_0036732 | Ga0466972_0036732_1304_2191 | 295 |
| 469 | 3300044658 | Ga0466972_0041291 | Ga0466972_0041291_871_1758 | 295 |
| 470 | 3300044658 | Ga0466972_0045810 | Ga0466972_0045810_97_984 | 295 |
| 471 | 3300044658 | Ga0466972_0065963 | Ga0466972_0065963_472_1359 | 295 |
| 472 | 3300044683 | Ga0466965_0005322 | Ga0466965_0005322_292_1179 | 295 |
| 473 | 3300044684 | Ga0466966_0009750 | Ga0466966_0009750_3627_4520 | 295 |
| 474 | 3300044684 | Ga0466966_0018116 | Ga0466966_0018116_2128_3015 | 295 |
| 475 | 3300044693 | Ga0466961_0016050 | Ga0466961_0016050_2184_3077 | 295 |
| 476 | 3300044693 | Ga0466961_0067126 | Ga0466961_0067126_401_1288 | 295 |
| 477 | 3300044694 | Ga0466963_0087879 | Ga0466963_0087879_580_1473 | 295 |
| 478 | 3300044694 | Ga0466963_0128468 | Ga0466963_0128468_812_1717 | 295 |
| 479 | 3300044706 | Ga0466964_0067387 | Ga0466964_0067387_578_1465 | 295 |
| 480 | 3300044719 | Ga0466971_0034221 | Ga0466971_0034221_285_1172 | 295 |
| 481 | 3300044735 | Ga0466968_0000435 | Ga0466968_0000435_12661_13548 | 295 |
| 482 | 3300044735 | Ga0466968_0006528 | Ga0466968_0006528_811_1704 | 295 |
| 483 | 3300044735 | Ga0466968_0073689 | Ga0466968_0073689_154_1041 | 295 |
| 484 | 3300044765 | Ga0466970_0018344 | Ga0466970_0018344_1835_2722 | 295 |
| 485 | 3300044765 | Ga0466970_0034589 | Ga0466970_0034589_1727_2614 | 295 |
| 486 | 3300044842 | Ga0466957_0006105 | Ga0466957_0006105_2154_3047 | 295 |
| 487 | 3300044842 | Ga0466957_0012121 | Ga0466957_0012121_1934_2821 | 295 |
| 488 | 3300044842 | Ga0466957_0119690 | Ga0466957_0119690_139_1026 | 295 |
| 489 | 3300044901 | Ga0466960_0000170 | Ga0466960_0000170_6006_6893 | 295 |
| 490 | 3300044901 | Ga0466960_0188595 | Ga0466960_0188595_18_911 | 295 |
| 491 | 3300045049 | Ga0466959_0042779 | Ga0466959_0042779_1670_2563 | 295 |
| 492 | 3300045049 | Ga0466959_0049302 | Ga0466959_0049302_1160_2047 | 295 |
| 493 | 3300045049 | Ga0466959_0149566 | Ga0466959_0149566_47_934 | 295 |
| 494 | 3300045049 | Ga0466959_0261992 | Ga0466959_0261992_198_1091 | 295 |
| 495 | 3300045836 | Ga0466958_0000545 | Ga0466958_0000545_12731_13624 | 295 |
| 496 | 3300045836 | Ga0466958_0026151 | Ga0466958_0026151_1143_2036 | 295 |
| 497 | 3300045836 | Ga0466958_0107582 | Ga0466958_0107582_716_1603 | 295 |
| 498 | 3300045976 | Ga0466967_0024083 | Ga0466967_0024083_3290_4189 | 295 |
| 499 | 3300045976 | Ga0466967_0417035 | Ga0466967_0417035_50_943 | 295 |
| 500 | 3300045976 | Ga0466967_0634920 | Ga0466967_0634920_35_922 | 295 |
| 501 | 3300046460 | Ga0495638_0008416 | Ga0495638_0008416_537_1430 | 295 |
| 502 | 3300046473 | Ga0495582_0072803 | Ga0495582_0072803_302_1195 | 295 |
| 503 | 3300046616 | Ga0495668_0011712 | Ga0495668_0011712_2193_3086 | 295 |
| 504 | 3300046642 | Ga0495634_0158752 | Ga0495634_0158752_291_1184 | 295 |
| 505 | 3300046660 | Ga0495625_0059991 | Ga0495625_0059991_211_1110 | 295 |
| 506 | 3300046683 | Ga0495658_0006659 | Ga0495658_0006659_4406_5299 | 295 |
| 507 | 3300046690 | Ga0495624_0033254 | Ga0495624_0033254_880_1773 | 295 |
| 508 | 3300047315 | Ga0495581_0045567 | Ga0495581_0045567_1333_2226 | 295 |
| 509 | 3300047320 | Ga0495672_0014046 | Ga0495672_0014046_2101_2994 | 295 |
| 510 | 3300047320 | Ga0495672_0096088 | Ga0495672_0096088_550_1437 | 295 |
| 511 | 3300047321 | Ga0495676_0032697 | Ga0495676_0032697_2788_3681 | 295 |
| 512 | 3300047472 | Ga0495686_0021340 | Ga0495686_0021340_671_1573 | 295 |
| 513 | 3300047673 | Ga0495593_0006211 | Ga0495593_0006211_500_1393 | 295 |
| 514 | 3300048903 | Ga0496100_0000029 | Ga0496100_0000029_101717_102616 | 295 |
| 515 | 3300048903 | Ga0496100_0001560 | Ga0496100_0001560_7184_8071 | 295 |
| 516 | 3300048903 | Ga0496100_0052366 | Ga0496100_0052366_114_1013 | 295 |
| 517 | 3300048903 | Ga0496100_0080938 | Ga0496100_0080938_455_1351 | 295 |
| 518 | 3300048903 | Ga0496100_0373163 | Ga0496100_0373163_33_926 | 295 |
| 519 | 3300048904 | Ga0496101_0000015 | Ga0496101_0000015_32082_32981 | 295 |
| 520 | 3300048904 | Ga0496101_0000717 | Ga0496101_0000717_15807_16706 | 295 |
| 521 | 3300048904 | Ga0496101_0015234 | Ga0496101_0015234_993_1880 | 295 |
| 522 | 3300048905 | Ga0496102_0000559 | Ga0496102_0000559_12829_13725 | 295 |
| 523 | 3300048905 | Ga0496102_0002030 | Ga0496102_0002030_11606_12493 | 295 |
| 524 | 3300048905 | Ga0496102_0028265 | Ga0496102_0028265_3229_4128 | 295 |
| 525 | 3300048905 | Ga0496102_0062848 | Ga0496102_0062848_1226_2125 | 295 |
| 526 | 3300048905 | Ga0496102_0121604 | Ga0496102_0121604_171_1064 | 295 |
| 527 | 3300048906 | Ga0496103_0000556 | Ga0496103_0000556_9168_10064 | 295 |
| 528 | 3300048906 | Ga0496103_0003067 | Ga0496103_0003067_9167_10054 | 295 |
| 529 | 3300048906 | Ga0496103_0090296 | Ga0496103_0090296_959_1852 | 295 |
| 530 | 3300048906 | Ga0496103_0147519 | Ga0496103_0147519_217_1104 | 295 |
| 531 | 3300048907 | Ga0496104_0001343 | Ga0496104_0001343_12503_13402 | 295 |
| 532 | 3300048907 | Ga0496104_0015016 | Ga0496104_0015016_4935_5822 | 295 |
| 533 | 3300048908 | Ga0496105_0006560 | Ga0496105_0006560_5971_6870 | 295 |
| 534 | 3300048908 | Ga0496105_0045395 | Ga0496105_0045395_1750_2637 | 295 |
| 535 | 3300048909 | Ga0496106_0000396 | Ga0496106_0000396_3646_4545 | 295 |
| 536 | 3300048909 | Ga0496106_0001046 | Ga0496106_0001046_8370_9269 | 295 |
| 537 | 3300048909 | Ga0496106_0026006 | Ga0496106_0026006_3280_4167 | 295 |
| 538 | 3300048909 | Ga0496106_0100390 | Ga0496106_0100390_1247_2140 | 295 |
| 539 | 3300048910 | Ga0496107_0000330 | Ga0496107_0000330_8622_9521 | 295 |
| 540 | 3300048910 | Ga0496107_0001096 | Ga0496107_0001096_13218_14117 | 295 |
| 541 | 3300048910 | Ga0496107_0015942 | Ga0496107_0015942_3621_4508 | 295 |
| 542 | 3300048911 | Ga0496108_0001084 | Ga0496108_0001084_16695_17582 | 295 |
| 543 | 3300048911 | Ga0496108_0003464 | Ga0496108_0003464_5978_6877 | 295 |
| 544 | 3300048911 | Ga0496108_0033538 | Ga0496108_0033538_860_1753 | 295 |
| 545 | 3300048911 | Ga0496108_0036517 | Ga0496108_0036517_1533_2426 | 295 |
| 546 | 3300048912 | Ga0496109_0000134 | Ga0496109_0000134_14878_15777 | 295 |
| 547 | 3300048912 | Ga0496109_0004328 | Ga0496109_0004328_899_1786 | 295 |
| 548 | 3300048912 | Ga0496109_0062738 | Ga0496109_0062738_1709_2605 | 295 |
| 549 | 3300048912 | Ga0496109_0064939 | Ga0496109_0064939_1212_2099 | 295 |
| 550 | 3300048912 | Ga0496109_0109215 | Ga0496109_0109215_1416_2303 | 295 |
| 551 | 3300048913 | Ga0496110_0096293 | Ga0496110_0096293_68_955 | 295 |
| 552 | 3300048913 | Ga0496110_0098094 | Ga0496110_0098094_1040_1939 | 295 |
| 553 | 3300048914 | Ga0496111_0136588 | Ga0496111_0136588_404_1303 | 295 |
| 554 | 3300048915 | Ga0496112_0018109 | Ga0496112_0018109_4088_4975 | 295 |
| 555 | 3300048915 | Ga0496112_0034944 | Ga0496112_0034944_3829_4716 | 295 |
| 556 | 3300048915 | Ga0496112_0152329 | Ga0496112_0152329_1115_2002 | 295 |
| 557 | 3300048916 | Ga0496113_0030325 | Ga0496113_0030325_768_1655 | 295 |
| 558 | 3300048916 | Ga0496113_0125919 | Ga0496113_0125919_674_1561 | 295 |
| 559 | 3300048916 | Ga0496113_0284331 | Ga0496113_0284331_35_934 | 295 |
| 560 | 3300048916 | Ga0496113_0285821 | Ga0496113_0285821_248_1135 | 295 |
| 561 | 3300048917 | Ga0496114_0001231 | Ga0496114_0001231_15878_16765 | 295 |
| 562 | 3300048917 | Ga0496114_0004867 | Ga0496114_0004867_6381_7280 | 295 |
| 563 | 3300048917 | Ga0496114_0126522 | Ga0496114_0126522_641_1540 | 295 |
| 564 | 3300048918 | Ga0496115_0002005 | Ga0496115_0002005_10050_10937 | 295 |
| 565 | 3300048918 | Ga0496115_0003450 | Ga0496115_0003450_23_922 | 295 |
| 566 | 3300048918 | Ga0496115_0018149 | Ga0496115_0018149_2690_3589 | 295 |
| 567 | 3300048919 | Ga0496116_0018374 | Ga0496116_0018374_1585_2481 | 295 |
| 568 | 3300048919 | Ga0496116_0019255 | Ga0496116_0019255_1250_2149 | 295 |
| 569 | 3300048920 | Ga0496117_0093875 | Ga0496117_0093875_204_1103 | 295 |
| 570 | 3300048921 | Ga0496118_0004348 | Ga0496118_0004348_13008_13904 | 295 |
| 571 | 3300048922 | Ga0496119_0003439 | Ga0496119_0003439_10105_11004 | 295 |
| 572 | 3300048922 | Ga0496119_0014096 | Ga0496119_0014096_2282_3178 | 295 |
| 573 | 3300048923 | Ga0496120_0013454 | Ga0496120_0013454_1128_2024 | 295 |
| 574 | 3300048923 | Ga0496120_0050017 | Ga0496120_0050017_514_1413 | 295 |
| 575 | 3300048923 | Ga0496120_0091148 | Ga0496120_0091148_519_1406 | 295 |
| 576 | 3300048924 | Ga0496121_0000004 | Ga0496121_0000004_567212_568111 | 295 |
| 577 | 3300048924 | Ga0496121_0047878 | Ga0496121_0047878_2699_3595 | 295 |
| 578 | 3300048925 | Ga0496122_0000138 | Ga0496122_0000138_69195_70094 | 295 |
| 579 | 3300048925 | Ga0496122_0054949 | Ga0496122_0054949_663_1550 | 295 |
| 580 | 3300048926 | Ga0496123_0007235 | Ga0496123_0007235_1534_2433 | 295 |
| 581 | 3300048926 | Ga0496123_0063893 | Ga0496123_0063893_708_1595 | 295 |
| 582 | 3300048927 | Ga0496124_0000012 | Ga0496124_0000012_292005_292904 | 295 |
| 583 | 3300048927 | Ga0496124_0105947 | Ga0496124_0105947_751_1647 | 295 |
| 584 | 3300048928 | Ga0496125_0000003 | Ga0496125_0000003_621657_622556 | 295 |
| 585 | 3300048928 | Ga0496125_0042302 | Ga0496125_0042302_1660_2553 | 295 |
| 586 | 3300048928 | Ga0496125_0049925 | Ga0496125_0049925_2258_3154 | 295 |
| 587 | 3300048929 | Ga0496126_0000001 | Ga0496126_0000001_567212_568111 | 295 |
| 588 | 3300048929 | Ga0496126_0005652 | Ga0496126_0005652_10744_11637 | 295 |
| 589 | 3300048929 | Ga0496126_0019389 | Ga0496126_0019389_5151_6038 | 295 |
| 590 | 3300048929 | Ga0496126_0093219 | Ga0496126_0093219_531_1424 | 295 |
| 591 | 3300049569 | Ga0501032_0001328 | Ga0501032_0001328_17760_18647 | 295 |
| 592 | 3300049571 | Ga0501034_0008577 | Ga0501034_0008577_123_1010 | 295 |
| 593 | 3300049572 | Ga0501036_0001872 | Ga0501036_0001872_11350_12237 | 295 |
| 594 | 3300049573 | Ga0501037_0000401 | Ga0501037_0000401_1057_1944 | 295 |
| 595 | 3300049574 | Ga0501038_0007683 | Ga0501038_0007683_1374_2261 | 295 |
| 596 | 3300049575 | Ga0501039_0003187 | Ga0501039_0003187_11276_12163 | 295 |
| 597 | 3300049579 | Ga0501043_0001795 | Ga0501043_0001795_6347_7234 | 295 |
| 598 | 3300049581 | Ga0501047_0008489 | Ga0501047_0008489_767_1663 | 295 |
| 599 | 3300049581 | Ga0501047_0223693 | Ga0501047_0223693_548_1441 | 295 |
| 600 | 3300049581 | Ga0501047_0558145 | Ga0501047_0558145_63_956 | 295 |
| 601 | 3300049586 | Ga0501070_0012220 | Ga0501070_0012220_460_1347 | 295 |
| 602 | 3300049586 | Ga0501070_0051180 | Ga0501070_0051180_180_1082 | 295 |
| 603 | 3300049742 | Ga0501080_0199315 | Ga0501080_0199315_831_1733 | 295 |
| 604 | 3300049822 | Ga0501035_0000742 | Ga0501035_0000742_12178_13071 | 295 |
| 605 | 3300049823 | Ga0501044_0000313 | Ga0501044_0000313_29192_30085 | 295 |
| 606 | 3300049823 | Ga0501044_0005938 | Ga0501044_0005938_11506_12393 | 295 |
| 607 | 3300049823 | Ga0501044_0015786 | Ga0501044_0015786_742_1635 | 295 |
| 608 | 3300050489 | nmdc:mga03683_1900_c1 | nmdc:mga03683_1900_c1_965_1852 | 295 |
| 609 | 3300050490 | nmdc:mga03n38_1249_c1 | nmdc:mga03n38_1249_c1_4552_5457 | 295 |
| 610 | 3300050490 | nmdc:mga03n38_77537_c1 | nmdc:mga03n38_77537_c1_577_1470 | 295 |
| 611 | 3300050491 | nmdc:mga00v17_142225_c1 | nmdc:mga00v17_142225_c1_196_1083 | 295 |
| 612 | 3300050491 | nmdc:mga00v17_22402_c1 | nmdc:mga00v17_22402_c1_2556_3461 | 295 |
| 613 | 3300050491 | nmdc:mga00v17_709_c1 | nmdc:mga00v17_709_c1_15350_16237 | 295 |
| 614 | 3300050491 | nmdc:mga00v17_7262_c1 | nmdc:mga00v17_7262_c1_3959_4852 | 295 |
| 615 | 3300050491 | nmdc:mga00v17_81797_c1 | nmdc:mga00v17_81797_c1_423_1310 | 295 |
| 616 | 3300050492 | nmdc:mga0yw44_210429_c1 | nmdc:mga0yw44_210429_c1_241_1134 | 295 |
| 617 | 3300050492 | nmdc:mga0yw44_235372_c1 | nmdc:mga0yw44_235372_c1_178_1071 | 295 |
| 618 | 3300050492 | nmdc:mga0yw44_57115_c1 | nmdc:mga0yw44_57115_c1_1345_2250 | 295 |
| 619 | 3300050492 | nmdc:mga0yw44_68000_c1 | nmdc:mga0yw44_68000_c1_86_973 | 295 |
| 620 | 3300050492 | nmdc:mga0yw44_68042_c1 | nmdc:mga0yw44_68042_c1_747_1634 | 295 |
| 621 | 3300050492 | nmdc:mga0yw44_8098_c1 | nmdc:mga0yw44_8098_c1_165_1058 | 295 |
| 622 | 3300050492 | nmdc:mga0yw44_84262_c1 | nmdc:mga0yw44_84262_c1_196_1083 | 295 |
| 623 | 3300050495 | nmdc:mga04h51_5850_c1 | nmdc:mga04h51_5850_c1_217_1104 | 295 |
| 624 | 3300050496 | nmdc:mga07m45_12814_c1 | nmdc:mga07m45_12814_c1_1409_2296 | 295 |
| 625 | 3300050496 | nmdc:mga07m45_29227_c1 | nmdc:mga07m45_29227_c1_355_1248 | 295 |
| 626 | 3300050496 | nmdc:mga07m45_38813_c1 | nmdc:mga07m45_38813_c1_40_927 | 295 |
| 627 | 3300050507 | nmdc:mga05p37_202951_c1 | nmdc:mga05p37_202951_c1_1481_2368 | 295 |
| 628 | 3300050509 | nmdc:mga0qj67_38699_c1 | nmdc:mga0qj67_38699_c1_172_1059 | 295 |
| 629 | 3300050516 | nmdc:mga0sz30_168625_c1 | nmdc:mga0sz30_168625_c1_28_915 | 295 |
| 630 | 3300050516 | nmdc:mga0sz30_338_c1 | nmdc:mga0sz30_338_c1_7663_8550 | 295 |
| 631 | 3300050516 | nmdc:mga0sz30_35904_c1 | nmdc:mga0sz30_35904_c1_378_1271 | 295 |
| 632 | 3300050516 | nmdc:mga0sz30_40125_c1 | nmdc:mga0sz30_40125_c1_130_1020 | 295 |
| 633 | 3300053087 | Ga0500643_003262 | Ga0500643_003262_5568_6461 | 295 |
| 634 | 3300053108 | Ga0500562_001188 | Ga0500562_001188_1796_2695 | 295 |
| 635 | 3300053730 | Ga0500645_000056 | Ga0500645_000056_38174_39067 | 295 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6z0r-assembly1.cif.gz_A | crystal structure of saicar synthetase (purc) from mycobacterium abscessus in complex with fragment 1 | 0.9665 | 1 | 295 |
| 3r9r-assembly1.cif.gz_A | structure of a phosphoribosylaminoimidazole-succinocarboxamide synthase from mycobacterium abscessus atcc 19977 / dsm 44196 | 0.9648 | 1 | 295 |
| 6yya-assembly1.cif.gz_A | crystal structure of saicar synthetase (purc) from mycobacterium abscessus in complex with inhibitor | 0.9643 | 1 | 295 |
| 6yyb-assembly1.cif.gz_A | crystal structure of saicar synthetase (purc) from mycobacterium abscessus in complex with inhibitor | 0.9632 | 1 | 295 |
| 6yya-assembly1.cif.gz_A | crystal structure of saicar synthetase (purc) from mycobacterium abscessus in complex with inhibitor | 0.9611 | 1 | 295 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WHN1_1_93_3.30.200.20 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 1.006 | 1 | 93 | 3.30.200.20 |
| af_P9WHN1_1_93_3.30.200.20 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.9952 | 1 | 93 | 3.30.200.20 |
| 3r9rA02 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9877 | 94 | 237 | 3.30.470.20 |
| 3r9rA02 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9743 | 94 | 237 | 3.30.470.20 |
| 1obgA02 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9662 | 94 | 237 | 3.30.470.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3S4W3U4-F1-model_v4 | deleted | 0.9982 | 92 | 198 |
|
| AF-T1CG79-F1-model_v4 | phosphoribosylaminoimidazolesuccinocarboxamide synthase (EC 6.3.2.6) | 0.9955 | 92 | 236 |
GO:0004639
GO:0005524 GO:0005737 GO:0006189 |
| AF-G0HCU7-F1-model_v4 | Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6) (SAICAR synthetase) | 0.9936 | 1 | 295 |
GO:0004639
GO:0005524 GO:0005737 GO:0006189 |
| AF-A0A6G3VQF6-F1-model_v4 | deleted | 0.9913 | 47 | 203 |
|
| AF-G0HCU7-F1-model_v4 | Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6) (SAICAR synthetase) | 0.9902 | 1 | 295 |
GO:0004639
GO:0005524 GO:0005737 GO:0006189 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar