F471263

General Info

Members Datasets Scaffolds Average Seq Length
635 341 587 296

Family's Representative Sequence

Representative Sequence 3300021388|Ga0213875_10038893|Ga0213875_100388931
Length 343
Sequence VAGLRGKRQLIGPDREAEQTPPLPRCSSDRDRTTATPSFAARYADPMRPALSDYQHLASGKVRELYRIDGDYLLFVASDRISAFDHVLDGLIPDKGRILTAMSVFFFELVEAPNHLAGPPDDPRIPDEVLGRALVVRQLEMVPVECVARGYLTGSGLLDYEQTGKVCGISLPPGLCEASRFSSPLFTPATKAELGHHDQNISFVEVIKMVGGVRANQLRDRTLQTYVQAADHALKRGIIIADTKFEFGIDAHDNLVLADEIFTPDSSRYWPANNYRAGEVQVSFDKQFVRNWLTGPESGWDRKGSQPPPPLPENIIDATRARYINAYERISGLRFDDWIGPGA

Samples

Sample ID Description Type Environment
1 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
2 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
3 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
4 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
5 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
6 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
7 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
8 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
9 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
10 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
11 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
12 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
13 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
14 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
15 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
16 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
17 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
18 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
19 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
20 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
21 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
22 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
23 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
24 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
25 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
26 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
27 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
28 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
29 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
30 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
31 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
32 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
33 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
34 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
35 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
36 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
37 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
38 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
39 2922554459 Rhodococcus sp. 66b Isolate Unclassified
40 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
41 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
42 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
43 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
44 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
45 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
46 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
47 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
48 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
49 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
50 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
51 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
52 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
53 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
54 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
55 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
56 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
57 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
58 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
59 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
60 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
61 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
62 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
63 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
64 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
65 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
66 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
67 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
68 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
69 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
70 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
71 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
72 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
73 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
74 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
75 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
76 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
77 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
78 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
79 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
80 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
81 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
82 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
83 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
84 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
85 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
86 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
87 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
88 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
89 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
90 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
91 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
92 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
93 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
94 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
95 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
96 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
97 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
98 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
99 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
100 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
101 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
102 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
103 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
104 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
105 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
106 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
107 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
108 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
109 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
111 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
112 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
113 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
114 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
115 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
116 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
117 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
118 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
119 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
120 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
121 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
122 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
123 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
124 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
125 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
127 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
128 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
129 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
130 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
131 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
132 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
133 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
134 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
135 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
136 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
137 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
138 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
139 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
140 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
141 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
142 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
143 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
144 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
145 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
146 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
147 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
148 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
149 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
150 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
151 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
201 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
202 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
203 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
204 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
205 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
206 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
207 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
208 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
209 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
210 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
211 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
212 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
213 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
214 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
215 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
216 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
217 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
218 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
219 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
220 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
221 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
222 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
223 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
224 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
225 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
226 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
227 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
228 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
229 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
230 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
231 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
232 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
233 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
234 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
235 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
236 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
237 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
238 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
239 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
240 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
241 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
242 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
243 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
244 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
245 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
246 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
247 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
248 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
249 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
250 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
251 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
252 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
253 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
254 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
255 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
256 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
257 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
258 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
259 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
260 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
261 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
262 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
263 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
264 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
265 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
266 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
267 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
268 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
269 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
270 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
271 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
272 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
273 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
274 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
275 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
276 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
277 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
278 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
279 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
280 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
281 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
282 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
283 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
284 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
285 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
286 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
287 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
288 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
289 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
290 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
291 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
292 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
293 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
294 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
295 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
296 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
297 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
298 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
299 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
300 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
301 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
312 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
313 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
315 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
316 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
317 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
318 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
319 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
320 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
321 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
322 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
323 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
324 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
325 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
326 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
327 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
328 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
329 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
330 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
331 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
332 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
333 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
334 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
335 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
336 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
337 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
338 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
339 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
340 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
341 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.44
Metatranscriptomes 0
Isolates 7.56

Biome Distribution

Category Percentage (%)
Aerial Root 0.16
Bulb 0
Endosphere 11.97
Nodule 0.16
Rhizoplane 11.34
Rhizosphere 62.2
Stem 0
Stem Tuber 0
Unclassified 14.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10000674 3300002077 Bacteria 6251
2 JGI24744J21845_10009096 3300002077 Bacteria 2041
3 JGI24742J22300_10001092 3300002244 Bacteria 4204
4 Ga0055540_1000071 3300003792 Bacteria 117607
5 Ga0055540_1001892 3300003792 Bacteria 11725
6 Ga0055540_1004083 3300003792 Bacteria 6766
7 Ga0055540_1006412 3300003792 Bacteria 4678
8 Ga0070683_100126889 3300005329 Bacteria 2412
9 Ga0070690_100189339 3300005330 Bacteria 1426
10 Ga0068869_100023810 3300005334 Bacteria 4236
11 Ga0070682_100024647 3300005337 Bacteria 3583
12 Ga0068868_100000247 3300005338 Bacteria 36780
13 Ga0068868_100212692 3300005338 Bacteria 1616
14 Ga0070689_100035103 3300005340 Bacteria 3830
15 Ga0070689_100035692 3300005340 Bacteria 3800
16 Ga0070687_100101596 3300005343 Bacteria 1611
17 Ga0070692_10031155 3300005345 Bacteria 2672
18 Ga0070668_100001215 3300005347 Bacteria 18315
19 Ga0070668_100005003 3300005347 Bacteria 9819
20 Ga0070669_100005981 3300005353 Bacteria 8779
21 Ga0070669_100071087 3300005353 Bacteria 2574
22 Ga0070675_100030390 3300005354 Bacteria 4362
23 Ga0070671_100000923 3300005355 Bacteria 21454
24 Ga0070671_100148547 3300005355 Bacteria 1979
25 Ga0070674_100001479 3300005356 Bacteria 12527
26 Ga0070674_100017589 3300005356 Bacteria 4502
27 Ga0070673_100159190 3300005364 Bacteria 1919
28 Ga0070667_100000535 3300005367 Bacteria 37853
29 Ga0070667_100001027 3300005367 Bacteria 25488
30 Ga0070667_100008266 3300005367 Bacteria 8624
31 Ga0070709_10061049 3300005434 Bacteria 2398
32 Ga0070714_100001783 3300005435 Bacteria 15668
33 Ga0070714_100139451 3300005435 Bacteria 2175
34 Ga0070713_100062771 3300005436 Bacteria 3112
35 Ga0070710_10000045 3300005437 Bacteria 57765
36 Ga0070710_10013147 3300005437 Bacteria 4136
37 Ga0070701_10000386 3300005438 Bacteria 14839
38 Ga0070711_100227277 3300005439 Bacteria 1453
39 Ga0070711_100273759 3300005439 Bacteria 1333
40 Ga0070705_100017328 3300005440 Bacteria 3760
41 Ga0070700_100002202 3300005441 Bacteria 9906
42 Ga0070694_100014961 3300005444 Bacteria 4861
43 Ga0070708_100352123 3300005445 Bacteria 1388
44 Ga0070663_100027896 3300005455 Bacteria 3839
45 Ga0070662_100025252 3300005457 Bacteria 4101
46 Ga0068867_100036729 3300005459 Bacteria 3558
47 Ga0070706_100018794 3300005467 Bacteria 6372
48 Ga0070706_100095369 3300005467 Bacteria 2761
49 Ga0070698_100032141 3300005471 Bacteria 5437
50 Ga0070697_100341626 3300005536 Bacteria 1292
51 Ga0068853_100001631 3300005539 Bacteria 16398
52 Ga0068853_100006430 3300005539 Bacteria 9337
53 Ga0070686_100282491 3300005544 Bacteria 1225
54 Ga0070695_100003191 3300005545 Bacteria 9567
55 Ga0070696_100066824 3300005546 Bacteria 2522
56 Ga0070665_100020021 3300005548 Bacteria 6719
57 Ga0070665_100029960 3300005548 Bacteria 5477
58 Ga0070665_100085885 3300005548 Bacteria 3152
59 Ga0070704_100003757 3300005549 Bacteria 8741
60 Ga0068854_100005222 3300005578 Bacteria 8191
61 Ga0070702_100002393 3300005615 Bacteria 8076
62 Ga0070702_100011901 3300005615 Bacteria 4340
63 Ga0068852_100098908 3300005616 Bacteria 2628
64 Ga0068859_100001716 3300005617 Bacteria 22359
65 Ga0068859_100002325 3300005617 Bacteria 19318
66 Ga0068859_100313470 3300005617 Bacteria 1662
67 Ga0068864_100275426 3300005618 Bacteria 1569
68 Ga0068866_10000253 3300005718 Bacteria 25012
69 Ga0068866_10019371 3300005718 Bacteria 3096
70 Ga0068866_10090344 3300005718 Bacteria 1666
71 Ga0068861_100077078 3300005719 Bacteria 2599
72 Ga0068863_100000143 3300005841 Bacteria 75127
73 Ga0068863_100004971 3300005841 Bacteria 13106
74 Ga0068858_100002178 3300005842 Bacteria 19860
75 Ga0068858_100004006 3300005842 Bacteria 14538
76 Ga0068858_100024382 3300005842 Bacteria 5636
77 Ga0068860_100000079 3300005843 Bacteria 170752
78 Ga0068860_100003457 3300005843 Bacteria 16245
79 Ga0068860_100249927 3300005843 Bacteria 1727
80 Ga0068862_100000093 3300005844 Bacteria 106838
81 Ga0081455_10176697 3300005937 Bacteria 1621
82 Ga0081455_10322534 3300005937 Bacteria 1100
83 Ga0070717_10061722 3300006028 Bacteria 3107
84 Ga0075365_10011313 3300006038 Bacteria 5242
85 Ga0075365_10013099 3300006038 Bacteria 4946
86 Ga0075365_10022237 3300006038 Bacteria 3971
87 Ga0075365_10027954 3300006038 Bacteria 3592
88 Ga0075365_10029657 3300006038 Bacteria 3499
89 Ga0075365_10038215 3300006038 Bacteria 3119
90 Ga0075365_10327337 3300006038 Bacteria 1079
91 Ga0075363_100001910 3300006048 Bacteria 8247
92 Ga0075363_100016373 3300006048 Bacteria 3662
93 Ga0075363_100031557 3300006048 Bacteria 2748
94 Ga0075363_100121744 3300006048 Bacteria 1457
95 Ga0075364_10002940 3300006051 Bacteria 9607
96 Ga0075364_10003555 3300006051 Bacteria 8873
97 Ga0075364_10005526 3300006051 Bacteria 7356
98 Ga0075364_10035612 3300006051 Bacteria 3217
99 Ga0075364_10105021 3300006051 Bacteria 1882
100 Ga0075364_10145323 3300006051 Bacteria 1597
101 Ga0070716_100017229 3300006173 Bacteria 3741
102 Ga0070716_100105601 3300006173 Bacteria 1736
103 Ga0070716_100166035 3300006173 Bacteria 1435
104 Ga0070712_100000630 3300006175 Bacteria 20763
105 Ga0070712_100541810 3300006175 Bacteria 980
106 Ga0075362_10005065 3300006177 Bacteria 4790
107 Ga0075362_10042218 3300006177 Bacteria 2015
108 Ga0075367_10012202 3300006178 Bacteria 4571
109 Ga0075367_10027541 3300006178 Bacteria 3234
110 Ga0075369_10000029 3300006186 Bacteria 39213
111 Ga0075369_10010587 3300006186 Bacteria 3610
112 Ga0075369_10046806 3300006186 Bacteria 1864
113 Ga0075369_10118654 3300006186 Bacteria 1196
114 Ga0097621_100021985 3300006237 Bacteria 4944
115 Ga0075370_10001915 3300006353 Bacteria 9369
116 Ga0075370_10005336 3300006353 Bacteria 6373
117 Ga0075370_10032492 3300006353 Bacteria 2918
118 Ga0075370_10056162 3300006353 Bacteria 2237
119 Ga0075370_10118426 3300006353 Bacteria 1540
120 Ga0075428_100045160 3300006844 Bacteria 4841
121 Ga0075428_100203898 3300006844 Bacteria 2137
122 Ga0075430_100060490 3300006846 Bacteria 3183
123 Ga0075431_100135176 3300006847 Bacteria 2542
124 Ga0075431_100169521 3300006847 Bacteria 2243
125 Ga0075431_100203785 3300006847 Bacteria 2023
126 Ga0075433_10018760 3300006852 Bacteria 5755
127 Ga0075434_100007719 3300006871 Bacteria 9959
128 Ga0075429_100072153 3300006880 Bacteria 3006
129 Ga0068865_100147800 3300006881 Bacteria 1779
130 Ga0075436_100012006 3300006914 Bacteria 5941
131 Ga0097620_100001716 3300006931 Bacteria 22359
132 Ga0097620_100002325 3300006931 Bacteria 19318
133 Ga0097620_100313470 3300006931 Bacteria 1662
134 Ga0075435_100110658 3300007076 Bacteria 2284
135 Ga0105240_10369152 3300009093 Bacteria 1623
136 Ga0111539_10131363 3300009094 Bacteria 2932
137 Ga0105245_10002753 3300009098 Bacteria 15803
138 Ga0105247_10001591 3300009101 Bacteria 16075
139 Ga0105247_10001633 3300009101 Bacteria 15845
140 Ga0105247_10005195 3300009101 Bacteria 8231
141 Ga0105247_10178849 3300009101 Bacteria 1414
142 Ga0114129_10237213 3300009147 Bacteria 2453
143 Ga0114129_10259178 3300009147 Bacteria 2332
144 Ga0114129_10314203 3300009147 Bacteria 2085
145 Ga0114129_10594745 3300009147 Bacteria 1434
146 Ga0105243_10000274 3300009148 Bacteria 57534
147 Ga0105243_10014300 3300009148 Bacteria 6006
148 Ga0105243_10303977 3300009148 Bacteria 1447
149 Ga0105243_10532952 3300009148 Bacteria 1119
150 Ga0105241_10209310 3300009174 Bacteria 1633
151 Ga0105242_10002125 3300009176 Bacteria 15631
152 Ga0105248_10000641 3300009177 Bacteria 39742
153 Ga0105248_10061664 3300009177 Bacteria 4211
154 Ga0105248_10073423 3300009177 Bacteria 3845
155 Ga0105237_10004429 3300009545 Bacteria 16276
156 Ga0105237_10062163 3300009545 Bacteria 3733
157 Ga0105237_10178490 3300009545 Bacteria 2124
158 Ga0105237_10286734 3300009545 Bacteria 1649
159 Ga0105238_10112010 3300009551 Bacteria 2708
160 Ga0105238_10743548 3300009551 Bacteria 994
161 Ga0105249_10000049 3300009553 Bacteria 169899
162 Ga0105249_10003002 3300009553 Bacteria 14553
163 Ga0105249_10183872 3300009553 Bacteria 2035
164 Ga0099796_10018706 3300010159 Bacteria 2086
165 Ga0105239_10007880 3300010375 Bacteria 12176
166 Ga0105239_10051513 3300010375 Bacteria 4513
167 Ga0105239_10079875 3300010375 Bacteria 3599
168 Ga0105246_10069726 3300011119 Bacteria 2470
169 Ga0105246_10180894 3300011119 Bacteria 1623
170 Ga0105246_10184791 3300011119 Bacteria 1608
171 Ga0157369_10054360 3300013105 Bacteria 4324
172 Ga0157374_10007942 3300013296 Bacteria 9063
173 Ga0157378_10002404 3300013297 Bacteria 16640
174 Ga0157378_10217696 3300013297 Bacteria 1814
175 Ga0157378_10379988 3300013297 Bacteria 1387
176 Ga0163162_10057493 3300013306 Bacteria 3918
177 Ga0157372_10000917 3300013307 Bacteria 32072
178 Ga0157375_10000573 3300013308 Bacteria 32942
179 Ga0157375_10712178 3300013308 Bacteria 1157
180 Ga0163163_10014803 3300014325 Bacteria 7181
181 Ga0163163_10079911 3300014325 Bacteria 3269
182 Ga0157380_10001337 3300014326 Bacteria 16040
183 Ga0157380_10234721 3300014326 Bacteria 1650
184 Ga0157377_10323220 3300014745 Bacteria 1026
185 Ga0157379_10035516 3300014968 Bacteria 4444
186 Ga0157376_10214156 3300014969 Bacteria 1780
187 Ga0163161_10009207 3300017792 Bacteria 6828
188 Ga0213876_10007007 3300021384 Bacteria 6147
189 Ga0213876_10010598 3300021384 Bacteria 4938
190 Ga0213876_10021820 3300021384 Bacteria 3386
191 Ga0213875_10012224 3300021388 Bacteria 4246
192 Ga0213875_10015347 3300021388 Bacteria 3728
193 Ga0213875_10038893 3300021388 Bacteria 2242
194 Ga0209758_1000815 3300025297 Bacteria 43876
195 Ga0209051_1000033 3300025303 Bacteria 380540
196 Ga0209051_1000775 3300025303 Bacteria 33951
197 Ga0209051_1007091 3300025303 Bacteria 6196
198 Ga0209051_1007985 3300025303 Bacteria 5682
199 Ga0209051_1032945 3300025303 Bacteria 1968
200 Ga0207653_10008494 3300025885 Bacteria 3200
201 Ga0207692_10005720 3300025898 Bacteria 4998
202 Ga0207692_10061619 3300025898 Bacteria 1945
203 Ga0207642_10000191 3300025899 Bacteria 17844
204 Ga0207642_10070184 3300025899 Bacteria 1664
205 Ga0207710_10000350 3300025900 Bacteria 33273
206 Ga0207710_10000908 3300025900 Bacteria 15831
207 Ga0207647_10090023 3300025904 Bacteria 1831
208 Ga0207645_10017918 3300025907 Bacteria 4671
209 Ga0207684_10026260 3300025910 Bacteria 4965
210 Ga0207684_10047727 3300025910 Bacteria 3632
211 Ga0207654_10178804 3300025911 Bacteria 1383
212 Ga0207671_10009509 3300025914 Bacteria 8120
213 Ga0207693_10000197 3300025915 Bacteria 54675
214 Ga0207693_10000771 3300025915 Bacteria 28766
215 Ga0207663_10001796 3300025916 Bacteria 10120
216 Ga0207663_10094352 3300025916 Bacteria 1994
217 Ga0207662_10070465 3300025918 Bacteria 2115
218 Ga0207646_10151154 3300025922 Bacteria 2094
219 Ga0207681_10016662 3300025923 Bacteria 4602
220 Ga0207694_10166166 3300025924 Bacteria 1785
221 Ga0207687_10031639 3300025927 Bacteria 3577
222 Ga0207700_10123926 3300025928 Bacteria 2099
223 Ga0207664_10008997 3300025929 Bacteria 6990
224 Ga0207664_10123324 3300025929 Bacteria 2172
225 Ga0207690_10086666 3300025932 Bacteria 2201
226 Ga0207706_10013062 3300025933 Bacteria 7557
227 Ga0207706_10265013 3300025933 Bacteria 1500
228 Ga0207686_10218679 3300025934 Bacteria 1374
229 Ga0207709_10001002 3300025935 Bacteria 20938
230 Ga0207709_10311802 3300025935 Bacteria 1174
231 Ga0207670_10024097 3300025936 Bacteria 3800
232 Ga0207670_10029869 3300025936 Bacteria 3476
233 Ga0207669_10004626 3300025937 Bacteria 6076
234 Ga0207704_10000448 3300025938 Bacteria 18392
235 Ga0207665_10007076 3300025939 Bacteria 7428
236 Ga0207691_10016548 3300025940 Bacteria 7003
237 Ga0207711_10002851 3300025941 Bacteria 15167
238 Ga0207711_10129967 3300025941 Bacteria 2257
239 Ga0207689_10009089 3300025942 Bacteria 8603
240 Ga0207661_10170923 3300025944 Bacteria 1892
241 Ga0207667_10183960 3300025949 Bacteria 2145
242 Ga0207651_10027395 3300025960 Bacteria 3579
243 Ga0207712_10000038 3300025961 Bacteria 192762
244 Ga0207712_10010767 3300025961 Bacteria 5814
245 Ga0207712_10247623 3300025961 Bacteria 1439
246 Ga0207668_10000838 3300025972 Bacteria 18580
247 Ga0207668_10001862 3300025972 Bacteria 12311
248 Ga0207668_10100060 3300025972 Bacteria 2152
249 Ga0207640_10059883 3300025981 Bacteria 2514
250 Ga0207658_10001213 3300025986 Bacteria 20454
251 Ga0207658_10002007 3300025986 Bacteria 15172
252 Ga0207658_10002028 3300025986 Bacteria 15117
253 Ga0207658_10006634 3300025986 Bacteria 7883
254 Ga0207658_10040484 3300025986 Bacteria 3369
255 Ga0207703_10015904 3300026035 Bacteria 5868
256 Ga0207703_10028817 3300026035 Bacteria 4381
257 Ga0207639_10013506 3300026041 Bacteria 5718
258 Ga0207639_10107907 3300026041 Bacteria 2262
259 Ga0207678_10013351 3300026067 Bacteria 7209
260 Ga0207678_10016619 3300026067 Bacteria 6465
261 Ga0207678_10078476 3300026067 Bacteria 2828
262 Ga0207708_10001480 3300026075 Bacteria 17558
263 Ga0207708_10009483 3300026075 Bacteria 7210
264 Ga0207702_10637400 3300026078 Bacteria 1047
265 Ga0207641_10000232 3300026088 Bacteria 71885
266 Ga0207641_10187414 3300026088 Bacteria 1899
267 Ga0207648_10001458 3300026089 Bacteria 26029
268 Ga0207676_10285713 3300026095 Bacteria 1500
269 Ga0207676_10365804 3300026095 Bacteria 1338
270 Ga0207683_10000996 3300026121 Bacteria 25929
271 Ga0207683_10029948 3300026121 Bacteria 4715
272 Ga0207683_10304224 3300026121 Bacteria 1459
273 Ga0268266_10006941 3300028379 Bacteria 10300
274 Ga0268266_10108023 3300028379 Bacteria 2461
275 Ga0268266_10228292 3300028379 Bacteria 1714
276 Ga0268265_10000053 3300028380 Bacteria 170215
277 Ga0268264_10000017 3300028381 Bacteria 498037
278 Ga0268264_10038818 3300028381 Bacteria 3931
279 Ga0307517_10058934 3300028786 Bacteria 3687
280 Ga0316176_1024040 3300030732 Bacteria 2462
281 Ga0316180_1017200 3300030736 Bacteria 2573
282 Ga0265327_10000004 3300031251 Bacteria 803973
283 Ga0265327_10000131 3300031251 Bacteria 164189
284 Ga0265327_10005208 3300031251 Bacteria 10976
285 Ga0265327_10009131 3300031251 Bacteria 7212
286 Ga0265316_10000176 3300031344 Bacteria 72297
287 Ga0307509_10372912 3300031507 Bacteria 1143
288 Ga0307518_10001252 3300031838 Bacteria 19089
289 Ga0307410_10184337 3300031852 Bacteria 1583
290 Ga0307406_10433186 3300031901 Bacteria 1051
291 Ga0307409_100187805 3300031995 Bacteria 1836
292 Ga0307416_100272869 3300032002 Bacteria 1662
293 Ga0307411_10050680 3300032005 Bacteria 2705
294 Ga0307415_100049110 3300032126 Bacteria 2851
295 Ga0373960_0065301 3300035121 Bacteria 1113
296 Ga0373943_0027530 3300035170 Bacteria 2672
297 Ga0373931_0121486 3300035691 Bacteria 1493
298 Ga0373931_0151868 3300035691 Bacteria 1351
299 Ga0373947_0100566 3300035725 Bacteria 1817
300 Ga0436364_0222313 3300037853 Bacteria 14411
301 Ga0436364_0437152 3300037853 Bacteria 1843
302 Ga0436364_1361024 3300037853 Bacteria 14087
303 Ga0436364_1486811 3300037853 Bacteria 3025
304 Ga0436365_0219282 3300039437 Bacteria 3131
305 Ga0436365_0271296 3300039437 Bacteria 39035
306 Ga0436365_0716503 3300039437 Bacteria 5300
307 Ga0436365_0892446 3300039437 Bacteria 1226
308 Ga0436365_1781365 3300039437 Bacteria 36167
309 Ga0436361_0588918 3300039447 Bacteria 1493
310 Ga0436363_0356295 3300039450 Bacteria 3847
311 Ga0436362_1086447 3300039453 Bacteria 1231
312 Ga0439461_0001905 3300041410 Bacteria 3288
313 Ga0439466_0008886 3300041411 Bacteria 3778
314 Ga0439466_0014516 3300041411 Bacteria 2867
315 Ga0439465_0001890 3300041413 Bacteria 6858
316 Ga0451793_0047961 3300041452 Bacteria 1311
317 Ga0451797_1249120 3300041453 Bacteria 6339
318 Ga0451795_1089617 3300041456 Bacteria 1915
319 Ga0451802_0218464 3300041460 Bacteria 1563
320 Ga0451833_1139607 3300041491 Bacteria 2681
321 Ga0451837_0618149 3300041494 Bacteria 3059
322 Ga0451839_0744362 3300041496 Bacteria 1021
323 Ga0451841_0208188 3300041498 Bacteria 5122
324 Ga0451843_0146450 3300041509 Bacteria 5063
325 Ga0439431_0000474 3300041997 Bacteria 8514
326 Ga0439445_0009947 3300042004 Bacteria 2246
327 Ga0439459_0012479 3300042438 Bacteria 1514
328 Ga0466972_0029290 3300044658 Bacteria 2711
329 Ga0466972_0036732 3300044658 Bacteria 2395
330 Ga0466972_0037866 3300044658 Bacteria 2356
331 Ga0466972_0041291 3300044658 Bacteria 2246
332 Ga0466972_0045810 3300044658 Bacteria 2119
333 Ga0466972_0065963 3300044658 Bacteria 1731
334 Ga0466965_0003197 3300044683 Bacteria 7156
335 Ga0466965_0005322 3300044683 Bacteria 5790
336 Ga0466965_0027851 3300044683 Bacteria 2743
337 Ga0466966_0009750 3300044684 Bacteria 6364
338 Ga0466966_0018116 3300044684 Bacteria 4648
339 Ga0466961_0016050 3300044693 Bacteria 4808
340 Ga0466961_0067126 3300044693 Bacteria 2278
341 Ga0466963_0087879 3300044694 Bacteria 2114
342 Ga0466963_0128468 3300044694 Bacteria 1749
343 Ga0466964_0067387 3300044706 Bacteria 1505
344 Ga0466971_0034221 3300044719 Bacteria 2277
345 Ga0466968_0000435 3300044735 Bacteria 13981
346 Ga0466968_0006528 3300044735 Bacteria 4402
347 Ga0466968_0073689 3300044735 Bacteria 1490
348 Ga0466970_0018344 3300044765 Bacteria 3620
349 Ga0466970_0034589 3300044765 Bacteria 2675
350 Ga0466957_0006105 3300044842 Bacteria 6801
351 Ga0466957_0012121 3300044842 Bacteria 4987
352 Ga0466957_0097697 3300044842 Bacteria 1847
353 Ga0466957_0119690 3300044842 Bacteria 1677
354 Ga0466960_0000170 3300044901 Bacteria 22220
355 Ga0466960_0001245 3300044901 Bacteria 9221
356 Ga0466960_0188595 3300044901 Bacteria 1121
357 Ga0466959_0042779 3300045049 Bacteria 3341
358 Ga0466959_0049302 3300045049 Bacteria 3093
359 Ga0466959_0149566 3300045049 Bacteria 1646
360 Ga0466959_0261992 3300045049 Bacteria 1190
361 Ga0466959_0286943 3300045049 Bacteria 1129
362 Ga0466958_0000545 3300045836 Bacteria 16027
363 Ga0466958_0026151 3300045836 Bacteria 3448
364 Ga0466958_0049686 3300045836 Bacteria 2538
365 Ga0466958_0107582 3300045836 Bacteria 1739
366 Ga0466967_0004219 3300045976 Bacteria 9640
367 Ga0466967_0024083 3300045976 Bacteria 4999
368 Ga0466967_0058809 3300045976 Bacteria 3399
369 Ga0466967_0124714 3300045976 Bacteria 2384
370 Ga0466967_0417035 3300045976 Bacteria 1308
371 Ga0466967_0634920 3300045976 Bacteria 1055
372 Ga0495638_0008416 3300046460 Bacteria 7317
373 Ga0495638_0030768 3300046460 Bacteria 3452
374 Ga0495580_0322565 3300046472 Bacteria 1050
375 Ga0495582_0072803 3300046473 Bacteria 1902
376 Ga0495606_0057597 3300046507 Bacteria 2502
377 Ga0495632_0057946 3300046519 Bacteria 1889
378 Ga0495643_0098744 3300046522 Bacteria 1499
379 Ga0495648_0018539 3300046524 Bacteria 4922
380 Ga0495665_0010417 3300046531 Bacteria 5030
381 Ga0495668_0011712 3300046616 Bacteria 5236
382 Ga0495634_0158752 3300046642 Bacteria 1427
383 Ga0495611_0032734 3300046648 Bacteria 2292
384 Ga0495625_0059991 3300046660 Bacteria 2697
385 Ga0495588_0014586 3300046674 Bacteria 3763
386 Ga0495647_0043574 3300046681 Bacteria 1717
387 Ga0495658_0006659 3300046683 Bacteria 5679
388 Ga0495624_0033254 3300046690 Bacteria 3340
389 Ga0495600_0102149 3300046809 Bacteria 1869
390 Ga0495581_0045567 3300047315 Bacteria 2535
391 Ga0495672_0002524 3300047320 Bacteria 16717
392 Ga0495672_0014046 3300047320 Bacteria 5500
393 Ga0495672_0096088 3300047320 Bacteria 1616
394 Ga0495676_0032697 3300047321 Bacteria 4388
395 Ga0495673_0001014 3300047469 Bacteria 24774
396 Ga0495686_0021340 3300047472 Bacteria 4303
397 Ga0495686_0115405 3300047472 Bacteria 1606
398 Ga0495593_0006211 3300047673 Bacteria 7024
399 Ga0496100_0000029 3300048903 Bacteria 110710
400 Ga0496100_0000780 3300048903 Bacteria 15181
401 Ga0496100_0001560 3300048903 Bacteria 11268
402 Ga0496100_0052366 3300048903 Bacteria 2653
403 Ga0496100_0080938 3300048903 Bacteria 2193
404 Ga0496100_0373163 3300048903 Bacteria 1082
405 Ga0496101_0000015 3300048904 Bacteria 252368
406 Ga0496101_0000031 3300048904 Bacteria 195195
407 Ga0496101_0000717 3300048904 Bacteria 19800
408 Ga0496101_0015234 3300048904 Bacteria 5176
409 Ga0496101_0093441 3300048904 Bacteria 2240
410 Ga0496102_0000065 3300048905 Bacteria 161370
411 Ga0496102_0000559 3300048905 Bacteria 39807
412 Ga0496102_0002030 3300048905 Bacteria 17497
413 Ga0496102_0028265 3300048905 Bacteria 5008
414 Ga0496102_0053608 3300048905 Bacteria 3676
415 Ga0496102_0062848 3300048905 Bacteria 3399
416 Ga0496102_0121604 3300048905 Bacteria 2439
417 Ga0496103_0000048 3300048906 Bacteria 160911
418 Ga0496103_0000556 3300048906 Bacteria 29725
419 Ga0496103_0003067 3300048906 Bacteria 10268
420 Ga0496103_0005902 3300048906 Bacteria 7318
421 Ga0496103_0090296 3300048906 Bacteria 1933
422 Ga0496103_0147519 3300048906 Bacteria 1506
423 Ga0496104_0001343 3300048907 Bacteria 21285
424 Ga0496104_0015016 3300048907 Bacteria 7006
425 Ga0496104_0074763 3300048907 Bacteria 3226
426 Ga0496105_0006560 3300048908 Bacteria 8952
427 Ga0496105_0045395 3300048908 Bacteria 3625
428 Ga0496106_0000396 3300048909 Bacteria 31087
429 Ga0496106_0001046 3300048909 Bacteria 20352
430 Ga0496106_0026006 3300048909 Bacteria 4355
431 Ga0496106_0092337 3300048909 Bacteria 2338
432 Ga0496106_0100390 3300048909 Bacteria 2244
433 Ga0496107_0000330 3300048910 Bacteria 25647
434 Ga0496107_0001096 3300048910 Bacteria 16279
435 Ga0496107_0015942 3300048910 Bacteria 5272
436 Ga0496108_0001084 3300048911 Bacteria 21234
437 Ga0496108_0003464 3300048911 Bacteria 12661
438 Ga0496108_0033538 3300048911 Bacteria 4265
439 Ga0496108_0036517 3300048911 Bacteria 4089
440 Ga0496109_0000134 3300048912 Bacteria 75662
441 Ga0496109_0004328 3300048912 Bacteria 11860
442 Ga0496109_0062738 3300048912 Bacteria 3399
443 Ga0496109_0064939 3300048912 Bacteria 3341
444 Ga0496109_0109215 3300048912 Bacteria 2571
445 Ga0496110_0096293 3300048913 Bacteria 2652
446 Ga0496110_0098094 3300048913 Bacteria 2625
447 Ga0496110_0105294 3300048913 Bacteria 2531
448 Ga0496111_0136588 3300048914 Bacteria 1816
449 Ga0496112_0018109 3300048915 Bacteria 6628
450 Ga0496112_0024386 3300048915 Bacteria 5790
451 Ga0496112_0034944 3300048915 Bacteria 4892
452 Ga0496112_0152329 3300048915 Bacteria 2279
453 Ga0496112_0202472 3300048915 Bacteria 1944
454 Ga0496113_0030325 3300048916 Bacteria 3915
455 Ga0496113_0125919 3300048916 Bacteria 2006
456 Ga0496113_0284331 3300048916 Bacteria 1323
457 Ga0496113_0285821 3300048916 Bacteria 1319
458 Ga0496114_0001231 3300048917 Bacteria 19347
459 Ga0496114_0001627 3300048917 Bacteria 17045
460 Ga0496114_0004867 3300048917 Bacteria 10462
461 Ga0496114_0082109 3300048917 Bacteria 2724
462 Ga0496114_0126522 3300048917 Bacteria 2203
463 Ga0496114_0453977 3300048917 Bacteria 1135
464 Ga0496115_0002005 3300048918 Bacteria 14559
465 Ga0496115_0003450 3300048918 Bacteria 11356
466 Ga0496115_0018149 3300048918 Bacteria 5395
467 Ga0496116_0000125 3300048919 Bacteria 160885
468 Ga0496116_0018374 3300048919 Bacteria 5392
469 Ga0496116_0019255 3300048919 Bacteria 5230
470 Ga0496117_0000111 3300048920 Bacteria 184570
471 Ga0496117_0055066 3300048920 Bacteria 2782
472 Ga0496117_0093875 3300048920 Bacteria 1922
473 Ga0496118_0000083 3300048921 Bacteria 184570
474 Ga0496118_0000272 3300048921 Bacteria 91016
475 Ga0496118_0004348 3300048921 Bacteria 16865
476 Ga0496118_0119452 3300048921 Bacteria 1723
477 Ga0496119_0003439 3300048922 Bacteria 16441
478 Ga0496119_0014096 3300048922 Bacteria 6290
479 Ga0496119_0090523 3300048922 Bacteria 1739
480 Ga0496119_0191666 3300048922 Bacteria 1064
481 Ga0496120_0013454 3300048923 Bacteria 5506
482 Ga0496120_0050017 3300048923 Bacteria 2395
483 Ga0496120_0052147 3300048923 Bacteria 2331
484 Ga0496120_0091148 3300048923 Bacteria 1628
485 Ga0496120_0175791 3300048923 Bacteria 1055
486 Ga0496121_0000004 3300048924 Bacteria 1139011
487 Ga0496121_0000728 3300048924 Bacteria 60874
488 Ga0496121_0047878 3300048924 Bacteria 3642
489 Ga0496122_0000138 3300048925 Bacteria 169434
490 Ga0496122_0054949 3300048925 Bacteria 2984
491 Ga0496123_0007235 3300048926 Bacteria 10535
492 Ga0496123_0063893 3300048926 Bacteria 2349
493 Ga0496124_0000012 3300048927 Bacteria 512581
494 Ga0496124_0105947 3300048927 Bacteria 2270
495 Ga0496125_0000003 3300048928 Bacteria 1189767
496 Ga0496125_0042302 3300048928 Bacteria 3882
497 Ga0496125_0049925 3300048928 Bacteria 3469
498 Ga0496126_0000001 3300048929 Bacteria 1139011
499 Ga0496126_0000220 3300048929 Bacteria 124547
500 Ga0496126_0005652 3300048929 Bacteria 14206
501 Ga0496126_0019389 3300048929 Bacteria 6699
502 Ga0496126_0093219 3300048929 Bacteria 2644
503 Ga0501032_0001328 3300049569 Bacteria 19718
504 Ga0501032_0004435 3300049569 Bacteria 10579
505 Ga0501034_0001406 3300049571 Bacteria 32322
506 Ga0501034_0008577 3300049571 Bacteria 10786
507 Ga0501036_0001872 3300049572 Bacteria 16318
508 Ga0501036_0041340 3300049572 Bacteria 3901
509 Ga0501037_0000401 3300049573 Bacteria 36095
510 Ga0501038_0007683 3300049574 Bacteria 9941
511 Ga0501039_0003187 3300049575 Bacteria 12267
512 Ga0501043_0000058 3300049579 Bacteria 102030
513 Ga0501043_0001795 3300049579 Bacteria 18430
514 Ga0501043_0007935 3300049579 Bacteria 8389
515 Ga0501046_0000051 3300049580 Bacteria 133545
516 Ga0501046_0000302 3300049580 Bacteria 49738
517 Ga0501047_0000003 3300049581 Bacteria 508375
518 Ga0501047_0001510 3300049581 Bacteria 22700
519 Ga0501047_0008489 3300049581 Bacteria 9689
520 Ga0501047_0223693 3300049581 Bacteria 1737
521 Ga0501047_0374947 3300049581 Bacteria 1258
522 Ga0501047_0558145 3300049581 Bacteria 969
523 Ga0501048_0001358 3300049582 Bacteria 18540
524 Ga0501048_0010014 3300049582 Bacteria 7095
525 Ga0501070_0000731 3300049586 Bacteria 30025
526 Ga0501070_0012220 3300049586 Bacteria 7244
527 Ga0501070_0051180 3300049586 Bacteria 3429
528 Ga0501080_0199315 3300049742 Bacteria 1838
529 Ga0501035_0000665 3300049822 Bacteria 37870
530 Ga0501035_0000742 3300049822 Bacteria 35160
531 Ga0501044_0000313 3300049823 Bacteria 61310
532 Ga0501044_0001249 3300049823 Bacteria 30175
533 Ga0501044_0005938 3300049823 Bacteria 13523
534 Ga0501044_0015786 3300049823 Bacteria 8130
535 nmdc:mga03683_1900_c1 3300050489 Bacteria 5668
536 nmdc:mga03n38_1249_c1 3300050490 Bacteria 7150
537 nmdc:mga03n38_149256_c1 3300050490 Bacteria 1175
538 nmdc:mga03n38_77537_c1 3300050490 Bacteria 1553
539 nmdc:mga00v17_142225_c1 3300050491 Bacteria 1539
540 nmdc:mga00v17_218881_c1 3300050491 Bacteria 1233
541 nmdc:mga00v17_22402_c1 3300050491 Bacteria 3645
542 nmdc:mga00v17_709_c1 3300050491 Bacteria 18242
543 nmdc:mga00v17_7262_c1 3300050491 Bacteria 5903
544 nmdc:mga00v17_81797_c1 3300050491 Bacteria 2018
545 nmdc:mga0yw44_210429_c1 3300050492 Bacteria 1286
546 nmdc:mga0yw44_235372_c1 3300050492 Bacteria 1216
547 nmdc:mga0yw44_57115_c1 3300050492 Bacteria 2380
548 nmdc:mga0yw44_68000_c1 3300050492 Bacteria 2202
549 nmdc:mga0yw44_68042_c1 3300050492 Bacteria 2202
550 nmdc:mga0yw44_8098_c1 3300050492 Bacteria 5218
551 nmdc:mga0yw44_84262_c1 3300050492 Bacteria 1998
552 nmdc:mga04h51_5850_c1 3300050495 Bacteria 3153
553 nmdc:mga07m45_12814_c1 3300050496 Bacteria 4436
554 nmdc:mga07m45_29227_c1 3300050496 Bacteria 2529
555 nmdc:mga07m45_38813_c1 3300050496 Bacteria 2659
556 nmdc:mga05p37_138110_c1 3300050507 Bacteria 2987
557 nmdc:mga05p37_202951_c1 3300050507 Bacteria 2400
558 nmdc:mga05p37_209453_c1 3300050507 Bacteria 2357
559 nmdc:mga05p37_327495_c1 3300050507 Bacteria 1811
560 nmdc:mga09592_32884_c1 3300050508 Bacteria 4325
561 nmdc:mga0qj67_38699_c1 3300050509 Bacteria 3742
562 nmdc:mga06r32_116982_c1 3300050510 Bacteria 2627
563 nmdc:mga06r32_318514_c1 3300050510 Bacteria 1541
564 nmdc:mga06r32_523876_c1 3300050510 Bacteria 1161
565 nmdc:mga06r32_67274_c1 3300050510 Bacteria 3459
566 nmdc:mga06r32_70938_c1 3300050510 Bacteria 3371
567 nmdc:mga08y16_192265_c1 3300050511 Bacteria 2116
568 nmdc:mga0n895_30558_c1 3300050512 Bacteria 5151
569 nmdc:mga0rr50_12854_c1 3300050513 Bacteria 5427
570 nmdc:mga08x19_16434_c1 3300050514 Bacteria 4515
571 nmdc:mga0a205_6365_c1 3300050515 Bacteria 10666
572 nmdc:mga0sz30_168625_c1 3300050516 Bacteria 971
573 nmdc:mga0sz30_338_c1 3300050516 Bacteria 17911
574 nmdc:mga0sz30_35904_c1 3300050516 Bacteria 2070
575 nmdc:mga0sz30_40125_c1 3300050516 Bacteria 1967
576 Ga0495601_0058651 3300053077 Bacteria 2440
577 Ga0500643_003262 3300053087 Bacteria 7902
578 Ga0500643_018464 3300053087 Bacteria 2313
579 Ga0500562_001188 3300053108 Bacteria 6427
580 Ga0500628_002231 3300053129 Bacteria 3231
581 Ga0500652_025550 3300053131 Bacteria 2264
582 Ga0500568_0006967 3300053139 Bacteria 5601
583 Ga0500577_0007324 3300053142 Bacteria 3087
584 Ga0500604_0006704 3300053151 Bacteria 3047
585 Ga0500622_0000198 3300053156 Bacteria 63633
586 Ga0500645_000056 3300053730 Bacteria 92126
587 Ga0500645_014341 3300053730 Bacteria 2527

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048906 Ga0496103_0005902 Ga0496103_0005902_6557_7291 240
2 3300048921 Ga0496118_0119452 Ga0496118_0119452_28_762 240
3 3300046472 Ga0495580_0322565 Ga0495580_0322565_189_1031 260
4 3300025935 Ga0207709_10311802 Ga0207709_103118022 267
5 3300025914 Ga0207671_10009509 Ga0207671_100095094 271
6 3300053730 Ga0500645_014341 Ga0500645_014341_1630_2484 274
7 3300009545 Ga0105237_10004429 Ga0105237_100044295 279
8 3300009551 Ga0105238_10743548 Ga0105238_107435481 279
9 3300010375 Ga0105239_10007880 Ga0105239_100078802 279
10 3300048922 Ga0496119_0090523 Ga0496119_0090523_74_964 279
11 3300048923 Ga0496120_0175791 Ga0496120_0175791_103_993 279
12 3300046507 Ga0495606_0057597 Ga0495606_0057597_713_1615 280
13 3300047472 Ga0495686_0115405 Ga0495686_0115405_162_1064 280
14 3300048905 Ga0496102_0000065 Ga0496102_0000065_82765_83667 280
15 3300048906 Ga0496103_0000048 Ga0496103_0000048_82306_83208 280
16 3300048919 Ga0496116_0000125 Ga0496116_0000125_77704_78606 280
17 3300048920 Ga0496117_0000111 Ga0496117_0000111_77704_78606 280
18 3300048921 Ga0496118_0000083 Ga0496118_0000083_77704_78606 280
19 3300048929 Ga0496126_0000220 Ga0496126_0000220_40238_41140 280
20 3300048907 Ga0496104_0074763 Ga0496104_0074763_1173_2072 281
21 3300048917 Ga0496114_0001627 Ga0496114_0001627_12743_13642 281
22 3300053077 Ga0495601_0058651 Ga0495601_0058651_614_1495 281
23 3300005445 Ga0070708_100352123 Ga0070708_1003521232 284
24 3300005455 Ga0070663_100027896 Ga0070663_1000278962 284
25 3300005467 Ga0070706_100018794 Ga0070706_1000187943 284
26 3300005467 Ga0070706_100095369 Ga0070706_1000953691 284
27 3300005471 Ga0070698_100032141 Ga0070698_1000321414 284
28 3300005937 Ga0081455_10176697 Ga0081455_101766972 284
29 3300006844 Ga0075428_100203898 Ga0075428_1002038982 284
30 3300006846 Ga0075430_100060490 Ga0075430_1000604903 284
31 3300006847 Ga0075431_100169521 Ga0075431_1001695212 284
32 3300006847 Ga0075431_100203785 Ga0075431_1002037852 284
33 3300006852 Ga0075433_10018760 Ga0075433_100187603 284
34 3300006871 Ga0075434_100007719 Ga0075434_10000771910 284
35 3300006880 Ga0075429_100072153 Ga0075429_1000721532 284
36 3300006914 Ga0075436_100012006 Ga0075436_1000120063 284
37 3300007076 Ga0075435_100110658 Ga0075435_1001106582 284
38 3300009094 Ga0111539_10131363 Ga0111539_101313634 284
39 3300009147 Ga0114129_10259178 Ga0114129_102591782 284
40 3300009147 Ga0114129_10314203 Ga0114129_103142032 284
41 3300009147 Ga0114129_10594745 Ga0114129_105947452 284
42 3300025297 Ga0209758_1000815 Ga0209758_100081521 284
43 3300025910 Ga0207684_10026260 Ga0207684_100262602 284
44 3300025910 Ga0207684_10047727 Ga0207684_100477272 284
45 3300028786 Ga0307517_10058934 Ga0307517_100589343 284
46 3300046460 Ga0495638_0030768 Ga0495638_0030768_1986_2891 284
47 3300046519 Ga0495632_0057946 Ga0495632_0057946_639_1544 284
48 3300046681 Ga0495647_0043574 Ga0495647_0043574_12_926 284
49 3300049579 Ga0501043_0000058 Ga0501043_0000058_36632_37540 284
50 3300049580 Ga0501046_0000051 Ga0501046_0000051_64538_65446 284
51 3300049581 Ga0501047_0000003 Ga0501047_0000003_442958_443866 284
52 3300049582 Ga0501048_0001358 Ga0501048_0001358_3362_4270 284
53 3300050507 nmdc:mga05p37_209453_c1 nmdc:mga05p37_209453_c1_237_1151 284
54 3300050507 nmdc:mga05p37_327495_c1 nmdc:mga05p37_327495_c1_819_1733 284
55 3300050508 nmdc:mga09592_32884_c1 nmdc:mga09592_32884_c1_2503_3417 284
56 3300050510 nmdc:mga06r32_116982_c1 nmdc:mga06r32_116982_c1_1153_2067 284
57 3300050510 nmdc:mga06r32_318514_c1 nmdc:mga06r32_318514_c1_292_1206 284
58 3300050510 nmdc:mga06r32_523876_c1 nmdc:mga06r32_523876_c1_162_1076 284
59 3300050511 nmdc:mga08y16_192265_c1 nmdc:mga08y16_192265_c1_403_1317 284
60 3300050512 nmdc:mga0n895_30558_c1 nmdc:mga0n895_30558_c1_896_1810 284
61 3300050513 nmdc:mga0rr50_12854_c1 nmdc:mga0rr50_12854_c1_1305_2219 284
62 3300050514 nmdc:mga08x19_16434_c1 nmdc:mga08x19_16434_c1_782_1696 284
63 3300050515 nmdc:mga0a205_6365_c1 nmdc:mga0a205_6365_c1_9061_9975 284
64 3300053129 Ga0500628_002231 Ga0500628_002231_1520_2425 284
65 3300053139 Ga0500568_0006967 Ga0500568_0006967_2524_3429 284
66 3300053142 Ga0500577_0007324 Ga0500577_0007324_608_1513 284
67 3300053151 Ga0500604_0006704 Ga0500604_0006704_851_1756 284
68 3300053156 Ga0500622_0000198 Ga0500622_0000198_58309_59214 284
69 iso_pu_bacteria 2585428057 2587725945 284
70 iso_pu_bacteria 2588253510 2588292842 284
71 iso_pu_bacteria 2643221592 2643967951 284
72 iso_pu_bacteria 2643221625 2644143149 284
73 iso_pu_bacteria 2643221648 2644271763 284
74 3300009148 Ga0105243_10532952 Ga0105243_105329522 285
75 3300010375 Ga0105239_10079875 Ga0105239_100798754 285
76 3300011119 Ga0105246_10180894 Ga0105246_101808942 285
77 3300048913 Ga0496110_0105294 Ga0496110_0105294_489_1382 285
78 3300048915 Ga0496112_0024386 Ga0496112_0024386_2717_3610 285
79 3300050490 nmdc:mga03n38_149256_c1 nmdc:mga03n38_149256_c1_76_969 285
80 3300050507 nmdc:mga05p37_138110_c1 nmdc:mga05p37_138110_c1_1414_2328 285
81 iso_pu_bacteria 2585427649 2586065409 285
82 iso_pu_bacteria 2808606522 2809593801 285
83 iso_pu_bacteria 2915768154 2915773014 285
84 3300013308 Ga0157375_10712178 Ga0157375_107121782 286
85 3300031344 Ga0265316_10000176 Ga0265316_1000017653 286
86 3300042438 Ga0439459_0012479 Ga0439459_0012479_22_912 286
87 3300053087 Ga0500643_018464 Ga0500643_018464_299_1189 286
88 iso_pu_bacteria 2795385470 2795781080 286
89 iso_pu_bacteria 2899359706 2899369135 286
90 iso_pu_bacteria 2917736166 2917744038 286
91 iso_pu_bacteria 8056207758 8056214015 286
92 3300026121 Ga0207683_10304224 Ga0207683_103042241 287
93 3300046522 Ga0495643_0098744 Ga0495643_0098744_407_1300 287
94 3300046524 Ga0495648_0018539 Ga0495648_0018539_3542_4444 287
95 3300046648 Ga0495611_0032734 Ga0495611_0032734_693_1595 287
96 3300047320 Ga0495672_0002524 Ga0495672_0002524_4678_5580 287
97 3300047469 Ga0495673_0001014 Ga0495673_0001014_17555_18457 287
98 3300048915 Ga0496112_0202472 Ga0496112_0202472_629_1525 287
99 3300053131 Ga0500652_025550 Ga0500652_025550_691_1584 288
100 iso_pu_bacteria 2795385472 2795793990 288
101 iso_pu_bacteria 2863067949 2863070038 288
102 3300031838 Ga0307518_10001252 Ga0307518_100012524 289
103 3300032002 Ga0307416_100272869 Ga0307416_1002728692 289
104 3300030732 Ga0316176_1024040 Ga0316176_10240403 290
105 3300030736 Ga0316180_1017200 Ga0316180_10172003 290
106 3300031507 Ga0307509_10372912 Ga0307509_103729122 290
107 3300041452 Ga0451793_0047961 Ga0451793_0047961_358_1239 290
108 3300041453 Ga0451797_1249120 Ga0451797_1249120_1105_1986 290
109 3300041456 Ga0451795_1089617 Ga0451795_1089617_260_1141 290
110 3300041460 Ga0451802_0218464 Ga0451802_0218464_283_1164 290
111 3300041491 Ga0451833_1139607 Ga0451833_1139607_334_1215 290
112 3300041494 Ga0451837_0618149 Ga0451837_0618149_2102_2983 290
113 3300041496 Ga0451839_0744362 Ga0451839_0744362_41_922 290
114 3300041498 Ga0451841_0208188 Ga0451841_0208188_3449_4330 290
115 3300041509 Ga0451843_0146450 Ga0451843_0146450_3560_4441 290
116 3300044683 Ga0466965_0003197 Ga0466965_0003197_2433_3308 290
117 3300044683 Ga0466965_0027851 Ga0466965_0027851_1481_2356 290
118 3300046809 Ga0495600_0102149 Ga0495600_0102149_378_1259 290
119 3300048905 Ga0496102_0053608 Ga0496102_0053608_1357_2238 290
120 3300048917 Ga0496114_0082109 Ga0496114_0082109_450_1331 290
121 iso_pu_bacteria 2738543034 2739364515 290
122 iso_pu_bacteria 2842888712 2842890005 290
123 iso_pu_bacteria 2902792274 2902797185 290
124 iso_pu_bacteria 2904765812 2904766791 290
125 iso_pu_bacteria 2904770941 2904775197 290
126 iso_pu_bacteria 2908811453 2908814485 290
127 iso_pu_bacteria 2919420072 2919420773 290
128 iso_pu_bacteria 2919432681 2919433469 290
129 iso_pu_bacteria 2928142448 2928145461 290
130 iso_pu_bacteria 2974315732 2974318781 290
131 iso_pu_bacteria 2984523437 2984527055 290
132 3300005435 Ga0070714_100001783 Ga0070714_10000178313 291
133 3300005437 Ga0070710_10000045 Ga0070710_1000004547 291
134 3300006028 Ga0070717_10061722 Ga0070717_100617223 291
135 3300025929 Ga0207664_10008997 Ga0207664_100089974 291
136 3300044658 Ga0466972_0037866 Ga0466972_0037866_1257_2174 291
137 3300045049 Ga0466959_0286943 Ga0466959_0286943_80_997 291
138 3300045976 Ga0466967_0058809 Ga0466967_0058809_1534_2433 291
139 iso_pu_bacteria 2565956761 2566996168 291
140 iso_pu_bacteria 2643221687 2644491276 291
141 iso_pu_bacteria 2643221715 2644636543 291
142 iso_pu_bacteria 2738541264 2738667362 291
143 iso_pu_bacteria 2738541274 2738706355 291
144 iso_pu_bacteria 2738541308 2738888735 291
145 iso_pu_bacteria 2738541356 2739146205 291
146 iso_pu_bacteria 2738543011 2739237873 291
147 iso_pu_bacteria 2738543028 2739328845 291
148 iso_pu_bacteria 2751185725 2753038816 291
149 iso_pu_bacteria 2751185792 2753327464 291
150 iso_pu_bacteria 2842134933 2842139491 291
151 iso_pu_bacteria 2889300758 2889303615 291
152 iso_pu_bacteria 2902810491 2902814505 291
153 iso_pu_bacteria 2902837492 2902839221 291
154 iso_pu_bacteria 2904535858 2904540804 291
155 iso_pu_bacteria 2922554459 2922554895 291
156 iso_pu_bacteria 2929212328 2929217913 291
157 iso_pu_bacteria 2939582691 2939585139 291
158 iso_pu_bacteria 2939743619 2939747400 291
159 iso_pu_bacteria 3001119090 3001119469 291
160 3300050510 nmdc:mga06r32_67274_c1 nmdc:mga06r32_67274_c1_405_1289 292
161 3300050510 nmdc:mga06r32_70938_c1 nmdc:mga06r32_70938_c1_2171_3055 292
162 iso_pu_bacteria 2902799365 2902804135 292
163 3300005329 Ga0070683_100126889 Ga0070683_1001268893 294
164 3300005435 Ga0070714_100139451 Ga0070714_1001394512 294
165 3300025929 Ga0207664_10123324 Ga0207664_101233243 294
166 3300025944 Ga0207661_10170923 Ga0207661_101709232 294
167 3300031251 Ga0265327_10000004 Ga0265327_10000004415 294
168 3300044842 Ga0466957_0097697 Ga0466957_0097697_767_1657 294
169 3300044901 Ga0466960_0001245 Ga0466960_0001245_7895_8785 294
170 3300045836 Ga0466958_0049686 Ga0466958_0049686_54_944 294
171 3300045976 Ga0466967_0004219 Ga0466967_0004219_2500_3390 294
172 3300045976 Ga0466967_0124714 Ga0466967_0124714_901_1791 294
173 3300046531 Ga0495665_0010417 Ga0495665_0010417_478_1362 294
174 3300046674 Ga0495588_0014586 Ga0495588_0014586_468_1352 294
175 3300048903 Ga0496100_0000780 Ga0496100_0000780_7956_8858 294
176 3300048904 Ga0496101_0000031 Ga0496101_0000031_36202_37104 294
177 3300048904 Ga0496101_0093441 Ga0496101_0093441_370_1254 294
178 3300048909 Ga0496106_0092337 Ga0496106_0092337_766_1668 294
179 3300048917 Ga0496114_0453977 Ga0496114_0453977_126_1010 294
180 3300048920 Ga0496117_0055066 Ga0496117_0055066_1260_2150 294
181 3300048921 Ga0496118_0000272 Ga0496118_0000272_12364_13254 294
182 3300048922 Ga0496119_0191666 Ga0496119_0191666_89_991 294
183 3300048923 Ga0496120_0052147 Ga0496120_0052147_103_1005 294
184 3300048924 Ga0496121_0000728 Ga0496121_0000728_13363_14265 294
185 3300049569 Ga0501032_0004435 Ga0501032_0004435_836_1726 294
186 3300049571 Ga0501034_0001406 Ga0501034_0001406_17688_18578 294
187 3300049572 Ga0501036_0041340 Ga0501036_0041340_2062_2952 294
188 3300049579 Ga0501043_0007935 Ga0501043_0007935_3178_4068 294
189 3300049580 Ga0501046_0000302 Ga0501046_0000302_20426_21316 294
190 3300049581 Ga0501047_0001510 Ga0501047_0001510_7938_8828 294
191 3300049581 Ga0501047_0374947 Ga0501047_0374947_58_948 294
192 3300049582 Ga0501048_0010014 Ga0501048_0010014_3744_4634 294
193 3300049586 Ga0501070_0000731 Ga0501070_0000731_17422_18312 294
194 3300049822 Ga0501035_0000665 Ga0501035_0000665_28639_29529 294
195 3300049823 Ga0501044_0001249 Ga0501044_0001249_6947_7837 294
196 3300050491 nmdc:mga00v17_218881_c1 nmdc:mga00v17_218881_c1_10_894 294
197 iso_pu_bacteria 2956939328 2956942118 294
198 3300002077 JGI24744J21845_10000674 JGI24744J21845_100006746 295
199 3300002077 JGI24744J21845_10009096 JGI24744J21845_100090962 295
200 3300002244 JGI24742J22300_10001092 JGI24742J22300_100010922 295
201 3300003792 Ga0055540_1000071 Ga0055540_100007184 295
202 3300003792 Ga0055540_1001892 Ga0055540_10018928 295
203 3300003792 Ga0055540_1004083 Ga0055540_10040834 295
204 3300003792 Ga0055540_1006412 Ga0055540_10064122 295
205 3300005330 Ga0070690_100189339 Ga0070690_1001893392 295
206 3300005334 Ga0068869_100023810 Ga0068869_1000238102 295
207 3300005337 Ga0070682_100024647 Ga0070682_1000246471 295
208 3300005338 Ga0068868_100000247 Ga0068868_10000024723 295
209 3300005338 Ga0068868_100212692 Ga0068868_1002126922 295
210 3300005340 Ga0070689_100035103 Ga0070689_1000351033 295
211 3300005340 Ga0070689_100035692 Ga0070689_1000356922 295
212 3300005343 Ga0070687_100101596 Ga0070687_1001015962 295
213 3300005345 Ga0070692_10031155 Ga0070692_100311552 295
214 3300005347 Ga0070668_100001215 Ga0070668_10000121512 295
215 3300005347 Ga0070668_100005003 Ga0070668_1000050039 295
216 3300005353 Ga0070669_100005981 Ga0070669_10000598110 295
217 3300005353 Ga0070669_100071087 Ga0070669_1000710873 295
218 3300005354 Ga0070675_100030390 Ga0070675_1000303905 295
219 3300005355 Ga0070671_100000923 Ga0070671_10000092312 295
220 3300005355 Ga0070671_100148547 Ga0070671_1001485472 295
221 3300005356 Ga0070674_100001479 Ga0070674_1000014796 295
222 3300005356 Ga0070674_100017589 Ga0070674_1000175892 295
223 3300005364 Ga0070673_100159190 Ga0070673_1001591902 295
224 3300005367 Ga0070667_100000535 Ga0070667_10000053516 295
225 3300005367 Ga0070667_100001027 Ga0070667_10000102717 295
226 3300005367 Ga0070667_100008266 Ga0070667_1000082665 295
227 3300005434 Ga0070709_10061049 Ga0070709_100610494 295
228 3300005436 Ga0070713_100062771 Ga0070713_1000627712 295
229 3300005437 Ga0070710_10013147 Ga0070710_100131474 295
230 3300005438 Ga0070701_10000386 Ga0070701_100003865 295
231 3300005439 Ga0070711_100227277 Ga0070711_1002272771 295
232 3300005439 Ga0070711_100273759 Ga0070711_1002737592 295
233 3300005440 Ga0070705_100017328 Ga0070705_1000173283 295
234 3300005441 Ga0070700_100002202 Ga0070700_1000022024 295
235 3300005444 Ga0070694_100014961 Ga0070694_1000149613 295
236 3300005457 Ga0070662_100025252 Ga0070662_1000252523 295
237 3300005459 Ga0068867_100036729 Ga0068867_1000367292 295
238 3300005536 Ga0070697_100341626 Ga0070697_1003416262 295
239 3300005539 Ga0068853_100001631 Ga0068853_10000163113 295
240 3300005539 Ga0068853_100006430 Ga0068853_1000064304 295
241 3300005544 Ga0070686_100282491 Ga0070686_1002824912 295
242 3300005545 Ga0070695_100003191 Ga0070695_1000031919 295
243 3300005546 Ga0070696_100066824 Ga0070696_1000668243 295
244 3300005548 Ga0070665_100020021 Ga0070665_1000200212 295
245 3300005548 Ga0070665_100029960 Ga0070665_1000299604 295
246 3300005548 Ga0070665_100085885 Ga0070665_1000858853 295
247 3300005549 Ga0070704_100003757 Ga0070704_1000037579 295
248 3300005578 Ga0068854_100005222 Ga0068854_1000052222 295
249 3300005615 Ga0070702_100002393 Ga0070702_1000023936 295
250 3300005615 Ga0070702_100011901 Ga0070702_1000119011 295
251 3300005616 Ga0068852_100098908 Ga0068852_1000989082 295
252 3300005617 Ga0068859_100001716 Ga0068859_1000017169 295
253 3300005617 Ga0068859_100002325 Ga0068859_1000023256 295
254 3300005617 Ga0068859_100313470 Ga0068859_1003134702 295
255 3300005618 Ga0068864_100275426 Ga0068864_1002754262 295
256 3300005718 Ga0068866_10000253 Ga0068866_100002536 295
257 3300005718 Ga0068866_10019371 Ga0068866_100193712 295
258 3300005718 Ga0068866_10090344 Ga0068866_100903442 295
259 3300005719 Ga0068861_100077078 Ga0068861_1000770783 295
260 3300005841 Ga0068863_100000143 Ga0068863_10000014367 295
261 3300005841 Ga0068863_100004971 Ga0068863_1000049712 295
262 3300005842 Ga0068858_100002178 Ga0068858_1000021783 295
263 3300005842 Ga0068858_100004006 Ga0068858_10000400616 295
264 3300005842 Ga0068858_100024382 Ga0068858_1000243822 295
265 3300005843 Ga0068860_100000079 Ga0068860_100000079133 295
266 3300005843 Ga0068860_100003457 Ga0068860_1000034577 295
267 3300005843 Ga0068860_100249927 Ga0068860_1002499272 295
268 3300005844 Ga0068862_100000093 Ga0068862_10000009317 295
269 3300005937 Ga0081455_10322534 Ga0081455_103225341 295
270 3300006038 Ga0075365_10011313 Ga0075365_100113135 295
271 3300006038 Ga0075365_10013099 Ga0075365_100130994 295
272 3300006038 Ga0075365_10022237 Ga0075365_100222375 295
273 3300006038 Ga0075365_10027954 Ga0075365_100279542 295
274 3300006038 Ga0075365_10029657 Ga0075365_100296572 295
275 3300006038 Ga0075365_10038215 Ga0075365_100382153 295
276 3300006038 Ga0075365_10327337 Ga0075365_103273371 295
277 3300006048 Ga0075363_100001910 Ga0075363_1000019106 295
278 3300006048 Ga0075363_100016373 Ga0075363_1000163732 295
279 3300006048 Ga0075363_100031557 Ga0075363_1000315573 295
280 3300006048 Ga0075363_100121744 Ga0075363_1001217442 295
281 3300006051 Ga0075364_10002940 Ga0075364_100029408 295
282 3300006051 Ga0075364_10003555 Ga0075364_100035551 295
283 3300006051 Ga0075364_10005526 Ga0075364_100055262 295
284 3300006051 Ga0075364_10035612 Ga0075364_100356122 295
285 3300006051 Ga0075364_10105021 Ga0075364_101050212 295
286 3300006051 Ga0075364_10145323 Ga0075364_101453232 295
287 3300006173 Ga0070716_100017229 Ga0070716_1000172294 295
288 3300006173 Ga0070716_100105601 Ga0070716_1001056012 295
289 3300006173 Ga0070716_100166035 Ga0070716_1001660352 295
290 3300006175 Ga0070712_100000630 Ga0070712_1000006308 295
291 3300006175 Ga0070712_100541810 Ga0070712_1005418102 295
292 3300006177 Ga0075362_10005065 Ga0075362_100050655 295
293 3300006177 Ga0075362_10042218 Ga0075362_100422181 295
294 3300006178 Ga0075367_10012202 Ga0075367_100122022 295
295 3300006178 Ga0075367_10027541 Ga0075367_100275412 295
296 3300006186 Ga0075369_10000029 Ga0075369_1000002930 295
297 3300006186 Ga0075369_10010587 Ga0075369_100105873 295
298 3300006186 Ga0075369_10046806 Ga0075369_100468062 295
299 3300006186 Ga0075369_10118654 Ga0075369_101186542 295
300 3300006237 Ga0097621_100021985 Ga0097621_1000219855 295
301 3300006353 Ga0075370_10001915 Ga0075370_100019152 295
302 3300006353 Ga0075370_10005336 Ga0075370_100053362 295
303 3300006353 Ga0075370_10032492 Ga0075370_100324922 295
304 3300006353 Ga0075370_10056162 Ga0075370_100561624 295
305 3300006353 Ga0075370_10118426 Ga0075370_101184262 295
306 3300006844 Ga0075428_100045160 Ga0075428_1000451602 295
307 3300006847 Ga0075431_100135176 Ga0075431_1001351762 295
308 3300006881 Ga0068865_100147800 Ga0068865_1001478002 295
309 3300006931 Ga0097620_100001716 Ga0097620_1000017169 295
310 3300006931 Ga0097620_100002325 Ga0097620_1000023256 295
311 3300006931 Ga0097620_100313470 Ga0097620_1003134702 295
312 3300009093 Ga0105240_10369152 Ga0105240_103691522 295
313 3300009098 Ga0105245_10002753 Ga0105245_1000275317 295
314 3300009101 Ga0105247_10001591 Ga0105247_1000159113 295
315 3300009101 Ga0105247_10001633 Ga0105247_1000163316 295
316 3300009101 Ga0105247_10005195 Ga0105247_100051955 295
317 3300009101 Ga0105247_10178849 Ga0105247_101788492 295
318 3300009147 Ga0114129_10237213 Ga0114129_102372133 295
319 3300009148 Ga0105243_10000274 Ga0105243_1000027430 295
320 3300009148 Ga0105243_10014300 Ga0105243_100143005 295
321 3300009148 Ga0105243_10303977 Ga0105243_103039772 295
322 3300009174 Ga0105241_10209310 Ga0105241_102093102 295
323 3300009176 Ga0105242_10002125 Ga0105242_1000212517 295
324 3300009177 Ga0105248_10000641 Ga0105248_1000064118 295
325 3300009177 Ga0105248_10061664 Ga0105248_100616645 295
326 3300009177 Ga0105248_10073423 Ga0105248_100734233 295
327 3300009545 Ga0105237_10062163 Ga0105237_100621632 295
328 3300009545 Ga0105237_10178490 Ga0105237_101784902 295
329 3300009545 Ga0105237_10286734 Ga0105237_102867342 295
330 3300009551 Ga0105238_10112010 Ga0105238_101120104 295
331 3300009553 Ga0105249_10000049 Ga0105249_10000049131 295
332 3300009553 Ga0105249_10003002 Ga0105249_1000300217 295
333 3300009553 Ga0105249_10183872 Ga0105249_101838722 295
334 3300010159 Ga0099796_10018706 Ga0099796_100187062 295
335 3300010375 Ga0105239_10051513 Ga0105239_100515132 295
336 3300011119 Ga0105246_10069726 Ga0105246_100697262 295
337 3300011119 Ga0105246_10184791 Ga0105246_101847912 295
338 3300013105 Ga0157369_10054360 Ga0157369_100543602 295
339 3300013296 Ga0157374_10007942 Ga0157374_100079428 295
340 3300013297 Ga0157378_10002404 Ga0157378_100024046 295
341 3300013297 Ga0157378_10217696 Ga0157378_102176962 295
342 3300013297 Ga0157378_10379988 Ga0157378_103799882 295
343 3300013306 Ga0163162_10057493 Ga0163162_100574934 295
344 3300013307 Ga0157372_10000917 Ga0157372_1000091719 295
345 3300013308 Ga0157375_10000573 Ga0157375_1000057316 295
346 3300014325 Ga0163163_10014803 Ga0163163_100148032 295
347 3300014325 Ga0163163_10079911 Ga0163163_100799112 295
348 3300014326 Ga0157380_10001337 Ga0157380_100013377 295
349 3300014326 Ga0157380_10234721 Ga0157380_102347212 295
350 3300014745 Ga0157377_10323220 Ga0157377_103232202 295
351 3300014968 Ga0157379_10035516 Ga0157379_100355163 295
352 3300014969 Ga0157376_10214156 Ga0157376_102141562 295
353 3300017792 Ga0163161_10009207 Ga0163161_100092074 295
354 3300021384 Ga0213876_10007007 Ga0213876_100070077 295
355 3300021384 Ga0213876_10010598 Ga0213876_100105985 295
356 3300021384 Ga0213876_10021820 Ga0213876_100218204 295
357 3300021388 Ga0213875_10012224 Ga0213875_100122244 295
358 3300021388 Ga0213875_10015347 Ga0213875_100153472 295
359 3300021388 Ga0213875_10038893 Ga0213875_100388931 295
360 3300025303 Ga0209051_1000033 Ga0209051_1000033317 295
361 3300025303 Ga0209051_1000775 Ga0209051_10007752 295
362 3300025303 Ga0209051_1007091 Ga0209051_10070915 295
363 3300025303 Ga0209051_1007985 Ga0209051_10079853 295
364 3300025303 Ga0209051_1032945 Ga0209051_10329452 295
365 3300025885 Ga0207653_10008494 Ga0207653_100084942 295
366 3300025898 Ga0207692_10005720 Ga0207692_100057202 295
367 3300025898 Ga0207692_10061619 Ga0207692_100616192 295
368 3300025899 Ga0207642_10000191 Ga0207642_100001919 295
369 3300025899 Ga0207642_10070184 Ga0207642_100701842 295
370 3300025900 Ga0207710_10000350 Ga0207710_1000035023 295
371 3300025900 Ga0207710_10000908 Ga0207710_1000090816 295
372 3300025904 Ga0207647_10090023 Ga0207647_100900232 295
373 3300025907 Ga0207645_10017918 Ga0207645_100179182 295
374 3300025911 Ga0207654_10178804 Ga0207654_101788042 295
375 3300025915 Ga0207693_10000197 Ga0207693_1000019742 295
376 3300025915 Ga0207693_10000771 Ga0207693_1000077124 295
377 3300025916 Ga0207663_10001796 Ga0207663_1000179611 295
378 3300025916 Ga0207663_10094352 Ga0207663_100943522 295
379 3300025918 Ga0207662_10070465 Ga0207662_100704652 295
380 3300025922 Ga0207646_10151154 Ga0207646_101511542 295
381 3300025923 Ga0207681_10016662 Ga0207681_100166623 295
382 3300025924 Ga0207694_10166166 Ga0207694_101661662 295
383 3300025927 Ga0207687_10031639 Ga0207687_100316394 295
384 3300025928 Ga0207700_10123926 Ga0207700_101239262 295
385 3300025932 Ga0207690_10086666 Ga0207690_100866662 295
386 3300025933 Ga0207706_10013062 Ga0207706_100130625 295
387 3300025933 Ga0207706_10265013 Ga0207706_102650132 295
388 3300025934 Ga0207686_10218679 Ga0207686_102186792 295
389 3300025935 Ga0207709_10001002 Ga0207709_1000100219 295
390 3300025936 Ga0207670_10024097 Ga0207670_100240973 295
391 3300025936 Ga0207670_10029869 Ga0207670_100298694 295
392 3300025937 Ga0207669_10004626 Ga0207669_100046264 295
393 3300025938 Ga0207704_10000448 Ga0207704_100004486 295
394 3300025939 Ga0207665_10007076 Ga0207665_100070768 295
395 3300025940 Ga0207691_10016548 Ga0207691_100165482 295
396 3300025941 Ga0207711_10002851 Ga0207711_1000285110 295
397 3300025941 Ga0207711_10129967 Ga0207711_101299672 295
398 3300025942 Ga0207689_10009089 Ga0207689_100090892 295
399 3300025949 Ga0207667_10183960 Ga0207667_101839602 295
400 3300025960 Ga0207651_10027395 Ga0207651_100273952 295
401 3300025961 Ga0207712_10000038 Ga0207712_10000038145 295
402 3300025961 Ga0207712_10010767 Ga0207712_100107673 295
403 3300025961 Ga0207712_10247623 Ga0207712_102476232 295
404 3300025972 Ga0207668_10000838 Ga0207668_100008387 295
405 3300025972 Ga0207668_10001862 Ga0207668_100018629 295
406 3300025972 Ga0207668_10100060 Ga0207668_101000602 295
407 3300025981 Ga0207640_10059883 Ga0207640_100598832 295
408 3300025986 Ga0207658_10001213 Ga0207658_1000121315 295
409 3300025986 Ga0207658_10002007 Ga0207658_1000200713 295
410 3300025986 Ga0207658_10002028 Ga0207658_1000202814 295
411 3300025986 Ga0207658_10006634 Ga0207658_100066348 295
412 3300025986 Ga0207658_10040484 Ga0207658_100404842 295
413 3300026035 Ga0207703_10015904 Ga0207703_100159045 295
414 3300026035 Ga0207703_10028817 Ga0207703_100288173 295
415 3300026041 Ga0207639_10013506 Ga0207639_100135064 295
416 3300026041 Ga0207639_10107907 Ga0207639_101079072 295
417 3300026067 Ga0207678_10013351 Ga0207678_100133514 295
418 3300026067 Ga0207678_10016619 Ga0207678_100166192 295
419 3300026067 Ga0207678_10078476 Ga0207678_100784763 295
420 3300026075 Ga0207708_10001480 Ga0207708_1000148017 295
421 3300026075 Ga0207708_10009483 Ga0207708_100094836 295
422 3300026078 Ga0207702_10637400 Ga0207702_106374002 295
423 3300026088 Ga0207641_10000232 Ga0207641_1000023216 295
424 3300026088 Ga0207641_10187414 Ga0207641_101874142 295
425 3300026089 Ga0207648_10001458 Ga0207648_100014586 295
426 3300026095 Ga0207676_10285713 Ga0207676_102857132 295
427 3300026095 Ga0207676_10365804 Ga0207676_103658042 295
428 3300026121 Ga0207683_10000996 Ga0207683_1000099626 295
429 3300026121 Ga0207683_10029948 Ga0207683_100299483 295
430 3300028379 Ga0268266_10006941 Ga0268266_100069417 295
431 3300028379 Ga0268266_10108023 Ga0268266_101080232 295
432 3300028379 Ga0268266_10228292 Ga0268266_102282922 295
433 3300028380 Ga0268265_10000053 Ga0268265_1000005317 295
434 3300028381 Ga0268264_10000017 Ga0268264_10000017131 295
435 3300028381 Ga0268264_10038818 Ga0268264_100388184 295
436 3300031251 Ga0265327_10000131 Ga0265327_10000131138 295
437 3300031251 Ga0265327_10005208 Ga0265327_1000520810 295
438 3300031251 Ga0265327_10009131 Ga0265327_100091315 295
439 3300031852 Ga0307410_10184337 Ga0307410_101843372 295
440 3300031901 Ga0307406_10433186 Ga0307406_104331862 295
441 3300031995 Ga0307409_100187805 Ga0307409_1001878052 295
442 3300032005 Ga0307411_10050680 Ga0307411_100506802 295
443 3300032126 Ga0307415_100049110 Ga0307415_1000491102 295
444 3300035121 Ga0373960_0065301 Ga0373960_0065301_102_995 295
445 3300035170 Ga0373943_0027530 Ga0373943_0027530_1088_1981 295
446 3300035691 Ga0373931_0121486 Ga0373931_0121486_202_1089 295
447 3300035691 Ga0373931_0151868 Ga0373931_0151868_407_1300 295
448 3300035725 Ga0373947_0100566 Ga0373947_0100566_243_1136 295
449 3300037853 Ga0436364_0222313 Ga0436364_0222313_1342_2247 295
450 3300037853 Ga0436364_0437152 Ga0436364_0437152_555_1448 295
451 3300037853 Ga0436364_1361024 Ga0436364_1361024_4227_5120 295
452 3300037853 Ga0436364_1486811 Ga0436364_1486811_1860_2891 295
453 3300039437 Ga0436365_0219282 Ga0436365_0219282_1819_2712 295
454 3300039437 Ga0436365_0271296 Ga0436365_0271296_19504_20397 295
455 3300039437 Ga0436365_0716503 Ga0436365_0716503_1694_2587 295
456 3300039437 Ga0436365_0892446 Ga0436365_0892446_47_1078 295
457 3300039437 Ga0436365_1781365 Ga0436365_1781365_12380_13285 295
458 3300039447 Ga0436361_0588918 Ga0436361_0588918_509_1405 295
459 3300039450 Ga0436363_0356295 Ga0436363_0356295_1817_2704 295
460 3300039453 Ga0436362_1086447 Ga0436362_1086447_13_906 295
461 3300041410 Ga0439461_0001905 Ga0439461_0001905_2054_2941 295
462 3300041411 Ga0439466_0008886 Ga0439466_0008886_1970_2857 295
463 3300041411 Ga0439466_0014516 Ga0439466_0014516_1715_2602 295
464 3300041413 Ga0439465_0001890 Ga0439465_0001890_5325_6212 295
465 3300041997 Ga0439431_0000474 Ga0439431_0000474_3953_4840 295
466 3300042004 Ga0439445_0009947 Ga0439445_0009947_976_1863 295
467 3300044658 Ga0466972_0029290 Ga0466972_0029290_1736_2647 295
468 3300044658 Ga0466972_0036732 Ga0466972_0036732_1304_2191 295
469 3300044658 Ga0466972_0041291 Ga0466972_0041291_871_1758 295
470 3300044658 Ga0466972_0045810 Ga0466972_0045810_97_984 295
471 3300044658 Ga0466972_0065963 Ga0466972_0065963_472_1359 295
472 3300044683 Ga0466965_0005322 Ga0466965_0005322_292_1179 295
473 3300044684 Ga0466966_0009750 Ga0466966_0009750_3627_4520 295
474 3300044684 Ga0466966_0018116 Ga0466966_0018116_2128_3015 295
475 3300044693 Ga0466961_0016050 Ga0466961_0016050_2184_3077 295
476 3300044693 Ga0466961_0067126 Ga0466961_0067126_401_1288 295
477 3300044694 Ga0466963_0087879 Ga0466963_0087879_580_1473 295
478 3300044694 Ga0466963_0128468 Ga0466963_0128468_812_1717 295
479 3300044706 Ga0466964_0067387 Ga0466964_0067387_578_1465 295
480 3300044719 Ga0466971_0034221 Ga0466971_0034221_285_1172 295
481 3300044735 Ga0466968_0000435 Ga0466968_0000435_12661_13548 295
482 3300044735 Ga0466968_0006528 Ga0466968_0006528_811_1704 295
483 3300044735 Ga0466968_0073689 Ga0466968_0073689_154_1041 295
484 3300044765 Ga0466970_0018344 Ga0466970_0018344_1835_2722 295
485 3300044765 Ga0466970_0034589 Ga0466970_0034589_1727_2614 295
486 3300044842 Ga0466957_0006105 Ga0466957_0006105_2154_3047 295
487 3300044842 Ga0466957_0012121 Ga0466957_0012121_1934_2821 295
488 3300044842 Ga0466957_0119690 Ga0466957_0119690_139_1026 295
489 3300044901 Ga0466960_0000170 Ga0466960_0000170_6006_6893 295
490 3300044901 Ga0466960_0188595 Ga0466960_0188595_18_911 295
491 3300045049 Ga0466959_0042779 Ga0466959_0042779_1670_2563 295
492 3300045049 Ga0466959_0049302 Ga0466959_0049302_1160_2047 295
493 3300045049 Ga0466959_0149566 Ga0466959_0149566_47_934 295
494 3300045049 Ga0466959_0261992 Ga0466959_0261992_198_1091 295
495 3300045836 Ga0466958_0000545 Ga0466958_0000545_12731_13624 295
496 3300045836 Ga0466958_0026151 Ga0466958_0026151_1143_2036 295
497 3300045836 Ga0466958_0107582 Ga0466958_0107582_716_1603 295
498 3300045976 Ga0466967_0024083 Ga0466967_0024083_3290_4189 295
499 3300045976 Ga0466967_0417035 Ga0466967_0417035_50_943 295
500 3300045976 Ga0466967_0634920 Ga0466967_0634920_35_922 295
501 3300046460 Ga0495638_0008416 Ga0495638_0008416_537_1430 295
502 3300046473 Ga0495582_0072803 Ga0495582_0072803_302_1195 295
503 3300046616 Ga0495668_0011712 Ga0495668_0011712_2193_3086 295
504 3300046642 Ga0495634_0158752 Ga0495634_0158752_291_1184 295
505 3300046660 Ga0495625_0059991 Ga0495625_0059991_211_1110 295
506 3300046683 Ga0495658_0006659 Ga0495658_0006659_4406_5299 295
507 3300046690 Ga0495624_0033254 Ga0495624_0033254_880_1773 295
508 3300047315 Ga0495581_0045567 Ga0495581_0045567_1333_2226 295
509 3300047320 Ga0495672_0014046 Ga0495672_0014046_2101_2994 295
510 3300047320 Ga0495672_0096088 Ga0495672_0096088_550_1437 295
511 3300047321 Ga0495676_0032697 Ga0495676_0032697_2788_3681 295
512 3300047472 Ga0495686_0021340 Ga0495686_0021340_671_1573 295
513 3300047673 Ga0495593_0006211 Ga0495593_0006211_500_1393 295
514 3300048903 Ga0496100_0000029 Ga0496100_0000029_101717_102616 295
515 3300048903 Ga0496100_0001560 Ga0496100_0001560_7184_8071 295
516 3300048903 Ga0496100_0052366 Ga0496100_0052366_114_1013 295
517 3300048903 Ga0496100_0080938 Ga0496100_0080938_455_1351 295
518 3300048903 Ga0496100_0373163 Ga0496100_0373163_33_926 295
519 3300048904 Ga0496101_0000015 Ga0496101_0000015_32082_32981 295
520 3300048904 Ga0496101_0000717 Ga0496101_0000717_15807_16706 295
521 3300048904 Ga0496101_0015234 Ga0496101_0015234_993_1880 295
522 3300048905 Ga0496102_0000559 Ga0496102_0000559_12829_13725 295
523 3300048905 Ga0496102_0002030 Ga0496102_0002030_11606_12493 295
524 3300048905 Ga0496102_0028265 Ga0496102_0028265_3229_4128 295
525 3300048905 Ga0496102_0062848 Ga0496102_0062848_1226_2125 295
526 3300048905 Ga0496102_0121604 Ga0496102_0121604_171_1064 295
527 3300048906 Ga0496103_0000556 Ga0496103_0000556_9168_10064 295
528 3300048906 Ga0496103_0003067 Ga0496103_0003067_9167_10054 295
529 3300048906 Ga0496103_0090296 Ga0496103_0090296_959_1852 295
530 3300048906 Ga0496103_0147519 Ga0496103_0147519_217_1104 295
531 3300048907 Ga0496104_0001343 Ga0496104_0001343_12503_13402 295
532 3300048907 Ga0496104_0015016 Ga0496104_0015016_4935_5822 295
533 3300048908 Ga0496105_0006560 Ga0496105_0006560_5971_6870 295
534 3300048908 Ga0496105_0045395 Ga0496105_0045395_1750_2637 295
535 3300048909 Ga0496106_0000396 Ga0496106_0000396_3646_4545 295
536 3300048909 Ga0496106_0001046 Ga0496106_0001046_8370_9269 295
537 3300048909 Ga0496106_0026006 Ga0496106_0026006_3280_4167 295
538 3300048909 Ga0496106_0100390 Ga0496106_0100390_1247_2140 295
539 3300048910 Ga0496107_0000330 Ga0496107_0000330_8622_9521 295
540 3300048910 Ga0496107_0001096 Ga0496107_0001096_13218_14117 295
541 3300048910 Ga0496107_0015942 Ga0496107_0015942_3621_4508 295
542 3300048911 Ga0496108_0001084 Ga0496108_0001084_16695_17582 295
543 3300048911 Ga0496108_0003464 Ga0496108_0003464_5978_6877 295
544 3300048911 Ga0496108_0033538 Ga0496108_0033538_860_1753 295
545 3300048911 Ga0496108_0036517 Ga0496108_0036517_1533_2426 295
546 3300048912 Ga0496109_0000134 Ga0496109_0000134_14878_15777 295
547 3300048912 Ga0496109_0004328 Ga0496109_0004328_899_1786 295
548 3300048912 Ga0496109_0062738 Ga0496109_0062738_1709_2605 295
549 3300048912 Ga0496109_0064939 Ga0496109_0064939_1212_2099 295
550 3300048912 Ga0496109_0109215 Ga0496109_0109215_1416_2303 295
551 3300048913 Ga0496110_0096293 Ga0496110_0096293_68_955 295
552 3300048913 Ga0496110_0098094 Ga0496110_0098094_1040_1939 295
553 3300048914 Ga0496111_0136588 Ga0496111_0136588_404_1303 295
554 3300048915 Ga0496112_0018109 Ga0496112_0018109_4088_4975 295
555 3300048915 Ga0496112_0034944 Ga0496112_0034944_3829_4716 295
556 3300048915 Ga0496112_0152329 Ga0496112_0152329_1115_2002 295
557 3300048916 Ga0496113_0030325 Ga0496113_0030325_768_1655 295
558 3300048916 Ga0496113_0125919 Ga0496113_0125919_674_1561 295
559 3300048916 Ga0496113_0284331 Ga0496113_0284331_35_934 295
560 3300048916 Ga0496113_0285821 Ga0496113_0285821_248_1135 295
561 3300048917 Ga0496114_0001231 Ga0496114_0001231_15878_16765 295
562 3300048917 Ga0496114_0004867 Ga0496114_0004867_6381_7280 295
563 3300048917 Ga0496114_0126522 Ga0496114_0126522_641_1540 295
564 3300048918 Ga0496115_0002005 Ga0496115_0002005_10050_10937 295
565 3300048918 Ga0496115_0003450 Ga0496115_0003450_23_922 295
566 3300048918 Ga0496115_0018149 Ga0496115_0018149_2690_3589 295
567 3300048919 Ga0496116_0018374 Ga0496116_0018374_1585_2481 295
568 3300048919 Ga0496116_0019255 Ga0496116_0019255_1250_2149 295
569 3300048920 Ga0496117_0093875 Ga0496117_0093875_204_1103 295
570 3300048921 Ga0496118_0004348 Ga0496118_0004348_13008_13904 295
571 3300048922 Ga0496119_0003439 Ga0496119_0003439_10105_11004 295
572 3300048922 Ga0496119_0014096 Ga0496119_0014096_2282_3178 295
573 3300048923 Ga0496120_0013454 Ga0496120_0013454_1128_2024 295
574 3300048923 Ga0496120_0050017 Ga0496120_0050017_514_1413 295
575 3300048923 Ga0496120_0091148 Ga0496120_0091148_519_1406 295
576 3300048924 Ga0496121_0000004 Ga0496121_0000004_567212_568111 295
577 3300048924 Ga0496121_0047878 Ga0496121_0047878_2699_3595 295
578 3300048925 Ga0496122_0000138 Ga0496122_0000138_69195_70094 295
579 3300048925 Ga0496122_0054949 Ga0496122_0054949_663_1550 295
580 3300048926 Ga0496123_0007235 Ga0496123_0007235_1534_2433 295
581 3300048926 Ga0496123_0063893 Ga0496123_0063893_708_1595 295
582 3300048927 Ga0496124_0000012 Ga0496124_0000012_292005_292904 295
583 3300048927 Ga0496124_0105947 Ga0496124_0105947_751_1647 295
584 3300048928 Ga0496125_0000003 Ga0496125_0000003_621657_622556 295
585 3300048928 Ga0496125_0042302 Ga0496125_0042302_1660_2553 295
586 3300048928 Ga0496125_0049925 Ga0496125_0049925_2258_3154 295
587 3300048929 Ga0496126_0000001 Ga0496126_0000001_567212_568111 295
588 3300048929 Ga0496126_0005652 Ga0496126_0005652_10744_11637 295
589 3300048929 Ga0496126_0019389 Ga0496126_0019389_5151_6038 295
590 3300048929 Ga0496126_0093219 Ga0496126_0093219_531_1424 295
591 3300049569 Ga0501032_0001328 Ga0501032_0001328_17760_18647 295
592 3300049571 Ga0501034_0008577 Ga0501034_0008577_123_1010 295
593 3300049572 Ga0501036_0001872 Ga0501036_0001872_11350_12237 295
594 3300049573 Ga0501037_0000401 Ga0501037_0000401_1057_1944 295
595 3300049574 Ga0501038_0007683 Ga0501038_0007683_1374_2261 295
596 3300049575 Ga0501039_0003187 Ga0501039_0003187_11276_12163 295
597 3300049579 Ga0501043_0001795 Ga0501043_0001795_6347_7234 295
598 3300049581 Ga0501047_0008489 Ga0501047_0008489_767_1663 295
599 3300049581 Ga0501047_0223693 Ga0501047_0223693_548_1441 295
600 3300049581 Ga0501047_0558145 Ga0501047_0558145_63_956 295
601 3300049586 Ga0501070_0012220 Ga0501070_0012220_460_1347 295
602 3300049586 Ga0501070_0051180 Ga0501070_0051180_180_1082 295
603 3300049742 Ga0501080_0199315 Ga0501080_0199315_831_1733 295
604 3300049822 Ga0501035_0000742 Ga0501035_0000742_12178_13071 295
605 3300049823 Ga0501044_0000313 Ga0501044_0000313_29192_30085 295
606 3300049823 Ga0501044_0005938 Ga0501044_0005938_11506_12393 295
607 3300049823 Ga0501044_0015786 Ga0501044_0015786_742_1635 295
608 3300050489 nmdc:mga03683_1900_c1 nmdc:mga03683_1900_c1_965_1852 295
609 3300050490 nmdc:mga03n38_1249_c1 nmdc:mga03n38_1249_c1_4552_5457 295
610 3300050490 nmdc:mga03n38_77537_c1 nmdc:mga03n38_77537_c1_577_1470 295
611 3300050491 nmdc:mga00v17_142225_c1 nmdc:mga00v17_142225_c1_196_1083 295
612 3300050491 nmdc:mga00v17_22402_c1 nmdc:mga00v17_22402_c1_2556_3461 295
613 3300050491 nmdc:mga00v17_709_c1 nmdc:mga00v17_709_c1_15350_16237 295
614 3300050491 nmdc:mga00v17_7262_c1 nmdc:mga00v17_7262_c1_3959_4852 295
615 3300050491 nmdc:mga00v17_81797_c1 nmdc:mga00v17_81797_c1_423_1310 295
616 3300050492 nmdc:mga0yw44_210429_c1 nmdc:mga0yw44_210429_c1_241_1134 295
617 3300050492 nmdc:mga0yw44_235372_c1 nmdc:mga0yw44_235372_c1_178_1071 295
618 3300050492 nmdc:mga0yw44_57115_c1 nmdc:mga0yw44_57115_c1_1345_2250 295
619 3300050492 nmdc:mga0yw44_68000_c1 nmdc:mga0yw44_68000_c1_86_973 295
620 3300050492 nmdc:mga0yw44_68042_c1 nmdc:mga0yw44_68042_c1_747_1634 295
621 3300050492 nmdc:mga0yw44_8098_c1 nmdc:mga0yw44_8098_c1_165_1058 295
622 3300050492 nmdc:mga0yw44_84262_c1 nmdc:mga0yw44_84262_c1_196_1083 295
623 3300050495 nmdc:mga04h51_5850_c1 nmdc:mga04h51_5850_c1_217_1104 295
624 3300050496 nmdc:mga07m45_12814_c1 nmdc:mga07m45_12814_c1_1409_2296 295
625 3300050496 nmdc:mga07m45_29227_c1 nmdc:mga07m45_29227_c1_355_1248 295
626 3300050496 nmdc:mga07m45_38813_c1 nmdc:mga07m45_38813_c1_40_927 295
627 3300050507 nmdc:mga05p37_202951_c1 nmdc:mga05p37_202951_c1_1481_2368 295
628 3300050509 nmdc:mga0qj67_38699_c1 nmdc:mga0qj67_38699_c1_172_1059 295
629 3300050516 nmdc:mga0sz30_168625_c1 nmdc:mga0sz30_168625_c1_28_915 295
630 3300050516 nmdc:mga0sz30_338_c1 nmdc:mga0sz30_338_c1_7663_8550 295
631 3300050516 nmdc:mga0sz30_35904_c1 nmdc:mga0sz30_35904_c1_378_1271 295
632 3300050516 nmdc:mga0sz30_40125_c1 nmdc:mga0sz30_40125_c1_130_1020 295
633 3300053087 Ga0500643_003262 Ga0500643_003262_5568_6461 295
634 3300053108 Ga0500562_001188 Ga0500562_001188_1796_2695 295
635 3300053730 Ga0500645_000056 Ga0500645_000056_38174_39067 295

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01259

SAICAR_synt

SAICAR synthetase

56

307

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z0r-assembly1.cif.gz_A crystal structure of saicar synthetase (purc) from mycobacterium abscessus in complex with fragment 1 0.9665 1 295
3r9r-assembly1.cif.gz_A structure of a phosphoribosylaminoimidazole-succinocarboxamide synthase from mycobacterium abscessus atcc 19977 / dsm 44196 0.9648 1 295
6yya-assembly1.cif.gz_A crystal structure of saicar synthetase (purc) from mycobacterium abscessus in complex with inhibitor 0.9643 1 295
6yyb-assembly1.cif.gz_A crystal structure of saicar synthetase (purc) from mycobacterium abscessus in complex with inhibitor 0.9632 1 295
6yya-assembly1.cif.gz_A crystal structure of saicar synthetase (purc) from mycobacterium abscessus in complex with inhibitor 0.9611 1 295
ID Description Score Start End Superfamily
af_P9WHN1_1_93_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 1.006 1 93 3.30.200.20
af_P9WHN1_1_93_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.9952 1 93 3.30.200.20
3r9rA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9877 94 237 3.30.470.20
3r9rA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9743 94 237 3.30.470.20
1obgA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9662 94 237 3.30.470.20
ID Description Score Start End GO Terms
AF-A0A3S4W3U4-F1-model_v4 deleted 0.9982 92 198
AF-T1CG79-F1-model_v4 phosphoribosylaminoimidazolesuccinocarboxamide synthase (EC 6.3.2.6) 0.9955 92 236 GO:0004639
GO:0005524
GO:0005737
GO:0006189
AF-G0HCU7-F1-model_v4 Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6) (SAICAR synthetase) 0.9936 1 295 GO:0004639
GO:0005524
GO:0005737
GO:0006189
AF-A0A6G3VQF6-F1-model_v4 deleted 0.9913 47 203
AF-G0HCU7-F1-model_v4 Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6) (SAICAR synthetase) 0.9902 1 295 GO:0004639
GO:0005524
GO:0005737
GO:0006189

Feature Viewer

pLDDT pTM Quality
94.85 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map