F471247

General Info

Members Datasets Scaffolds Average Seq Length
635 240 635 98

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100133868|Ga0075428_1001338683
Length 103
Sequence VATFILKRDNLKLGLILGLFGPFLGLVFVYLFSSNYRSLTFFEFVDFFFHDNRLITSIGALCLLANAVLFTFYINTHRDKTAKGIFATTLVYGIAILVLKIFN

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
156 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
162 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
163 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
164 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
167 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
168 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
169 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
170 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
171 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
172 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
173 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
174 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
175 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
176 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
177 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
178 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
179 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
180 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
181 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
182 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
183 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
184 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
185 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
186 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
187 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
188 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
189 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
190 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
191 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
192 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
193 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
194 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
195 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
196 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
197 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
198 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
199 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
200 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
201 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
202 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
203 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
204 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
205 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
208 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
212 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
224 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
225 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
226 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
227 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
228 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
229 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
233 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
234 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
235 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
236 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
237 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
238 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
239 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
240 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.79
Nodule 0
Rhizoplane 2.36
Rhizosphere 96.06
Stem 0
Stem Tuber 0
Unclassified 0.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_1278685 2162886011 Bacteria 2203
2 MBSR1b_contig_4982930 2162886012 Unclassified 1238
3 JGI24743J22301_10048807 3300001991 Bacteria 860
4 JGI24744J21845_10014200 3300002077 Bacteria 1601
5 JGI24742J22300_10077530 3300002244 Bacteria 625
6 rootL2_10213118 3300003322 Bacteria 4766
7 Ga0065714_10204137 3300005288 Bacteria 886
8 Ga0065712_10009117 3300005290 Bacteria 3822
9 Ga0065712_10053336 3300005290 Unclassified 691
10 Ga0065712_10092996 3300005290 Bacteria 2308
11 Ga0065712_10426193 3300005290 Bacteria 700
12 Ga0065715_10125870 3300005293 Bacteria 2121
13 Ga0065715_10595162 3300005293 Unclassified 711
14 Ga0065707_10007663 3300005295 Unclassified 2942
15 Ga0070658_10002266 3300005327 Bacteria 16152
16 Ga0070676_10000458 3300005328 Bacteria 19490
17 Ga0070676_10003200 3300005328 Bacteria 8493
18 Ga0070683_101944403 3300005329 Unclassified 565
19 Ga0070690_100044227 3300005330 Bacteria 2826
20 Ga0070690_100465837 3300005330 Unclassified 940
21 Ga0070670_100050349 3300005331 Bacteria 3579
22 Ga0070670_100080535 3300005331 Bacteria 2799
23 Ga0070670_100099508 3300005331 Bacteria 2502
24 Ga0070670_100318657 3300005331 Bacteria 1362
25 Ga0070670_100438223 3300005331 Unclassified 1157
26 Ga0070670_100786966 3300005331 Unclassified 858
27 Ga0070677_10013498 3300005333 Bacteria 2859
28 Ga0070677_10285123 3300005333 Bacteria 833
29 Ga0070677_10507306 3300005333 Bacteria 655
30 Ga0070677_10879097 3300005333 Bacteria 517
31 Ga0068869_100011037 3300005334 Bacteria 5917
32 Ga0068869_100032741 3300005334 Bacteria 3665
33 Ga0068869_100045035 3300005334 Unclassified 3175
34 Ga0068869_100172105 3300005334 Bacteria 1692
35 Ga0068869_100338759 3300005334 Bacteria 1223
36 Ga0068869_100463182 3300005334 Bacteria 1053
37 Ga0068869_100820240 3300005334 Bacteria 801
38 Ga0070666_10035829 3300005335 Bacteria 3290
39 Ga0070666_10053243 3300005335 Bacteria 2729
40 Ga0070666_10278456 3300005335 Bacteria 1189
41 Ga0070682_100195368 3300005337 Bacteria 1424
42 Ga0068868_100000493 3300005338 Bacteria 26280
43 Ga0068868_100016265 3300005338 Bacteria 5520
44 Ga0068868_100243133 3300005338 Bacteria 1513
45 Ga0068868_100506649 3300005338 Bacteria 1058
46 Ga0068868_101777251 3300005338 Unclassified 582
47 Ga0070689_100052227 3300005340 Unclassified 3161
48 Ga0070689_100935374 3300005340 Bacteria 768
49 Ga0070689_101143030 3300005340 Bacteria 697
50 Ga0070687_100048101 3300005343 Bacteria 2191
51 Ga0070687_100505186 3300005343 Bacteria 814
52 Ga0070687_100521384 3300005343 Unclassified 803
53 Ga0070661_101193586 3300005344 Bacteria 636
54 Ga0070692_10341604 3300005345 Bacteria 927
55 Ga0070668_100000154 3300005347 Bacteria 43788
56 Ga0070668_100035316 3300005347 Bacteria 3812
57 Ga0070668_100221798 3300005347 Bacteria 1560
58 Ga0070668_100404316 3300005347 Bacteria 1166
59 Ga0070668_100861682 3300005347 Unclassified 808
60 Ga0070668_101800123 3300005347 Bacteria 563
61 Ga0070669_100003025 3300005353 Bacteria 12090
62 Ga0070669_100006016 3300005353 Bacteria 8750
63 Ga0070669_100214312 3300005353 Bacteria 1520
64 Ga0070669_100769731 3300005353 Bacteria 816
65 Ga0070669_101597342 3300005353 Bacteria 568
66 Ga0070675_100005755 3300005354 Bacteria 9482
67 Ga0070675_100080415 3300005354 Bacteria 2716
68 Ga0070675_101603116 3300005354 Bacteria 600
69 Ga0070671_100017163 3300005355 Bacteria 5859
70 Ga0070671_100843408 3300005355 Bacteria 799
71 Ga0070674_100122880 3300005356 Bacteria 1924
72 Ga0070674_100413658 3300005356 Bacteria 1105
73 Ga0070674_101063817 3300005356 Bacteria 713
74 Ga0070674_101229134 3300005356 Unclassified 666
75 Ga0070673_100001017 3300005364 Bacteria 15874
76 Ga0070673_100020510 3300005364 Bacteria 4768
77 Ga0070673_100030274 3300005364 Bacteria 4047
78 Ga0070673_100046319 3300005364 Bacteria 3377
79 Ga0070673_101516161 3300005364 Bacteria 632
80 Ga0070688_100023656 3300005365 Unclassified 3616
81 Ga0070688_100053524 3300005365 Bacteria 2525
82 Ga0070688_100354789 3300005365 Bacteria 1074
83 Ga0070688_100619284 3300005365 Bacteria 830
84 Ga0070667_100001203 3300005367 Bacteria 23556
85 Ga0070667_100128225 3300005367 Bacteria 2212
86 Ga0070667_100227853 3300005367 Bacteria 1661
87 Ga0070667_100242765 3300005367 Bacteria 1609
88 Ga0070667_100303957 3300005367 Bacteria 1437
89 Ga0070667_100771627 3300005367 Bacteria 892
90 Ga0070667_101434151 3300005367 Bacteria 648
91 Ga0070705_100899648 3300005440 Bacteria 712
92 Ga0070700_100068909 3300005441 Bacteria 2251
93 Ga0070700_100185339 3300005441 Bacteria 1451
94 Ga0070700_100211890 3300005441 Bacteria 1367
95 Ga0070700_100885706 3300005441 Bacteria 726
96 Ga0070663_100149260 3300005455 Unclassified 1791
97 Ga0070663_100366089 3300005455 Bacteria 1170
98 Ga0070678_100027407 3300005456 Unclassified 3868
99 Ga0070678_100145245 3300005456 Bacteria 1903
100 Ga0070678_101633003 3300005456 Bacteria 606
101 Ga0070662_100004216 3300005457 Bacteria 9057
102 Ga0070662_100010256 3300005457 Bacteria 6142
103 Ga0070662_100168155 3300005457 Bacteria 1720
104 Ga0068867_100001830 3300005459 Bacteria 14826
105 Ga0068867_100105504 3300005459 Bacteria 2158
106 Ga0068867_100111234 3300005459 Bacteria 2104
107 Ga0068867_100587030 3300005459 Bacteria 970
108 Ga0070685_10081682 3300005466 Bacteria 1938
109 Ga0070685_11325362 3300005466 Unclassified 550
110 Ga0070698_100002094 3300005471 Bacteria 22141
111 Ga0070698_100006624 3300005471 Bacteria 12560
112 Ga0068853_100014617 3300005539 Bacteria 6438
113 Ga0068853_100049869 3300005539 Unclassified 3599
114 Ga0068853_100052295 3300005539 Bacteria 3519
115 Ga0068853_102071117 3300005539 Bacteria 552
116 Ga0070672_100000048 3300005543 Bacteria 52547
117 Ga0070672_100008700 3300005543 Bacteria 6963
118 Ga0070672_100330345 3300005543 Bacteria 1297
119 Ga0070672_101690240 3300005543 Bacteria 568
120 Ga0070686_100361545 3300005544 Unclassified 1093
121 Ga0070693_101082102 3300005547 Bacteria 610
122 Ga0070665_100003379 3300005548 Bacteria 17072
123 Ga0070665_100071165 3300005548 Bacteria 3484
124 Ga0070665_101258312 3300005548 Unclassified 750
125 Ga0068855_100095276 3300005563 Unclassified 3431
126 Ga0070664_101185467 3300005564 Bacteria 720
127 Ga0068857_100132871 3300005577 Bacteria 2245
128 Ga0068857_100382856 3300005577 Bacteria 1307
129 Ga0068857_100586298 3300005577 Bacteria 1053
130 Ga0068854_100717046 3300005578 Bacteria 865
131 Ga0068856_101424176 3300005614 Unclassified 707
132 Ga0068852_100105336 3300005616 Unclassified 2555
133 Ga0068852_100781872 3300005616 Bacteria 968
134 Ga0068852_101406589 3300005616 Unclassified 720
135 Ga0068859_100007565 3300005617 Bacteria 11034
136 Ga0068859_100027468 3300005617 Bacteria 5707
137 Ga0068859_100205833 3300005617 Unclassified 2053
138 Ga0068859_100432566 3300005617 Bacteria 1412
139 Ga0068859_100514640 3300005617 Unclassified 1292
140 Ga0068859_100802538 3300005617 Bacteria 1029
141 Ga0068859_100962911 3300005617 Bacteria 936
142 Ga0068859_101032159 3300005617 Bacteria 903
143 Ga0068864_100026182 3300005618 Unclassified 4917
144 Ga0068864_100079101 3300005618 Unclassified 2878
145 Ga0068864_100328351 3300005618 Bacteria 1438
146 Ga0068864_101115940 3300005618 Bacteria 785
147 Ga0068864_101872215 3300005618 Bacteria 605
148 Ga0068866_10061456 3300005718 Bacteria 1951
149 Ga0068866_10172262 3300005718 Bacteria 1271
150 Ga0068866_10491455 3300005718 Bacteria 810
151 Ga0068861_100008514 3300005719 Bacteria 7062
152 Ga0068861_100013356 3300005719 Bacteria 5747
153 Ga0068861_100031759 3300005719 Bacteria 3882
154 Ga0068861_100055850 3300005719 Bacteria 3012
155 Ga0068861_100139662 3300005719 Unclassified 1976
156 Ga0068861_100584343 3300005719 Bacteria 1023
157 Ga0068861_101402953 3300005719 Unclassified 682
158 Ga0068861_101709345 3300005719 Bacteria 622
159 Ga0068861_102049644 3300005719 Bacteria 571
160 Ga0068851_10004047 3300005834 Bacteria 6581
161 Ga0068870_10002573 3300005840 Bacteria 7587
162 Ga0068870_10002679 3300005840 Bacteria 7457
163 Ga0068870_10214484 3300005840 Unclassified 1174
164 Ga0068870_11143518 3300005840 Bacteria 561
165 Ga0068863_100005521 3300005841 Bacteria 12439
166 Ga0068863_100033403 3300005841 Bacteria 4901
167 Ga0068863_100095798 3300005841 Bacteria 2817
168 Ga0068863_100269041 3300005841 Bacteria 1649
169 Ga0068863_100325905 3300005841 Bacteria 1493
170 Ga0068863_100848295 3300005841 Unclassified 912
171 Ga0068858_100001355 3300005842 Bacteria 25204
172 Ga0068858_100913907 3300005842 Bacteria 858
173 Ga0068858_101563734 3300005842 Bacteria 651
174 Ga0068860_100005349 3300005843 Bacteria 13024
175 Ga0068860_100011687 3300005843 Bacteria 8655
176 Ga0068860_100092303 3300005843 Bacteria 2885
177 Ga0068860_100325752 3300005843 Bacteria 1508
178 Ga0068860_100460023 3300005843 Bacteria 1266
179 Ga0068860_100808090 3300005843 Bacteria 951
180 Ga0068862_100050077 3300005844 Bacteria 3569
181 Ga0068862_100166306 3300005844 Bacteria 1972
182 Ga0068862_100294371 3300005844 Bacteria 1492
183 Ga0068862_100906719 3300005844 Bacteria 867
184 Ga0068862_101490526 3300005844 Unclassified 682
185 Ga0068862_102740873 3300005844 Unclassified 504
186 Ga0070715_10158131 3300006163 Bacteria 1117
187 Ga0070715_10243824 3300006163 Unclassified 936
188 Ga0070716_100050453 3300006173 Bacteria 2362
189 Ga0075427_10053032 3300006194 Bacteria 701
190 Ga0075366_10011207 3300006195 Bacteria 5056
191 Ga0097621_100002545 3300006237 Bacteria 12488
192 Ga0097621_100022140 3300006237 Bacteria 4929
193 Ga0097621_100076545 3300006237 Unclassified 2776
194 Ga0097621_100453399 3300006237 Bacteria 1156
195 Ga0097621_101951294 3300006237 Bacteria 560
196 Ga0075370_10487625 3300006353 Unclassified 743
197 Ga0068871_100003156 3300006358 Bacteria 11319
198 Ga0068871_100048716 3300006358 Bacteria 3422
199 Ga0068871_100104372 3300006358 Bacteria 2377
200 Ga0068871_100186135 3300006358 Bacteria 1787
201 Ga0068871_100360679 3300006358 Unclassified 1287
202 Ga0068871_100452626 3300006358 Bacteria 1151
203 Ga0068871_100634297 3300006358 Bacteria 974
204 Ga0075428_100133868 3300006844 Bacteria 2695
205 Ga0075428_100186483 3300006844 Bacteria 2244
206 Ga0075428_100235074 3300006844 Unclassified 1977
207 Ga0075428_102047621 3300006844 Bacteria 593
208 Ga0075430_100003135 3300006846 Bacteria 13825
209 Ga0075430_100044213 3300006846 Bacteria 3767
210 Ga0075431_100202278 3300006847 Bacteria 2032
211 Ga0075431_100345451 3300006847 Bacteria 1497
212 Ga0075431_101490277 3300006847 Bacteria 635
213 Ga0075433_10517232 3300006852 Bacteria 1050
214 Ga0075429_100167295 3300006880 Unclassified 1926
215 Ga0075429_100274449 3300006880 Unclassified 1476
216 Ga0075429_101445106 3300006880 Unclassified 599
217 Ga0068865_100001341 3300006881 Bacteria 14328
218 Ga0068865_100053256 3300006881 Bacteria 2807
219 Ga0068865_100536648 3300006881 Bacteria 980
220 Ga0068865_100811983 3300006881 Bacteria 808
221 Ga0097620_100007565 3300006931 Bacteria 11034
222 Ga0097620_100027468 3300006931 Bacteria 5707
223 Ga0097620_100205847 3300006931 Unclassified 2053
224 Ga0097620_100432560 3300006931 Bacteria 1412
225 Ga0097620_100514666 3300006931 Unclassified 1292
226 Ga0097620_100802620 3300006931 Bacteria 1029
227 Ga0097620_100962838 3300006931 Bacteria 936
228 Ga0097620_101032091 3300006931 Bacteria 903
229 Ga0105240_10066684 3300009093 Unclassified 4464
230 Ga0111539_10023974 3300009094 Bacteria 7495
231 Ga0111539_10399820 3300009094 Bacteria 1600
232 Ga0111539_10519150 3300009094 Bacteria 1388
233 Ga0105245_10070211 3300009098 Unclassified 3178
234 Ga0105245_10447724 3300009098 Bacteria 1299
235 Ga0105245_11160076 3300009098 Bacteria 820
236 Ga0105247_10948164 3300009101 Bacteria 668
237 Ga0114129_10364637 3300009147 Bacteria 1911
238 Ga0114129_11261763 3300009147 Unclassified 917
239 Ga0114129_13086625 3300009147 Bacteria 545
240 Ga0105243_10223480 3300009148 Unclassified 1666
241 Ga0105241_10150429 3300009174 Bacteria 1904
242 Ga0105241_10436437 3300009174 Bacteria 1156
243 Ga0105241_10967330 3300009174 Bacteria 794
244 Ga0105241_12696762 3300009174 Bacteria 500
245 Ga0105242_10025455 3300009176 Bacteria 4684
246 Ga0105242_10068251 3300009176 Bacteria 2941
247 Ga0105242_10553337 3300009176 Bacteria 1103
248 Ga0105242_10635598 3300009176 Bacteria 1036
249 Ga0105242_10945275 3300009176 Bacteria 865
250 Ga0105242_12953651 3300009176 Unclassified 526
251 Ga0105242_13206256 3300009176 Bacteria 508
252 Ga0105248_10128000 3300009177 Bacteria 2865
253 Ga0105248_12780078 3300009177 Bacteria 558
254 Ga0105237_10330937 3300009545 Unclassified 1527
255 Ga0105237_11535979 3300009545 Bacteria 673
256 Ga0105249_10003125 3300009553 Bacteria 14313
257 Ga0105249_10003218 3300009553 Bacteria 14139
258 Ga0105249_10004834 3300009553 Bacteria 11632
259 Ga0105249_10056524 3300009553 Bacteria 3593
260 Ga0105249_10179071 3300009553 Bacteria 2061
261 Ga0105249_10243512 3300009553 Unclassified 1779
262 Ga0105249_10316937 3300009553 Unclassified 1570
263 Ga0105249_10446226 3300009553 Bacteria 1332
264 Ga0105249_10891508 3300009553 Bacteria 956
265 Ga0105249_11684389 3300009553 Bacteria 707
266 Ga0105249_11734010 3300009553 Bacteria 697
267 Ga0105249_12244194 3300009553 Bacteria 619
268 Ga0105239_10288495 3300010375 Bacteria 1848
269 Ga0105239_10637411 3300010375 Unclassified 1217
270 Ga0105246_10009910 3300011119 Bacteria 5877
271 Ga0105246_10203726 3300011119 Bacteria 1540
272 Ga0105246_10467507 3300011119 Unclassified 1064
273 Ga0105246_10845059 3300011119 Bacteria 816
274 Ga0157370_10017114 3300013104 Bacteria 7320
275 Ga0157370_10017652 3300013104 Bacteria 7193
276 Ga0157370_11300313 3300013104 Unclassified 655
277 Ga0157369_11660651 3300013105 Unclassified 649
278 Ga0157369_12222305 3300013105 Bacteria 556
279 Ga0157374_10000314 3300013296 Bacteria 44972
280 Ga0157374_10100813 3300013296 Bacteria 2768
281 Ga0157374_10479636 3300013296 Bacteria 1247
282 Ga0157374_10514754 3300013296 Bacteria 1202
283 Ga0157378_10001556 3300013297 Bacteria 20709
284 Ga0157378_10492247 3300013297 Unclassified 1223
285 Ga0157378_11079495 3300013297 Bacteria 839
286 Ga0157378_11287322 3300013297 Bacteria 772
287 Ga0163162_10000224 3300013306 Bacteria 51849
288 Ga0163162_10000231 3300013306 Bacteria 51138
289 Ga0163162_10000318 3300013306 Bacteria 44343
290 Ga0163162_10002781 3300013306 Bacteria 16627
291 Ga0163162_10009899 3300013306 Bacteria 9271
292 Ga0163162_10055575 3300013306 Bacteria 3986
293 Ga0163162_10062519 3300013306 Bacteria 3763
294 Ga0163162_10109079 3300013306 Bacteria 2865
295 Ga0163162_10250702 3300013306 Bacteria 1902
296 Ga0163162_10251650 3300013306 Bacteria 1899
297 Ga0163162_10326309 3300013306 Bacteria 1667
298 Ga0163162_10783451 3300013306 Bacteria 1072
299 Ga0157372_10136366 3300013307 Unclassified 2826
300 Ga0157372_11483281 3300013307 Unclassified 781
301 Ga0157375_10000073 3300013308 Bacteria 105972
302 Ga0157375_10000272 3300013308 Bacteria 46932
303 Ga0157375_10021346 3300013308 Bacteria 5935
304 Ga0157375_10098056 3300013308 Bacteria 3007
305 Ga0157375_10606785 3300013308 Bacteria 1253
306 Ga0157375_10706277 3300013308 Bacteria 1162
307 Ga0157375_11537787 3300013308 Bacteria 786
308 Ga0157375_11601731 3300013308 Unclassified 770
309 Ga0157375_11923004 3300013308 Unclassified 702
310 Ga0157375_12490430 3300013308 Bacteria 618
311 Ga0157375_13048253 3300013308 Unclassified 559
312 Ga0163163_10000129 3300014325 Bacteria 77897
313 Ga0163163_10000347 3300014325 Bacteria 44548
314 Ga0163163_10435822 3300014325 Bacteria 1370
315 Ga0163163_10728490 3300014325 Bacteria 1055
316 Ga0163163_10736684 3300014325 Bacteria 1049
317 Ga0163163_10880387 3300014325 Bacteria 959
318 Ga0163163_12289764 3300014325 Unclassified 599
319 Ga0157380_10013692 3300014326 Bacteria 5921
320 Ga0157380_10590765 3300014326 Bacteria 1097
321 Ga0157380_11722044 3300014326 Unclassified 685
322 Ga0157377_10002157 3300014745 Bacteria 8642
323 Ga0157377_10061358 3300014745 Bacteria 2148
324 Ga0157377_10135847 3300014745 Bacteria 1507
325 Ga0157377_11002983 3300014745 Bacteria 632
326 Ga0157377_11230127 3300014745 Unclassified 581
327 Ga0157379_10000120 3300014968 Bacteria 54605
328 Ga0157379_10380397 3300014968 Bacteria 1295
329 Ga0157379_10632225 3300014968 Bacteria 1001
330 Ga0157379_10828694 3300014968 Unclassified 874
331 Ga0157379_10897515 3300014968 Bacteria 841
332 Ga0157379_11372497 3300014968 Unclassified 684
333 Ga0157379_12043932 3300014968 Bacteria 567
334 Ga0157376_10000271 3300014969 Bacteria 35219
335 Ga0157376_10000774 3300014969 Bacteria 20877
336 Ga0157376_10032084 3300014969 Bacteria 4214
337 Ga0157376_10193197 3300014969 Bacteria 1868
338 Ga0157376_10197202 3300014969 Bacteria 1850
339 Ga0157376_10246399 3300014969 Bacteria 1667
340 Ga0157376_10271107 3300014969 Bacteria 1594
341 Ga0163161_10011166 3300017792 Bacteria 6223
342 Ga0163161_10021878 3300017792 Bacteria 4497
343 Ga0163161_10058069 3300017792 Unclassified 2812
344 Ga0163161_10083144 3300017792 Bacteria 2359
345 Ga0163161_10385984 3300017792 Bacteria 1120
346 Ga0163161_11686295 3300017792 Bacteria 561
347 Ga0163161_11926432 3300017792 Bacteria 526
348 Ga0207697_10009721 3300025315 Bacteria 4143
349 Ga0207656_10002217 3300025321 Bacteria 6506
350 Ga0207656_10074325 3300025321 Bacteria 1516
351 Ga0207682_10087645 3300025893 Bacteria 1345
352 Ga0207682_10461528 3300025893 Unclassified 601
353 Ga0207642_10442005 3300025899 Bacteria 786
354 Ga0207642_10826158 3300025899 Bacteria 590
355 Ga0207688_10135229 3300025901 Bacteria 1447
356 Ga0207680_10000165 3300025903 Bacteria 32266
357 Ga0207680_10042466 3300025903 Bacteria 2660
358 Ga0207680_10133108 3300025903 Bacteria 1640
359 Ga0207647_10051653 3300025904 Unclassified 2540
360 Ga0207647_10357526 3300025904 Bacteria 826
361 Ga0207685_10265341 3300025905 Unclassified 836
362 Ga0207645_10000263 3300025907 Bacteria 43560
363 Ga0207645_10001368 3300025907 Bacteria 20023
364 Ga0207645_10052338 3300025907 Bacteria 2608
365 Ga0207643_10002440 3300025908 Bacteria 10046
366 Ga0207643_10004417 3300025908 Bacteria 7561
367 Ga0207643_10195392 3300025908 Unclassified 1230
368 Ga0207705_10008997 3300025909 Bacteria 7276
369 Ga0207654_10596115 3300025911 Bacteria 788
370 Ga0207662_10094232 3300025918 Bacteria 1846
371 Ga0207662_10401390 3300025918 Bacteria 930
372 Ga0207662_10562837 3300025918 Bacteria 790
373 Ga0207649_11069718 3300025920 Bacteria 636
374 Ga0207681_10042542 3300025923 Bacteria 3035
375 Ga0207681_10047551 3300025923 Bacteria 2891
376 Ga0207681_10374259 3300025923 Bacteria 1145
377 Ga0207681_10460829 3300025923 Bacteria 1035
378 Ga0207650_10113773 3300025925 Bacteria 2098
379 Ga0207650_10135789 3300025925 Bacteria 1929
380 Ga0207650_10219152 3300025925 Bacteria 1531
381 Ga0207650_10283504 3300025925 Bacteria 1349
382 Ga0207650_11047692 3300025925 Bacteria 694
383 Ga0207659_10044504 3300025926 Bacteria 3123
384 Ga0207659_10143270 3300025926 Bacteria 1857
385 Ga0207659_10554345 3300025926 Bacteria 977
386 Ga0207644_10009824 3300025931 Bacteria 6294
387 Ga0207644_10780109 3300025931 Bacteria 799
388 Ga0207706_10021277 3300025933 Bacteria 5827
389 Ga0207706_10052672 3300025933 Unclassified 3593
390 Ga0207706_10194915 3300025933 Bacteria 1777
391 Ga0207686_10007206 3300025934 Bacteria 5991
392 Ga0207686_10053723 3300025934 Bacteria 2520
393 Ga0207686_10408285 3300025934 Bacteria 1036
394 Ga0207686_11687276 3300025934 Unclassified 524
395 Ga0207686_11852283 3300025934 Bacteria 500
396 Ga0207709_10173575 3300025935 Unclassified 1515
397 Ga0207670_10064208 3300025936 Bacteria 2516
398 Ga0207670_10427255 3300025936 Unclassified 1064
399 Ga0207670_10496736 3300025936 Bacteria 990
400 Ga0207669_10027963 3300025937 Bacteria 3096
401 Ga0207669_10152289 3300025937 Bacteria 1621
402 Ga0207704_10000986 3300025938 Bacteria 12639
403 Ga0207704_10057274 3300025938 Bacteria 2393
404 Ga0207704_10508301 3300025938 Unclassified 972
405 Ga0207704_10777157 3300025938 Bacteria 798
406 Ga0207665_10300867 3300025939 Unclassified 1199
407 Ga0207691_10000245 3300025940 Bacteria 53608
408 Ga0207691_10003243 3300025940 Bacteria 15850
409 Ga0207691_10766138 3300025940 Unclassified 812
410 Ga0207691_10973129 3300025940 Bacteria 709
411 Ga0207691_11443784 3300025940 Bacteria 564
412 Ga0207711_10144727 3300025941 Unclassified 2141
413 Ga0207689_10007704 3300025942 Bacteria 9423
414 Ga0207689_10018354 3300025942 Bacteria 5903
415 Ga0207689_10034355 3300025942 Unclassified 4212
416 Ga0207689_10110922 3300025942 Bacteria 2254
417 Ga0207689_10350872 3300025942 Bacteria 1226
418 Ga0207689_10491444 3300025942 Bacteria 1028
419 Ga0207679_11781498 3300025945 Bacteria 563
420 Ga0207667_10088148 3300025949 Unclassified 3210
421 Ga0207651_10009691 3300025960 Bacteria 5293
422 Ga0207651_10133394 3300025960 Bacteria 1905
423 Ga0207651_10230096 3300025960 Bacteria 1504
424 Ga0207651_10392678 3300025960 Bacteria 1178
425 Ga0207651_10582341 3300025960 Bacteria 976
426 Ga0207651_10870530 3300025960 Unclassified 801
427 Ga0207651_10896550 3300025960 Bacteria 790
428 Ga0207651_11045601 3300025960 Bacteria 731
429 Ga0207712_10001366 3300025961 Bacteria 16706
430 Ga0207712_10023399 3300025961 Bacteria 4076
431 Ga0207712_10053484 3300025961 Bacteria 2833
432 Ga0207712_10053502 3300025961 Unclassified 2832
433 Ga0207712_10358221 3300025961 Bacteria 1215
434 Ga0207712_10768054 3300025961 Bacteria 845
435 Ga0207712_11211046 3300025961 Unclassified 674
436 Ga0207668_10000184 3300025972 Bacteria 42493
437 Ga0207668_10031257 3300025972 Bacteria 3505
438 Ga0207668_10175479 3300025972 Bacteria 1685
439 Ga0207668_10207582 3300025972 Bacteria 1564
440 Ga0207668_11452968 3300025972 Bacteria 618
441 Ga0207640_11027713 3300025981 Unclassified 726
442 Ga0207658_10000452 3300025986 Bacteria 38428
443 Ga0207658_10051664 3300025986 Bacteria 3030
444 Ga0207658_10080711 3300025986 Bacteria 2492
445 Ga0207658_10277636 3300025986 Bacteria 1435
446 Ga0207658_10676452 3300025986 Bacteria 931
447 Ga0207677_10007781 3300026023 Bacteria 5949
448 Ga0207677_10044534 3300026023 Bacteria 2957
449 Ga0207677_11032246 3300026023 Unclassified 747
450 Ga0207677_11146253 3300026023 Bacteria 710
451 Ga0207703_10000388 3300026035 Bacteria 47169
452 Ga0207703_10184958 3300026035 Unclassified 1841
453 Ga0207703_11301785 3300026035 Bacteria 699
454 Ga0207703_11842410 3300026035 Bacteria 581
455 Ga0207639_10010418 3300026041 Bacteria 6438
456 Ga0207639_10037498 3300026041 Unclassified 3600
457 Ga0207639_10128442 3300026041 Bacteria 2094
458 Ga0207639_12053487 3300026041 Unclassified 533
459 Ga0207678_10133009 3300026067 Unclassified 2122
460 Ga0207678_10255098 3300026067 Bacteria 1503
461 Ga0207708_10058594 3300026075 Bacteria 2938
462 Ga0207708_10219354 3300026075 Bacteria 1523
463 Ga0207708_10750224 3300026075 Bacteria 838
464 Ga0207708_11005798 3300026075 Bacteria 724
465 Ga0207641_10001405 3300026088 Bacteria 23727
466 Ga0207641_10002172 3300026088 Bacteria 18470
467 Ga0207641_10082161 3300026088 Bacteria 2799
468 Ga0207641_10299891 3300026088 Bacteria 1517
469 Ga0207641_11326362 3300026088 Bacteria 720
470 Ga0207641_12037396 3300026088 Bacteria 575
471 Ga0207648_10002644 3300026089 Bacteria 19132
472 Ga0207648_10004150 3300026089 Bacteria 14988
473 Ga0207648_10076562 3300026089 Unclassified 2916
474 Ga0207648_10139450 3300026089 Bacteria 2137
475 Ga0207648_10244327 3300026089 Bacteria 1599
476 Ga0207676_10011439 3300026095 Bacteria 6342
477 Ga0207676_10604333 3300026095 Unclassified 1054
478 Ga0207676_10690287 3300026095 Bacteria 988
479 Ga0207676_11003068 3300026095 Bacteria 823
480 Ga0207674_10001856 3300026116 Bacteria 26902
481 Ga0207674_10053595 3300026116 Bacteria 4110
482 Ga0207674_10386839 3300026116 Bacteria 1352
483 Ga0207674_10624581 3300026116 Bacteria 1040
484 Ga0207674_10902001 3300026116 Bacteria 852
485 Ga0207675_100003498 3300026118 Bacteria 15327
486 Ga0207675_100006997 3300026118 Bacteria 10670
487 Ga0207675_100010293 3300026118 Bacteria 8762
488 Ga0207675_100011111 3300026118 Bacteria 8436
489 Ga0207675_100053310 3300026118 Bacteria 3774
490 Ga0207675_100136537 3300026118 Bacteria 2327
491 Ga0207675_100252475 3300026118 Unclassified 1707
492 Ga0207675_100891835 3300026118 Bacteria 905
493 Ga0207683_10000943 3300026121 Bacteria 26669
494 Ga0207683_10232413 3300026121 Bacteria 1682
495 Ga0207683_10314792 3300026121 Bacteria 1433
496 Ga0207683_10614457 3300026121 Unclassified 1006
497 Ga0207683_10650508 3300026121 Bacteria 976
498 Ga0207698_10084616 3300026142 Unclassified 2572
499 Ga0207698_10784324 3300026142 Bacteria 954
500 Ga0207698_12609638 3300026142 Bacteria 515
501 Ga0207428_10028282 3300027907 Unclassified 4659
502 Ga0268266_10000928 3300028379 Bacteria 37520
503 Ga0268266_10262957 3300028379 Bacteria 1599
504 Ga0268266_10408629 3300028379 Bacteria 1285
505 Ga0268266_10857449 3300028379 Bacteria 878
506 Ga0268265_10360472 3300028380 Bacteria 1331
507 Ga0268265_10578627 3300028380 Bacteria 1070
508 Ga0268265_10955553 3300028380 Unclassified 844
509 Ga0268265_11085868 3300028380 Bacteria 794
510 Ga0268265_11090925 3300028380 Bacteria 792
511 Ga0268265_11139810 3300028380 Bacteria 775
512 Ga0268265_11568668 3300028380 Bacteria 663
513 Ga0268264_10001859 3300028381 Bacteria 19198
514 Ga0268264_10039112 3300028381 Unclassified 3919
515 Ga0268264_10077792 3300028381 Unclassified 2826
516 Ga0268264_10198139 3300028381 Bacteria 1835
517 Ga0268264_11345710 3300028381 Bacteria 724
518 Ga0307515_10000002 3300028794 Bacteria 1231751
519 Ga0307515_10631097 3300028794 Bacteria 683
520 Ga0307408_101513119 3300031548 Bacteria 635
521 Ga0307516_10306853 3300031730 Bacteria 1261
522 Ga0307413_11326757 3300031824 Bacteria 630
523 Ga0307407_10681062 3300031903 Unclassified 773
524 Ga0307416_100989056 3300032002 Bacteria 944
525 Ga0307416_103714075 3300032002 Bacteria 511
526 Ga0307415_101721566 3300032126 Bacteria 605
527 Ga0373936_0239539 3300035113 Bacteria 808
528 Ga0373957_0238696 3300035120 Bacteria 763
529 Ga0373943_0465097 3300035170 Bacteria 736
530 Ga0373955_0604520 3300035172 Unclassified 672
531 Ga0373933_0836023 3300035724 Unclassified 606
532 Ga0373937_0157412 3300036401 Bacteria 2130
533 Ga0373937_0288355 3300036401 Unclassified 1551
534 Ga0373937_0543129 3300036401 Bacteria 1104
535 Ga0373937_1527002 3300036401 Unclassified 615
536 Ga0436365_0869194 3300039437 Unclassified 565
537 Ga0451791_0582350 3300041451 Bacteria 638
538 Ga0451798_1046411 3300041458 Unclassified 1248
539 Ga0451800_0180239 3300041459 Bacteria 638
540 Ga0451807_0115588 3300041486 Bacteria 527
541 Ga0439441_020574 3300042001 Bacteria 1210
542 Ga0450923_019270 3300042125 Bacteria 1313
543 Ga0439444_0050134 3300042437 Bacteria 846
544 Ga0439464_0178557 3300042439 Unclassified 672
545 Ga0450918_067729 3300042531 Unclassified 667
546 Ga0451577_1420388 3300042876 Unclassified 615
547 Ga0466970_0719545 3300044765 Unclassified 583
548 Ga0495629_0126232 3300046459 Unclassified 1782
549 Ga0495650_0076336 3300046471 Bacteria 1302
550 Ga0495580_1015429 3300046472 Unclassified 528
551 Ga0495662_0029821 3300046476 Bacteria 2633
552 Ga0495594_0165482 3300046499 Bacteria 1258
553 Ga0495630_0020530 3300046517 Bacteria 4871
554 Ga0495630_0035779 3300046517 Bacteria 3711
555 Ga0495665_0040252 3300046531 Bacteria 2489
556 Ga0495586_0449538 3300046535 Bacteria 743
557 Ga0495587_0196346 3300046536 Bacteria 1142
558 Ga0495645_0081049 3300046543 Unclassified 2329
559 Ga0495645_0528240 3300046543 Bacteria 734
560 Ga0495667_0738787 3300046559 Unclassified 609
561 Ga0495635_0414322 3300046663 Unclassified 894
562 Ga0495647_0074203 3300046681 Unclassified 1367
563 Ga0495658_0338468 3300046683 Bacteria 955
564 Ga0495669_0459106 3300046684 Bacteria 619
565 Ga0495613_0156689 3300046689 Unclassified 1622
566 Ga0495624_0157733 3300046690 Unclassified 1387
567 Ga0495624_0386278 3300046690 Unclassified 841
568 Ga0495600_0608583 3300046809 Bacteria 663
569 Ga0495604_0759893 3300047317 Unclassified 613
570 Ga0495674_0540664 3300047319 Bacteria 928
571 Ga0495672_0012712 3300047320 Bacteria 5854
572 Ga0495672_0046640 3300047320 Bacteria 2583
573 Ga0495672_0056973 3300047320 Bacteria 2271
574 Ga0495680_0752664 3300047322 Unclassified 640
575 Ga0495675_0283314 3300047444 Bacteria 988
576 Ga0495684_0350016 3300047471 Unclassified 1049
577 Ga0495686_0014005 3300047472 Bacteria 5542
578 Ga0495686_0016543 3300047472 Bacteria 5000
579 Ga0495602_0698058 3300048088 Bacteria 689
580 Ga0496101_1296933 3300048904 Bacteria 569
581 Ga0496102_0152912 3300048905 Bacteria 2169
582 Ga0496104_0837146 3300048907 Bacteria 826
583 Ga0496104_0856706 3300048907 Bacteria 814
584 Ga0496104_0968950 3300048907 Unclassified 755
585 Ga0496105_0440087 3300048908 Unclassified 1030
586 Ga0496105_1176213 3300048908 Bacteria 566
587 Ga0496107_1116045 3300048910 Bacteria 569
588 Ga0496108_0082978 3300048911 Unclassified 2718
589 Ga0496109_0029361 3300048912 Bacteria 4925
590 Ga0496114_0283711 3300048917 Bacteria 1460
591 Ga0501031_0005392 3300049568 Bacteria 8326
592 Ga0501031_0216466 3300049568 Bacteria 1248
593 Ga0501032_0034263 3300049569 Bacteria 3477
594 Ga0501032_0040483 3300049569 Bacteria 3168
595 Ga0501034_0126078 3300049571 Bacteria 2545
596 Ga0501036_0004749 3300049572 Bacteria 10968
597 Ga0501036_0106987 3300049572 Unclassified 2365
598 Ga0501037_0272204 3300049573 Bacteria 1181
599 Ga0501038_0011074 3300049574 Bacteria 8235
600 Ga0501038_0063668 3300049574 Bacteria 3147
601 Ga0501039_0099538 3300049575 Bacteria 2269
602 Ga0501043_0008703 3300049579 Bacteria 7986
603 Ga0501043_0069093 3300049579 Bacteria 2774
604 Ga0501046_0042558 3300049580 Bacteria 3621
605 Ga0501046_0796391 3300049580 Bacteria 662
606 Ga0501047_0031811 3300049581 Bacteria 5090
607 Ga0501048_0037369 3300049582 Bacteria 3487
608 Ga0501068_0787394 3300049584 Unclassified 623
609 Ga0501070_0586871 3300049586 Bacteria 889
610 Ga0501072_0235572 3300049588 Bacteria 1458
611 Ga0501073_0051186 3300049589 Bacteria 2893
612 Ga0501073_0999434 3300049589 Unclassified 575
613 Ga0501074_0078227 3300049590 Bacteria 2374
614 Ga0501075_1173551 3300049591 Bacteria 583
615 Ga0501080_0102847 3300049742 Bacteria 2650
616 Ga0501080_0460968 3300049742 Unclassified 1138
617 Ga0501035_0034818 3300049822 Bacteria 4575
618 Ga0501035_0042535 3300049822 Unclassified 4097
619 Ga0501044_0005613 3300049823 Bacteria 13933
620 Ga0501044_0301765 3300049823 Unclassified 1530
621 nmdc:mga0k408_1636_c1 3300050493 Bacteria 12115
622 nmdc:mga0k408_18606_c1 3300050493 Bacteria 3879
623 nmdc:mga05p37_285543_c1 3300050507 Bacteria 1966
624 nmdc:mga05p37_381519_c1 3300050507 Bacteria 1651
625 nmdc:mga09592_124074_c1 3300050508 Bacteria 2220
626 nmdc:mga09592_321370_c1 3300050508 Bacteria 1341
627 nmdc:mga0qj67_10091_c1 3300050509 Bacteria 7047
628 nmdc:mga0qj67_80584_c1 3300050509 Bacteria 2608
629 nmdc:mga06r32_1332723_c1 3300050510 Bacteria 661
630 nmdc:mga06r32_505653_c1 3300050510 Bacteria 1185
631 nmdc:mga08y16_1119021_c1 3300050511 Bacteria 762
632 nmdc:mga08y16_25548_c1 3300050511 Bacteria 6230
633 nmdc:mga0rr50_1005601_c1 3300050513 Bacteria 710
634 Ga0495619_0070002 3300053085 Unclassified 2346
635 Ga0500654_087461 3300053099 Bacteria 1411

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026121 Ga0207683_10232413 Ga0207683_102324133 81
2 3300006353 Ga0075370_10487625 Ga0075370_104876252 82
3 3300005840 Ga0068870_10214484 Ga0068870_102144842 83
4 3300009553 Ga0105249_10003125 Ga0105249_100031257 83
5 3300014325 Ga0163163_10880387 Ga0163163_108803871 83
6 3300014326 Ga0157380_11722044 Ga0157380_117220441 83
7 3300025961 Ga0207712_10001366 Ga0207712_100013666 83
8 3300005288 Ga0065714_10204137 Ga0065714_102041371 84
9 3300005290 Ga0065712_10053336 Ga0065712_100533361 84
10 3300005333 Ga0070677_10507306 Ga0070677_105073061 84
11 3300005333 Ga0070677_10879097 Ga0070677_108790971 84
12 3300005334 Ga0068869_100463182 Ga0068869_1004631822 84
13 3300005337 Ga0070682_100195368 Ga0070682_1001953682 84
14 3300005338 Ga0068868_100243133 Ga0068868_1002431332 84
15 3300005343 Ga0070687_100505186 Ga0070687_1005051862 84
16 3300005353 Ga0070669_100769731 Ga0070669_1007697311 84
17 3300005367 Ga0070667_100303957 Ga0070667_1003039572 84
18 3300005440 Ga0070705_100899648 Ga0070705_1008996482 84
19 3300005441 Ga0070700_100211890 Ga0070700_1002118902 84
20 3300005456 Ga0070678_101633003 Ga0070678_1016330031 84
21 3300005617 Ga0068859_100432566 Ga0068859_1004325662 84
22 3300005617 Ga0068859_101032159 Ga0068859_1010321592 84
23 3300005718 Ga0068866_10172262 Ga0068866_101722622 84
24 3300006881 Ga0068865_100536648 Ga0068865_1005366481 84
25 3300006931 Ga0097620_100432560 Ga0097620_1004325602 84
26 3300006931 Ga0097620_101032091 Ga0097620_1010320912 84
27 3300009176 Ga0105242_10945275 Ga0105242_109452752 84
28 3300011119 Ga0105246_10467507 Ga0105246_104675072 84
29 3300013308 Ga0157375_12490430 Ga0157375_124904301 84
30 3300013308 Ga0157375_13048253 Ga0157375_130482531 84
31 3300014745 Ga0157377_11230127 Ga0157377_112301271 84
32 3300025893 Ga0207682_10461528 Ga0207682_104615281 84
33 3300025908 Ga0207643_10195392 Ga0207643_101953921 84
34 3300025918 Ga0207662_10562837 Ga0207662_105628371 84
35 3300025923 Ga0207681_10374259 Ga0207681_103742592 84
36 3300025926 Ga0207659_10554345 Ga0207659_105543452 84
37 3300025936 Ga0207670_10427255 Ga0207670_104272552 84
38 3300025938 Ga0207704_10777157 Ga0207704_107771572 84
39 3300025940 Ga0207691_10973129 Ga0207691_109731291 84
40 3300025942 Ga0207689_10491444 Ga0207689_104914442 84
41 3300025960 Ga0207651_10870530 Ga0207651_108705302 84
42 3300026023 Ga0207677_11146253 Ga0207677_111462532 84
43 3300026041 Ga0207639_12053487 Ga0207639_120534871 84
44 3300026075 Ga0207708_10750224 Ga0207708_107502242 84
45 3300026121 Ga0207683_10314792 Ga0207683_103147922 84
46 3300028380 Ga0268265_11139810 Ga0268265_111398101 84
47 3300005293 Ga0065715_10595162 Ga0065715_105951621 85
48 3300005331 Ga0070670_100050349 Ga0070670_1000503493 85
49 3300005343 Ga0070687_100521384 Ga0070687_1005213841 85
50 3300005365 Ga0070688_100053524 Ga0070688_1000535243 85
51 3300005466 Ga0070685_10081682 Ga0070685_100816821 85
52 3300005719 Ga0068861_100584343 Ga0068861_1005843431 85
53 3300005842 Ga0068858_100913907 Ga0068858_1009139072 85
54 3300009553 Ga0105249_10179071 Ga0105249_101790712 85
55 3300013306 Ga0163162_10326309 Ga0163162_103263091 85
56 3300013308 Ga0157375_10606785 Ga0157375_106067852 85
57 3300025899 Ga0207642_10826158 Ga0207642_108261581 85
58 3300025918 Ga0207662_10094232 Ga0207662_100942322 85
59 3300025925 Ga0207650_10113773 Ga0207650_101137732 85
60 3300026035 Ga0207703_10184958 Ga0207703_101849583 85
61 3300028381 Ga0268264_11345710 Ga0268264_113457102 85
62 3300005356 Ga0070674_100413658 Ga0070674_1004136582 86
63 3300009094 Ga0111539_10519150 Ga0111539_105191502 86
64 3300025937 Ga0207669_10027963 Ga0207669_100279632 86
65 3300026089 Ga0207648_10244327 Ga0207648_102443272 86
66 3300026118 Ga0207675_100136537 Ga0207675_1001365373 86
67 3300050511 nmdc:mga08y16_1119021_c1 nmdc:mga08y16_1119021_c1_370_675 86
68 3300005290 Ga0065712_10092996 Ga0065712_100929962 87
69 3300005841 Ga0068863_100033403 Ga0068863_1000334033 87
70 3300009553 Ga0105249_11734010 Ga0105249_117340102 87
71 3300013306 Ga0163162_10250702 Ga0163162_102507023 87
72 3300013308 Ga0157375_10706277 Ga0157375_107062771 87
73 3300017792 Ga0163161_10083144 Ga0163161_100831442 87
74 3300026088 Ga0207641_10001405 Ga0207641_100014057 87
75 3300026088 Ga0207641_12037396 Ga0207641_120373962 87
76 3300026118 Ga0207675_100252475 Ga0207675_1002524751 87
77 3300026121 Ga0207683_10650508 Ga0207683_106505082 87
78 3300006844 Ga0075428_102047621 Ga0075428_1020476212 89
79 3300006847 Ga0075431_101490277 Ga0075431_1014902771 89
80 3300042001 Ga0439441_020574 Ga0439441_020574_815_1120 89
81 3300050510 nmdc:mga06r32_1332723_c1 nmdc:mga06r32_1332723_c1_341_646 89
82 3300041458 Ga0451798_1046411 Ga0451798_1046411_859_1164 90
83 3300013104 Ga0157370_10017114 Ga0157370_100171143 93
84 3300009174 Ga0105241_10967330 Ga0105241_109673302 96
85 3300009176 Ga0105242_10635598 Ga0105242_106355982 96
86 3300013297 Ga0157378_11287322 Ga0157378_112873222 96
87 3300005327 Ga0070658_10002266 Ga0070658_1000226614 97
88 3300005328 Ga0070676_10000458 Ga0070676_1000045815 97
89 3300005329 Ga0070683_101944403 Ga0070683_1019444031 97
90 3300005331 Ga0070670_100099508 Ga0070670_1000995083 97
91 3300005333 Ga0070677_10285123 Ga0070677_102851233 97
92 3300005334 Ga0068869_100338759 Ga0068869_1003387592 97
93 3300005335 Ga0070666_10053243 Ga0070666_100532432 97
94 3300005338 Ga0068868_100000493 Ga0068868_10000049321 97
95 3300005338 Ga0068868_100506649 Ga0068868_1005066492 97
96 3300005344 Ga0070661_101193586 Ga0070661_1011935861 97
97 3300005345 Ga0070692_10341604 Ga0070692_103416042 97
98 3300005347 Ga0070668_100000154 Ga0070668_10000015413 97
99 3300005355 Ga0070671_100017163 Ga0070671_1000171638 97
100 3300005356 Ga0070674_101229134 Ga0070674_1012291341 97
101 3300005364 Ga0070673_100001017 Ga0070673_10000101714 97
102 3300005367 Ga0070667_100001203 Ga0070667_10000120310 97
103 3300005367 Ga0070667_100227853 Ga0070667_1002278531 97
104 3300005367 Ga0070667_100242765 Ga0070667_1002427653 97
105 3300005455 Ga0070663_100149260 Ga0070663_1001492601 97
106 3300005456 Ga0070678_100027407 Ga0070678_1000274075 97
107 3300005457 Ga0070662_100004216 Ga0070662_10000421611 97
108 3300005459 Ga0068867_100001830 Ga0068867_1000018302 97
109 3300005539 Ga0068853_100049869 Ga0068853_1000498693 97
110 3300005543 Ga0070672_100000048 Ga0070672_10000004832 97
111 3300005543 Ga0070672_100330345 Ga0070672_1003303452 97
112 3300005547 Ga0070693_101082102 Ga0070693_1010821022 97
113 3300005548 Ga0070665_100003379 Ga0070665_10000337916 97
114 3300005563 Ga0068855_100095276 Ga0068855_1000952762 97
115 3300005614 Ga0068856_101424176 Ga0068856_1014241762 97
116 3300005616 Ga0068852_100105336 Ga0068852_1001053362 97
117 3300005616 Ga0068852_100781872 Ga0068852_1007818722 97
118 3300005618 Ga0068864_100079101 Ga0068864_1000791011 97
119 3300005618 Ga0068864_100328351 Ga0068864_1003283512 97
120 3300005718 Ga0068866_10491455 Ga0068866_104914551 97
121 3300005719 Ga0068861_100139662 Ga0068861_1001396623 97
122 3300005834 Ga0068851_10004047 Ga0068851_100040472 97
123 3300005841 Ga0068863_100005521 Ga0068863_10000552113 97
124 3300005841 Ga0068863_100269041 Ga0068863_1002690412 97
125 3300005842 Ga0068858_100001355 Ga0068858_10000135514 97
126 3300005843 Ga0068860_100011687 Ga0068860_1000116877 97
127 3300006163 Ga0070715_10158131 Ga0070715_101581312 97
128 3300006237 Ga0097621_100002545 Ga0097621_1000025454 97
129 3300006237 Ga0097621_100076545 Ga0097621_1000765455 97
130 3300006358 Ga0068871_100003156 Ga0068871_1000031566 97
131 3300006358 Ga0068871_100048716 Ga0068871_1000487166 97
132 3300006881 Ga0068865_100001341 Ga0068865_1000013415 97
133 3300009093 Ga0105240_10066684 Ga0105240_100666842 97
134 3300009098 Ga0105245_10070211 Ga0105245_100702112 97
135 3300009098 Ga0105245_11160076 Ga0105245_111600762 97
136 3300009148 Ga0105243_10223480 Ga0105243_102234802 97
137 3300009176 Ga0105242_12953651 Ga0105242_129536512 97
138 3300009177 Ga0105248_10128000 Ga0105248_101280002 97
139 3300009545 Ga0105237_10330937 Ga0105237_103309372 97
140 3300009553 Ga0105249_10004834 Ga0105249_100048345 97
141 3300009553 Ga0105249_10056524 Ga0105249_100565244 97
142 3300010375 Ga0105239_10637411 Ga0105239_106374112 97
143 3300013104 Ga0157370_10017652 Ga0157370_100176524 97
144 3300013105 Ga0157369_12222305 Ga0157369_122223052 97
145 3300013296 Ga0157374_10000314 Ga0157374_1000031427 97
146 3300013296 Ga0157374_10479636 Ga0157374_104796362 97
147 3300013297 Ga0157378_10001556 Ga0157378_1000155618 97
148 3300013297 Ga0157378_10492247 Ga0157378_104922472 97
149 3300013306 Ga0163162_10000231 Ga0163162_1000023113 97
150 3300013306 Ga0163162_10000318 Ga0163162_1000031812 97
151 3300013306 Ga0163162_10009899 Ga0163162_1000989911 97
152 3300013306 Ga0163162_10062519 Ga0163162_100625193 97
153 3300013306 Ga0163162_10109079 Ga0163162_101090792 97
154 3300013307 Ga0157372_10136366 Ga0157372_101363663 97
155 3300013307 Ga0157372_11483281 Ga0157372_114832812 97
156 3300013308 Ga0157375_10000073 Ga0157375_100000735 97
157 3300013308 Ga0157375_10000272 Ga0157375_1000027227 97
158 3300013308 Ga0157375_11537787 Ga0157375_115377872 97
159 3300013308 Ga0157375_11601731 Ga0157375_116017312 97
160 3300014325 Ga0163163_10000129 Ga0163163_1000012916 97
161 3300014325 Ga0163163_10000347 Ga0163163_1000034726 97
162 3300014968 Ga0157379_10000120 Ga0157379_1000012015 97
163 3300014968 Ga0157379_10380397 Ga0157379_103803972 97
164 3300014969 Ga0157376_10000271 Ga0157376_1000027126 97
165 3300014969 Ga0157376_10000774 Ga0157376_1000077410 97
166 3300014969 Ga0157376_10197202 Ga0157376_101972022 97
167 3300017792 Ga0163161_10011166 Ga0163161_100111662 97
168 3300017792 Ga0163161_10021878 Ga0163161_100218783 97
169 3300017792 Ga0163161_10058069 Ga0163161_100580695 97
170 3300025321 Ga0207656_10002217 Ga0207656_100022176 97
171 3300025903 Ga0207680_10000165 Ga0207680_1000016520 97
172 3300025903 Ga0207680_10042466 Ga0207680_100424662 97
173 3300025904 Ga0207647_10051653 Ga0207647_100516532 97
174 3300025905 Ga0207685_10265341 Ga0207685_102653412 97
175 3300025907 Ga0207645_10001368 Ga0207645_1000136810 97
176 3300025909 Ga0207705_10008997 Ga0207705_100089974 97
177 3300025920 Ga0207649_11069718 Ga0207649_110697181 97
178 3300025925 Ga0207650_10219152 Ga0207650_102191522 97
179 3300025931 Ga0207644_10009824 Ga0207644_100098244 97
180 3300025933 Ga0207706_10052672 Ga0207706_100526723 97
181 3300025934 Ga0207686_11687276 Ga0207686_116872761 97
182 3300025935 Ga0207709_10173575 Ga0207709_101735752 97
183 3300025938 Ga0207704_10000986 Ga0207704_1000098614 97
184 3300025940 Ga0207691_10000245 Ga0207691_1000024513 97
185 3300025940 Ga0207691_10766138 Ga0207691_107661382 97
186 3300025941 Ga0207711_10144727 Ga0207711_101447273 97
187 3300025942 Ga0207689_10350872 Ga0207689_103508722 97
188 3300025949 Ga0207667_10088148 Ga0207667_100881482 97
189 3300025960 Ga0207651_10009691 Ga0207651_100096912 97
190 3300025961 Ga0207712_10053502 Ga0207712_100535023 97
191 3300025961 Ga0207712_10358221 Ga0207712_103582212 97
192 3300025972 Ga0207668_10000184 Ga0207668_1000018413 97
193 3300025986 Ga0207658_10000452 Ga0207658_100004525 97
194 3300025986 Ga0207658_10080711 Ga0207658_100807113 97
195 3300026023 Ga0207677_10007781 Ga0207677_100077816 97
196 3300026023 Ga0207677_11032246 Ga0207677_110322462 97
197 3300026035 Ga0207703_10000388 Ga0207703_1000038812 97
198 3300026041 Ga0207639_10037498 Ga0207639_100374983 97
199 3300026067 Ga0207678_10133009 Ga0207678_101330092 97
200 3300026088 Ga0207641_10002172 Ga0207641_1000217212 97
201 3300026088 Ga0207641_11326362 Ga0207641_113263622 97
202 3300026089 Ga0207648_10004150 Ga0207648_1000415013 97
203 3300026095 Ga0207676_10011439 Ga0207676_100114396 97
204 3300026095 Ga0207676_10690287 Ga0207676_106902871 97
205 3300026118 Ga0207675_100010293 Ga0207675_1000102932 97
206 3300026121 Ga0207683_10614457 Ga0207683_106144572 97
207 3300026142 Ga0207698_10084616 Ga0207698_100846162 97
208 3300026142 Ga0207698_10784324 Ga0207698_107843242 97
209 3300028379 Ga0268266_10000928 Ga0268266_1000092827 97
210 3300028379 Ga0268266_10408629 Ga0268266_104086291 97
211 3300028381 Ga0268264_10039112 Ga0268264_100391124 97
212 3300041451 Ga0451791_0582350 Ga0451791_0582350_333_626 97
213 3300041486 Ga0451807_0115588 Ga0451807_0115588_174_467 97
214 3300046472 Ga0495580_1015429 Ga0495580_1015429_91_387 97
215 3300046517 Ga0495630_0035779 Ga0495630_0035779_2619_2915 97
216 3300046690 Ga0495624_0386278 Ga0495624_0386278_138_434 97
217 3300047322 Ga0495680_0752664 Ga0495680_0752664_145_441 97
218 3300048904 Ga0496101_1296933 Ga0496101_1296933_13_312 97
219 3300048905 Ga0496102_0152912 Ga0496102_0152912_965_1264 97
220 3300048907 Ga0496104_0837146 Ga0496104_0837146_420_719 97
221 3300048907 Ga0496104_0968950 Ga0496104_0968950_55_351 97
222 3300048908 Ga0496105_0440087 Ga0496105_0440087_559_855 97
223 3300048911 Ga0496108_0082978 Ga0496108_0082978_2211_2510 97
224 3300048912 Ga0496109_0029361 Ga0496109_0029361_1528_1827 97
225 3300048917 Ga0496114_0283711 Ga0496114_0283711_881_1180 97
226 3300050513 nmdc:mga0rr50_1005601_c1 nmdc:mga0rr50_1005601_c1_406_699 97
227 3300053099 Ga0500654_087461 Ga0500654_087461_192_485 97
228 2162886011 MRS1b_contig_1278685 MRS1b_0273.00003440 98
229 2162886012 MBSR1b_contig_4982930 MBSR1b_0817.00003530 98
230 3300001991 JGI24743J22301_10048807 JGI24743J22301_100488072 98
231 3300002077 JGI24744J21845_10014200 JGI24744J21845_100142002 98
232 3300002244 JGI24742J22300_10077530 JGI24742J22300_100775302 98
233 3300003322 rootL2_10213118 rootL2_102131183 98
234 3300005290 Ga0065712_10009117 Ga0065712_100091172 98
235 3300005290 Ga0065712_10426193 Ga0065712_104261932 98
236 3300005293 Ga0065715_10125870 Ga0065715_101258702 98
237 3300005295 Ga0065707_10007663 Ga0065707_100076633 98
238 3300005328 Ga0070676_10003200 Ga0070676_100032007 98
239 3300005330 Ga0070690_100044227 Ga0070690_1000442273 98
240 3300005330 Ga0070690_100465837 Ga0070690_1004658371 98
241 3300005331 Ga0070670_100080535 Ga0070670_1000805352 98
242 3300005331 Ga0070670_100318657 Ga0070670_1003186573 98
243 3300005331 Ga0070670_100438223 Ga0070670_1004382232 98
244 3300005331 Ga0070670_100786966 Ga0070670_1007869661 98
245 3300005333 Ga0070677_10013498 Ga0070677_100134982 98
246 3300005334 Ga0068869_100011037 Ga0068869_1000110376 98
247 3300005334 Ga0068869_100032741 Ga0068869_1000327413 98
248 3300005334 Ga0068869_100045035 Ga0068869_1000450353 98
249 3300005334 Ga0068869_100172105 Ga0068869_1001721052 98
250 3300005334 Ga0068869_100820240 Ga0068869_1008202402 98
251 3300005335 Ga0070666_10035829 Ga0070666_100358292 98
252 3300005335 Ga0070666_10278456 Ga0070666_102784561 98
253 3300005338 Ga0068868_100016265 Ga0068868_1000162656 98
254 3300005338 Ga0068868_101777251 Ga0068868_1017772511 98
255 3300005340 Ga0070689_100052227 Ga0070689_1000522272 98
256 3300005340 Ga0070689_100935374 Ga0070689_1009353742 98
257 3300005340 Ga0070689_101143030 Ga0070689_1011430302 98
258 3300005343 Ga0070687_100048101 Ga0070687_1000481012 98
259 3300005347 Ga0070668_100035316 Ga0070668_1000353165 98
260 3300005347 Ga0070668_100221798 Ga0070668_1002217983 98
261 3300005347 Ga0070668_100404316 Ga0070668_1004043161 98
262 3300005347 Ga0070668_100861682 Ga0070668_1008616822 98
263 3300005347 Ga0070668_101800123 Ga0070668_1018001232 98
264 3300005353 Ga0070669_100003025 Ga0070669_1000030255 98
265 3300005353 Ga0070669_100006016 Ga0070669_1000060165 98
266 3300005353 Ga0070669_100214312 Ga0070669_1002143122 98
267 3300005353 Ga0070669_101597342 Ga0070669_1015973422 98
268 3300005354 Ga0070675_100005755 Ga0070675_1000057554 98
269 3300005354 Ga0070675_100080415 Ga0070675_1000804154 98
270 3300005354 Ga0070675_101603116 Ga0070675_1016031162 98
271 3300005355 Ga0070671_100843408 Ga0070671_1008434081 98
272 3300005356 Ga0070674_100122880 Ga0070674_1001228803 98
273 3300005356 Ga0070674_101063817 Ga0070674_1010638171 98
274 3300005364 Ga0070673_100020510 Ga0070673_1000205102 98
275 3300005364 Ga0070673_100030274 Ga0070673_1000302741 98
276 3300005364 Ga0070673_100046319 Ga0070673_1000463191 98
277 3300005364 Ga0070673_101516161 Ga0070673_1015161612 98
278 3300005365 Ga0070688_100023656 Ga0070688_1000236562 98
279 3300005365 Ga0070688_100354789 Ga0070688_1003547892 98
280 3300005365 Ga0070688_100619284 Ga0070688_1006192842 98
281 3300005367 Ga0070667_100128225 Ga0070667_1001282251 98
282 3300005367 Ga0070667_100771627 Ga0070667_1007716272 98
283 3300005367 Ga0070667_101434151 Ga0070667_1014341512 98
284 3300005441 Ga0070700_100068909 Ga0070700_1000689093 98
285 3300005441 Ga0070700_100185339 Ga0070700_1001853392 98
286 3300005441 Ga0070700_100885706 Ga0070700_1008857061 98
287 3300005455 Ga0070663_100366089 Ga0070663_1003660892 98
288 3300005456 Ga0070678_100145245 Ga0070678_1001452453 98
289 3300005457 Ga0070662_100010256 Ga0070662_1000102567 98
290 3300005457 Ga0070662_100168155 Ga0070662_1001681552 98
291 3300005459 Ga0068867_100105504 Ga0068867_1001055042 98
292 3300005459 Ga0068867_100111234 Ga0068867_1001112344 98
293 3300005459 Ga0068867_100587030 Ga0068867_1005870302 98
294 3300005466 Ga0070685_11325362 Ga0070685_113253621 98
295 3300005471 Ga0070698_100002094 Ga0070698_10000209416 98
296 3300005471 Ga0070698_100006624 Ga0070698_1000066247 98
297 3300005539 Ga0068853_100014617 Ga0068853_1000146176 98
298 3300005539 Ga0068853_100052295 Ga0068853_1000522952 98
299 3300005539 Ga0068853_102071117 Ga0068853_1020711172 98
300 3300005543 Ga0070672_100008700 Ga0070672_1000087007 98
301 3300005543 Ga0070672_101690240 Ga0070672_1016902401 98
302 3300005544 Ga0070686_100361545 Ga0070686_1003615452 98
303 3300005548 Ga0070665_100071165 Ga0070665_1000711654 98
304 3300005548 Ga0070665_101258312 Ga0070665_1012583121 98
305 3300005564 Ga0070664_101185467 Ga0070664_1011854673 98
306 3300005577 Ga0068857_100132871 Ga0068857_1001328713 98
307 3300005577 Ga0068857_100382856 Ga0068857_1003828562 98
308 3300005577 Ga0068857_100586298 Ga0068857_1005862983 98
309 3300005578 Ga0068854_100717046 Ga0068854_1007170462 98
310 3300005616 Ga0068852_101406589 Ga0068852_1014065892 98
311 3300005617 Ga0068859_100007565 Ga0068859_1000075658 98
312 3300005617 Ga0068859_100027468 Ga0068859_1000274685 98
313 3300005617 Ga0068859_100205833 Ga0068859_1002058332 98
314 3300005617 Ga0068859_100514640 Ga0068859_1005146402 98
315 3300005617 Ga0068859_100802538 Ga0068859_1008025382 98
316 3300005617 Ga0068859_100962911 Ga0068859_1009629112 98
317 3300005618 Ga0068864_100026182 Ga0068864_1000261822 98
318 3300005618 Ga0068864_101115940 Ga0068864_1011159402 98
319 3300005618 Ga0068864_101872215 Ga0068864_1018722152 98
320 3300005718 Ga0068866_10061456 Ga0068866_100614563 98
321 3300005719 Ga0068861_100008514 Ga0068861_1000085145 98
322 3300005719 Ga0068861_100013356 Ga0068861_1000133562 98
323 3300005719 Ga0068861_100031759 Ga0068861_1000317595 98
324 3300005719 Ga0068861_100055850 Ga0068861_1000558501 98
325 3300005719 Ga0068861_101402953 Ga0068861_1014029532 98
326 3300005719 Ga0068861_101709345 Ga0068861_1017093452 98
327 3300005719 Ga0068861_102049644 Ga0068861_1020496442 98
328 3300005840 Ga0068870_10002573 Ga0068870_100025735 98
329 3300005840 Ga0068870_10002679 Ga0068870_100026794 98
330 3300005840 Ga0068870_11143518 Ga0068870_111435181 98
331 3300005841 Ga0068863_100095798 Ga0068863_1000957983 98
332 3300005841 Ga0068863_100325905 Ga0068863_1003259052 98
333 3300005841 Ga0068863_100848295 Ga0068863_1008482952 98
334 3300005842 Ga0068858_101563734 Ga0068858_1015637342 98
335 3300005843 Ga0068860_100005349 Ga0068860_10000534912 98
336 3300005843 Ga0068860_100092303 Ga0068860_1000923035 98
337 3300005843 Ga0068860_100325752 Ga0068860_1003257522 98
338 3300005843 Ga0068860_100460023 Ga0068860_1004600232 98
339 3300005843 Ga0068860_100808090 Ga0068860_1008080902 98
340 3300005844 Ga0068862_100050077 Ga0068862_1000500774 98
341 3300005844 Ga0068862_100166306 Ga0068862_1001663063 98
342 3300005844 Ga0068862_100294371 Ga0068862_1002943712 98
343 3300005844 Ga0068862_100906719 Ga0068862_1009067192 98
344 3300005844 Ga0068862_101490526 Ga0068862_1014905262 98
345 3300005844 Ga0068862_102740873 Ga0068862_1027408732 98
346 3300006163 Ga0070715_10243824 Ga0070715_102438242 98
347 3300006173 Ga0070716_100050453 Ga0070716_1000504533 98
348 3300006194 Ga0075427_10053032 Ga0075427_100530322 98
349 3300006195 Ga0075366_10011207 Ga0075366_100112076 98
350 3300006237 Ga0097621_100022140 Ga0097621_1000221404 98
351 3300006237 Ga0097621_100453399 Ga0097621_1004533992 98
352 3300006237 Ga0097621_101951294 Ga0097621_1019512942 98
353 3300006358 Ga0068871_100104372 Ga0068871_1001043722 98
354 3300006358 Ga0068871_100186135 Ga0068871_1001861352 98
355 3300006358 Ga0068871_100360679 Ga0068871_1003606792 98
356 3300006358 Ga0068871_100452626 Ga0068871_1004526262 98
357 3300006358 Ga0068871_100634297 Ga0068871_1006342971 98
358 3300006844 Ga0075428_100133868 Ga0075428_1001338683 98
359 3300006844 Ga0075428_100186483 Ga0075428_1001864833 98
360 3300006844 Ga0075428_100235074 Ga0075428_1002350742 98
361 3300006846 Ga0075430_100003135 Ga0075430_1000031355 98
362 3300006846 Ga0075430_100044213 Ga0075430_1000442134 98
363 3300006847 Ga0075431_100202278 Ga0075431_1002022783 98
364 3300006847 Ga0075431_100345451 Ga0075431_1003454512 98
365 3300006852 Ga0075433_10517232 Ga0075433_105172321 98
366 3300006880 Ga0075429_100167295 Ga0075429_1001672952 98
367 3300006880 Ga0075429_100274449 Ga0075429_1002744491 98
368 3300006880 Ga0075429_101445106 Ga0075429_1014451061 98
369 3300006881 Ga0068865_100053256 Ga0068865_1000532564 98
370 3300006881 Ga0068865_100811983 Ga0068865_1008119832 98
371 3300006931 Ga0097620_100007565 Ga0097620_1000075658 98
372 3300006931 Ga0097620_100027468 Ga0097620_1000274685 98
373 3300006931 Ga0097620_100205847 Ga0097620_1002058472 98
374 3300006931 Ga0097620_100514666 Ga0097620_1005146662 98
375 3300006931 Ga0097620_100802620 Ga0097620_1008026202 98
376 3300006931 Ga0097620_100962838 Ga0097620_1009628382 98
377 3300009094 Ga0111539_10023974 Ga0111539_100239747 98
378 3300009094 Ga0111539_10399820 Ga0111539_103998201 98
379 3300009098 Ga0105245_10447724 Ga0105245_104477242 98
380 3300009101 Ga0105247_10948164 Ga0105247_109481642 98
381 3300009147 Ga0114129_10364637 Ga0114129_103646373 98
382 3300009147 Ga0114129_11261763 Ga0114129_112617631 98
383 3300009147 Ga0114129_13086625 Ga0114129_130866252 98
384 3300009174 Ga0105241_10150429 Ga0105241_101504293 98
385 3300009174 Ga0105241_10436437 Ga0105241_104364372 98
386 3300009174 Ga0105241_12696762 Ga0105241_126967621 98
387 3300009176 Ga0105242_10025455 Ga0105242_100254555 98
388 3300009176 Ga0105242_10068251 Ga0105242_100682513 98
389 3300009176 Ga0105242_10553337 Ga0105242_105533372 98
390 3300009176 Ga0105242_13206256 Ga0105242_132062562 98
391 3300009177 Ga0105248_12780078 Ga0105248_127800781 98
392 3300009545 Ga0105237_11535979 Ga0105237_115359792 98
393 3300009553 Ga0105249_10003218 Ga0105249_100032187 98
394 3300009553 Ga0105249_10243512 Ga0105249_102435122 98
395 3300009553 Ga0105249_10316937 Ga0105249_103169372 98
396 3300009553 Ga0105249_10446226 Ga0105249_104462262 98
397 3300009553 Ga0105249_10891508 Ga0105249_108915082 98
398 3300009553 Ga0105249_11684389 Ga0105249_116843892 98
399 3300009553 Ga0105249_12244194 Ga0105249_122441941 98
400 3300010375 Ga0105239_10288495 Ga0105239_102884953 98
401 3300011119 Ga0105246_10009910 Ga0105246_100099102 98
402 3300011119 Ga0105246_10203726 Ga0105246_102037262 98
403 3300011119 Ga0105246_10845059 Ga0105246_108450591 98
404 3300013104 Ga0157370_11300313 Ga0157370_113003131 98
405 3300013105 Ga0157369_11660651 Ga0157369_116606512 98
406 3300013296 Ga0157374_10100813 Ga0157374_101008131 98
407 3300013296 Ga0157374_10514754 Ga0157374_105147542 98
408 3300013297 Ga0157378_11079495 Ga0157378_110794952 98
409 3300013306 Ga0163162_10000224 Ga0163162_1000022424 98
410 3300013306 Ga0163162_10002781 Ga0163162_100027812 98
411 3300013306 Ga0163162_10055575 Ga0163162_100555753 98
412 3300013306 Ga0163162_10251650 Ga0163162_102516502 98
413 3300013306 Ga0163162_10783451 Ga0163162_107834512 98
414 3300013308 Ga0157375_10021346 Ga0157375_100213462 98
415 3300013308 Ga0157375_10098056 Ga0157375_100980564 98
416 3300013308 Ga0157375_11923004 Ga0157375_119230041 98
417 3300014325 Ga0163163_10435822 Ga0163163_104358222 98
418 3300014325 Ga0163163_10728490 Ga0163163_107284901 98
419 3300014325 Ga0163163_10736684 Ga0163163_107366842 98
420 3300014325 Ga0163163_12289764 Ga0163163_122897641 98
421 3300014326 Ga0157380_10013692 Ga0157380_100136924 98
422 3300014326 Ga0157380_10590765 Ga0157380_105907652 98
423 3300014745 Ga0157377_10002157 Ga0157377_100021572 98
424 3300014745 Ga0157377_10061358 Ga0157377_100613583 98
425 3300014745 Ga0157377_10135847 Ga0157377_101358472 98
426 3300014745 Ga0157377_11002983 Ga0157377_110029832 98
427 3300014968 Ga0157379_10632225 Ga0157379_106322251 98
428 3300014968 Ga0157379_10828694 Ga0157379_108286941 98
429 3300014968 Ga0157379_10897515 Ga0157379_108975152 98
430 3300014968 Ga0157379_11372497 Ga0157379_113724972 98
431 3300014968 Ga0157379_12043932 Ga0157379_120439322 98
432 3300014969 Ga0157376_10032084 Ga0157376_100320844 98
433 3300014969 Ga0157376_10193197 Ga0157376_101931972 98
434 3300014969 Ga0157376_10246399 Ga0157376_102463992 98
435 3300014969 Ga0157376_10271107 Ga0157376_102711072 98
436 3300017792 Ga0163161_10385984 Ga0163161_103859842 98
437 3300017792 Ga0163161_11686295 Ga0163161_116862952 98
438 3300017792 Ga0163161_11926432 Ga0163161_119264322 98
439 3300025315 Ga0207697_10009721 Ga0207697_100097214 98
440 3300025321 Ga0207656_10074325 Ga0207656_100743252 98
441 3300025893 Ga0207682_10087645 Ga0207682_100876451 98
442 3300025899 Ga0207642_10442005 Ga0207642_104420052 98
443 3300025901 Ga0207688_10135229 Ga0207688_101352292 98
444 3300025903 Ga0207680_10133108 Ga0207680_101331082 98
445 3300025904 Ga0207647_10357526 Ga0207647_103575262 98
446 3300025907 Ga0207645_10000263 Ga0207645_1000026310 98
447 3300025907 Ga0207645_10052338 Ga0207645_100523384 98
448 3300025908 Ga0207643_10002440 Ga0207643_100024402 98
449 3300025908 Ga0207643_10004417 Ga0207643_100044175 98
450 3300025911 Ga0207654_10596115 Ga0207654_105961152 98
451 3300025918 Ga0207662_10401390 Ga0207662_104013902 98
452 3300025923 Ga0207681_10042542 Ga0207681_100425424 98
453 3300025923 Ga0207681_10047551 Ga0207681_100475512 98
454 3300025923 Ga0207681_10460829 Ga0207681_104608292 98
455 3300025925 Ga0207650_10135789 Ga0207650_101357892 98
456 3300025925 Ga0207650_10283504 Ga0207650_102835041 98
457 3300025925 Ga0207650_11047692 Ga0207650_110476922 98
458 3300025926 Ga0207659_10044504 Ga0207659_100445042 98
459 3300025926 Ga0207659_10143270 Ga0207659_101432702 98
460 3300025931 Ga0207644_10780109 Ga0207644_107801092 98
461 3300025933 Ga0207706_10021277 Ga0207706_100212777 98
462 3300025933 Ga0207706_10194915 Ga0207706_101949152 98
463 3300025934 Ga0207686_10007206 Ga0207686_100072063 98
464 3300025934 Ga0207686_10053723 Ga0207686_100537232 98
465 3300025934 Ga0207686_10408285 Ga0207686_104082852 98
466 3300025934 Ga0207686_11852283 Ga0207686_118522832 98
467 3300025936 Ga0207670_10064208 Ga0207670_100642082 98
468 3300025936 Ga0207670_10496736 Ga0207670_104967362 98
469 3300025937 Ga0207669_10152289 Ga0207669_101522892 98
470 3300025938 Ga0207704_10057274 Ga0207704_100572743 98
471 3300025938 Ga0207704_10508301 Ga0207704_105083012 98
472 3300025939 Ga0207665_10300867 Ga0207665_103008673 98
473 3300025940 Ga0207691_10003243 Ga0207691_1000324311 98
474 3300025940 Ga0207691_11443784 Ga0207691_114437841 98
475 3300025942 Ga0207689_10007704 Ga0207689_100077045 98
476 3300025942 Ga0207689_10018354 Ga0207689_100183542 98
477 3300025942 Ga0207689_10034355 Ga0207689_100343554 98
478 3300025942 Ga0207689_10110922 Ga0207689_101109222 98
479 3300025945 Ga0207679_11781498 Ga0207679_117814981 98
480 3300025960 Ga0207651_10133394 Ga0207651_101333942 98
481 3300025960 Ga0207651_10230096 Ga0207651_102300962 98
482 3300025960 Ga0207651_10392678 Ga0207651_103926782 98
483 3300025960 Ga0207651_10582341 Ga0207651_105823412 98
484 3300025960 Ga0207651_10896550 Ga0207651_108965501 98
485 3300025960 Ga0207651_11045601 Ga0207651_110456012 98
486 3300025961 Ga0207712_10023399 Ga0207712_100233993 98
487 3300025961 Ga0207712_10053484 Ga0207712_100534841 98
488 3300025961 Ga0207712_10768054 Ga0207712_107680542 98
489 3300025961 Ga0207712_11211046 Ga0207712_112110461 98
490 3300025972 Ga0207668_10031257 Ga0207668_100312574 98
491 3300025972 Ga0207668_10175479 Ga0207668_101754792 98
492 3300025972 Ga0207668_10207582 Ga0207668_102075822 98
493 3300025972 Ga0207668_11452968 Ga0207668_114529682 98
494 3300025981 Ga0207640_11027713 Ga0207640_110277132 98
495 3300025986 Ga0207658_10051664 Ga0207658_100516643 98
496 3300025986 Ga0207658_10277636 Ga0207658_102776362 98
497 3300025986 Ga0207658_10676452 Ga0207658_106764522 98
498 3300026023 Ga0207677_10044534 Ga0207677_100445342 98
499 3300026035 Ga0207703_11301785 Ga0207703_113017852 98
500 3300026035 Ga0207703_11842410 Ga0207703_118424101 98
501 3300026041 Ga0207639_10010418 Ga0207639_100104183 98
502 3300026041 Ga0207639_10128442 Ga0207639_101284422 98
503 3300026067 Ga0207678_10255098 Ga0207678_102550983 98
504 3300026075 Ga0207708_10058594 Ga0207708_100585942 98
505 3300026075 Ga0207708_10219354 Ga0207708_102193542 98
506 3300026075 Ga0207708_11005798 Ga0207708_110057982 98
507 3300026088 Ga0207641_10082161 Ga0207641_100821612 98
508 3300026088 Ga0207641_10299891 Ga0207641_102998912 98
509 3300026089 Ga0207648_10002644 Ga0207648_100026447 98
510 3300026089 Ga0207648_10076562 Ga0207648_100765622 98
511 3300026089 Ga0207648_10139450 Ga0207648_101394503 98
512 3300026095 Ga0207676_10604333 Ga0207676_106043332 98
513 3300026095 Ga0207676_11003068 Ga0207676_110030682 98
514 3300026116 Ga0207674_10001856 Ga0207674_100018566 98
515 3300026116 Ga0207674_10053595 Ga0207674_100535954 98
516 3300026116 Ga0207674_10386839 Ga0207674_103868392 98
517 3300026116 Ga0207674_10624581 Ga0207674_106245811 98
518 3300026116 Ga0207674_10902001 Ga0207674_109020012 98
519 3300026118 Ga0207675_100003498 Ga0207675_1000034989 98
520 3300026118 Ga0207675_100006997 Ga0207675_1000069976 98
521 3300026118 Ga0207675_100011111 Ga0207675_1000111118 98
522 3300026118 Ga0207675_100053310 Ga0207675_1000533103 98
523 3300026118 Ga0207675_100891835 Ga0207675_1008918352 98
524 3300026121 Ga0207683_10000943 Ga0207683_1000094319 98
525 3300026142 Ga0207698_12609638 Ga0207698_126096382 98
526 3300027907 Ga0207428_10028282 Ga0207428_100282826 98
527 3300028379 Ga0268266_10262957 Ga0268266_102629572 98
528 3300028379 Ga0268266_10857449 Ga0268266_108574491 98
529 3300028380 Ga0268265_10360472 Ga0268265_103604721 98
530 3300028380 Ga0268265_10578627 Ga0268265_105786272 98
531 3300028380 Ga0268265_10955553 Ga0268265_109555532 98
532 3300028380 Ga0268265_11085868 Ga0268265_110858682 98
533 3300028380 Ga0268265_11090925 Ga0268265_110909251 98
534 3300028380 Ga0268265_11568668 Ga0268265_115686682 98
535 3300028381 Ga0268264_10001859 Ga0268264_100018597 98
536 3300028381 Ga0268264_10077792 Ga0268264_100777922 98
537 3300028381 Ga0268264_10198139 Ga0268264_101981392 98
538 3300028794 Ga0307515_10000002 Ga0307515_10000002394 98
539 3300028794 Ga0307515_10631097 Ga0307515_106310972 98
540 3300031548 Ga0307408_101513119 Ga0307408_1015131192 98
541 3300031730 Ga0307516_10306853 Ga0307516_103068532 98
542 3300031824 Ga0307413_11326757 Ga0307413_113267572 98
543 3300031903 Ga0307407_10681062 Ga0307407_106810622 98
544 3300032002 Ga0307416_100989056 Ga0307416_1009890562 98
545 3300032002 Ga0307416_103714075 Ga0307416_1037140751 98
546 3300032126 Ga0307415_101721566 Ga0307415_1017215662 98
547 3300035113 Ga0373936_0239539 Ga0373936_0239539_440_739 98
548 3300035120 Ga0373957_0238696 Ga0373957_0238696_188_487 98
549 3300035170 Ga0373943_0465097 Ga0373943_0465097_104_403 98
550 3300035172 Ga0373955_0604520 Ga0373955_0604520_107_406 98
551 3300035724 Ga0373933_0836023 Ga0373933_0836023_225_524 98
552 3300036401 Ga0373937_0157412 Ga0373937_0157412_831_1130 98
553 3300036401 Ga0373937_0288355 Ga0373937_0288355_1175_1480 98
554 3300036401 Ga0373937_0543129 Ga0373937_0543129_442_747 98
555 3300036401 Ga0373937_1527002 Ga0373937_1527002_272_571 98
556 3300039437 Ga0436365_0869194 Ga0436365_0869194_136_432 98
557 3300041459 Ga0451800_0180239 Ga0451800_0180239_145_450 98
558 3300042125 Ga0450923_019270 Ga0450923_019270_340_645 98
559 3300042437 Ga0439444_0050134 Ga0439444_0050134_80_385 98
560 3300042439 Ga0439464_0178557 Ga0439464_0178557_266_571 98
561 3300042531 Ga0450918_067729 Ga0450918_067729_315_620 98
562 3300042876 Ga0451577_1420388 Ga0451577_1420388_129_425 98
563 3300044765 Ga0466970_0719545 Ga0466970_0719545_224_538 98
564 3300046459 Ga0495629_0126232 Ga0495629_0126232_318_617 98
565 3300046471 Ga0495650_0076336 Ga0495650_0076336_627_932 98
566 3300046476 Ga0495662_0029821 Ga0495662_0029821_114_413 98
567 3300046499 Ga0495594_0165482 Ga0495594_0165482_723_1028 98
568 3300046517 Ga0495630_0020530 Ga0495630_0020530_3981_4280 98
569 3300046531 Ga0495665_0040252 Ga0495665_0040252_1747_2046 98
570 3300046535 Ga0495586_0449538 Ga0495586_0449538_216_515 98
571 3300046536 Ga0495587_0196346 Ga0495587_0196346_244_543 98
572 3300046543 Ga0495645_0081049 Ga0495645_0081049_157_456 98
573 3300046543 Ga0495645_0528240 Ga0495645_0528240_97_396 98
574 3300046559 Ga0495667_0738787 Ga0495667_0738787_58_357 98
575 3300046663 Ga0495635_0414322 Ga0495635_0414322_361_660 98
576 3300046681 Ga0495647_0074203 Ga0495647_0074203_352_651 98
577 3300046683 Ga0495658_0338468 Ga0495658_0338468_637_936 98
578 3300046684 Ga0495669_0459106 Ga0495669_0459106_135_440 98
579 3300046689 Ga0495613_0156689 Ga0495613_0156689_1144_1443 98
580 3300046690 Ga0495624_0157733 Ga0495624_0157733_957_1256 98
581 3300046809 Ga0495600_0608583 Ga0495600_0608583_109_408 98
582 3300047317 Ga0495604_0759893 Ga0495604_0759893_55_354 98
583 3300047319 Ga0495674_0540664 Ga0495674_0540664_396_695 98
584 3300047320 Ga0495672_0012712 Ga0495672_0012712_2632_2937 98
585 3300047320 Ga0495672_0046640 Ga0495672_0046640_1274_1573 98
586 3300047320 Ga0495672_0056973 Ga0495672_0056973_872_1180 98
587 3300047444 Ga0495675_0283314 Ga0495675_0283314_146_445 98
588 3300047471 Ga0495684_0350016 Ga0495684_0350016_17_316 98
589 3300047472 Ga0495686_0014005 Ga0495686_0014005_3999_4301 98
590 3300047472 Ga0495686_0016543 Ga0495686_0016543_2400_2702 98
591 3300048088 Ga0495602_0698058 Ga0495602_0698058_357_656 98
592 3300048907 Ga0496104_0856706 Ga0496104_0856706_71_370 98
593 3300048908 Ga0496105_1176213 Ga0496105_1176213_21_320 98
594 3300048910 Ga0496107_1116045 Ga0496107_1116045_87_386 98
595 3300049568 Ga0501031_0005392 Ga0501031_0005392_4511_4816 98
596 3300049568 Ga0501031_0216466 Ga0501031_0216466_41_337 98
597 3300049569 Ga0501032_0034263 Ga0501032_0034263_2969_3265 98
598 3300049569 Ga0501032_0040483 Ga0501032_0040483_2126_2431 98
599 3300049571 Ga0501034_0126078 Ga0501034_0126078_1402_1707 98
600 3300049572 Ga0501036_0004749 Ga0501036_0004749_3307_3612 98
601 3300049572 Ga0501036_0106987 Ga0501036_0106987_1703_1999 98
602 3300049573 Ga0501037_0272204 Ga0501037_0272204_22_327 98
603 3300049574 Ga0501038_0011074 Ga0501038_0011074_1243_1548 98
604 3300049574 Ga0501038_0063668 Ga0501038_0063668_2730_3026 98
605 3300049575 Ga0501039_0099538 Ga0501039_0099538_389_685 98
606 3300049579 Ga0501043_0008703 Ga0501043_0008703_1490_1795 98
607 3300049579 Ga0501043_0069093 Ga0501043_0069093_225_521 98
608 3300049580 Ga0501046_0042558 Ga0501046_0042558_2651_2956 98
609 3300049580 Ga0501046_0796391 Ga0501046_0796391_56_352 98
610 3300049581 Ga0501047_0031811 Ga0501047_0031811_4688_4984 98
611 3300049582 Ga0501048_0037369 Ga0501048_0037369_266_562 98
612 3300049584 Ga0501068_0787394 Ga0501068_0787394_60_365 98
613 3300049586 Ga0501070_0586871 Ga0501070_0586871_502_798 98
614 3300049588 Ga0501072_0235572 Ga0501072_0235572_847_1152 98
615 3300049589 Ga0501073_0051186 Ga0501073_0051186_374_670 98
616 3300049589 Ga0501073_0999434 Ga0501073_0999434_37_342 98
617 3300049590 Ga0501074_0078227 Ga0501074_0078227_288_584 98
618 3300049591 Ga0501075_1173551 Ga0501075_1173551_267_572 98
619 3300049742 Ga0501080_0102847 Ga0501080_0102847_1491_1796 98
620 3300049742 Ga0501080_0460968 Ga0501080_0460968_374_670 98
621 3300049822 Ga0501035_0034818 Ga0501035_0034818_926_1222 98
622 3300049822 Ga0501035_0042535 Ga0501035_0042535_548_853 98
623 3300049823 Ga0501044_0005613 Ga0501044_0005613_13592_13897 98
624 3300049823 Ga0501044_0301765 Ga0501044_0301765_901_1197 98
625 3300050493 nmdc:mga0k408_1636_c1 nmdc:mga0k408_1636_c1_5078_5380 98
626 3300050493 nmdc:mga0k408_18606_c1 nmdc:mga0k408_18606_c1_2341_2643 98
627 3300050507 nmdc:mga05p37_285543_c1 nmdc:mga05p37_285543_c1_565_870 98
628 3300050507 nmdc:mga05p37_381519_c1 nmdc:mga05p37_381519_c1_336_647 98
629 3300050508 nmdc:mga09592_124074_c1 nmdc:mga09592_124074_c1_1706_2011 98
630 3300050508 nmdc:mga09592_321370_c1 nmdc:mga09592_321370_c1_547_858 98
631 3300050509 nmdc:mga0qj67_10091_c1 nmdc:mga0qj67_10091_c1_3044_3349 98
632 3300050509 nmdc:mga0qj67_80584_c1 nmdc:mga0qj67_80584_c1_100_411 98
633 3300050510 nmdc:mga06r32_505653_c1 nmdc:mga06r32_505653_c1_477_788 98
634 3300050511 nmdc:mga08y16_25548_c1 nmdc:mga08y16_25548_c1_5879_6175 98
635 3300053085 Ga0495619_0070002 Ga0495619_0070002_1217_1516 98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8acy-assembly1.cif.gz_D x-ray structure of na+-nqr from vibrio cholerae at 3.5 a resolution 0.4983 6 87
8acy-assembly1.cif.gz_D x-ray structure of na+-nqr from vibrio cholerae at 3.5 a resolution 0.4018 6 87
1q16-assembly1.cif.gz_C crystal structure of nitrate reductase a, narghi, from escherichia coli 0.3659 4 96
1q16-assembly1.cif.gz_C crystal structure of nitrate reductase a, narghi, from escherichia coli 0.3492 4 96
3urz-assembly2.cif.gz_B crystal structure of a putative protein binding protein (bacova_03105) from bacteroides ovatus atcc 8483 at 2.19 a resolution 0.2801 3 87
ID Description Score Start End Superfamily
af_Q2G0A8_1_95_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.6054 9 97 1.20.58.80
af_Q46867_3_109_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5901 11 95 1.20.1070.10
af_Q21780_16_146_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.5296 21 95 1.20.140.150
af_Q46867_3_109_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5139 11 95 1.20.1070.10
af_Q17953_1_158_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.5133 10 94 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A352CJH6-F1-model_v4 Uncharacterized protein 0.998 1 98 GO:0016020
AF-A0A4Q6AKG0-F1-model_v4 Uncharacterized protein 0.9656 4 96 GO:0016020
AF-A0A7V9K2P5-F1-model_v4 DUF368 domain-containing protein 0.9474 1 98 GO:0016020
AF-A0A2W2BA27-F1-model_v4 Uncharacterized protein 0.9428 3 98 GO:0016020
AF-A0A136NL37-F1-model_v4 deleted 0.9324 8 96

Feature Viewer

pLDDT pTM Quality
93.61 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map