F471247
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 635 | 240 | 635 | 98 |
Family's Representative Sequence
| Representative Sequence | 3300006844|Ga0075428_100133868|Ga0075428_1001338683 |
| Length | 103 |
| Sequence | VATFILKRDNLKLGLILGLFGPFLGLVFVYLFSSNYRSLTFFEFVDFFFHDNRLITSIGALCLLANAVLFTFYINTHRDKTAKGIFATTLVYGIAILVLKIFN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 5 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 65 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 70 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 71 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 72 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 73 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 150 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 154 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 155 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 156 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 157 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 158 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 159 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 160 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 161 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 162 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 163 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 164 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 165 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 166 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 167 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 168 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 169 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 170 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 171 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 172 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 173 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 174 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 175 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 176 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 177 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 178 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 205 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 206 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 207 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 208 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 209 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 210 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 211 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 212 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 233 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.79 |
| Nodule | 0 |
| Rhizoplane | 2.36 |
| Rhizosphere | 96.06 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.79 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_1278685 | 2162886011 | Bacteria | 2203 |
| 2 | MBSR1b_contig_4982930 | 2162886012 | Unclassified | 1238 |
| 3 | JGI24743J22301_10048807 | 3300001991 | Bacteria | 860 |
| 4 | JGI24744J21845_10014200 | 3300002077 | Bacteria | 1601 |
| 5 | JGI24742J22300_10077530 | 3300002244 | Bacteria | 625 |
| 6 | rootL2_10213118 | 3300003322 | Bacteria | 4766 |
| 7 | Ga0065714_10204137 | 3300005288 | Bacteria | 886 |
| 8 | Ga0065712_10009117 | 3300005290 | Bacteria | 3822 |
| 9 | Ga0065712_10053336 | 3300005290 | Unclassified | 691 |
| 10 | Ga0065712_10092996 | 3300005290 | Bacteria | 2308 |
| 11 | Ga0065712_10426193 | 3300005290 | Bacteria | 700 |
| 12 | Ga0065715_10125870 | 3300005293 | Bacteria | 2121 |
| 13 | Ga0065715_10595162 | 3300005293 | Unclassified | 711 |
| 14 | Ga0065707_10007663 | 3300005295 | Unclassified | 2942 |
| 15 | Ga0070658_10002266 | 3300005327 | Bacteria | 16152 |
| 16 | Ga0070676_10000458 | 3300005328 | Bacteria | 19490 |
| 17 | Ga0070676_10003200 | 3300005328 | Bacteria | 8493 |
| 18 | Ga0070683_101944403 | 3300005329 | Unclassified | 565 |
| 19 | Ga0070690_100044227 | 3300005330 | Bacteria | 2826 |
| 20 | Ga0070690_100465837 | 3300005330 | Unclassified | 940 |
| 21 | Ga0070670_100050349 | 3300005331 | Bacteria | 3579 |
| 22 | Ga0070670_100080535 | 3300005331 | Bacteria | 2799 |
| 23 | Ga0070670_100099508 | 3300005331 | Bacteria | 2502 |
| 24 | Ga0070670_100318657 | 3300005331 | Bacteria | 1362 |
| 25 | Ga0070670_100438223 | 3300005331 | Unclassified | 1157 |
| 26 | Ga0070670_100786966 | 3300005331 | Unclassified | 858 |
| 27 | Ga0070677_10013498 | 3300005333 | Bacteria | 2859 |
| 28 | Ga0070677_10285123 | 3300005333 | Bacteria | 833 |
| 29 | Ga0070677_10507306 | 3300005333 | Bacteria | 655 |
| 30 | Ga0070677_10879097 | 3300005333 | Bacteria | 517 |
| 31 | Ga0068869_100011037 | 3300005334 | Bacteria | 5917 |
| 32 | Ga0068869_100032741 | 3300005334 | Bacteria | 3665 |
| 33 | Ga0068869_100045035 | 3300005334 | Unclassified | 3175 |
| 34 | Ga0068869_100172105 | 3300005334 | Bacteria | 1692 |
| 35 | Ga0068869_100338759 | 3300005334 | Bacteria | 1223 |
| 36 | Ga0068869_100463182 | 3300005334 | Bacteria | 1053 |
| 37 | Ga0068869_100820240 | 3300005334 | Bacteria | 801 |
| 38 | Ga0070666_10035829 | 3300005335 | Bacteria | 3290 |
| 39 | Ga0070666_10053243 | 3300005335 | Bacteria | 2729 |
| 40 | Ga0070666_10278456 | 3300005335 | Bacteria | 1189 |
| 41 | Ga0070682_100195368 | 3300005337 | Bacteria | 1424 |
| 42 | Ga0068868_100000493 | 3300005338 | Bacteria | 26280 |
| 43 | Ga0068868_100016265 | 3300005338 | Bacteria | 5520 |
| 44 | Ga0068868_100243133 | 3300005338 | Bacteria | 1513 |
| 45 | Ga0068868_100506649 | 3300005338 | Bacteria | 1058 |
| 46 | Ga0068868_101777251 | 3300005338 | Unclassified | 582 |
| 47 | Ga0070689_100052227 | 3300005340 | Unclassified | 3161 |
| 48 | Ga0070689_100935374 | 3300005340 | Bacteria | 768 |
| 49 | Ga0070689_101143030 | 3300005340 | Bacteria | 697 |
| 50 | Ga0070687_100048101 | 3300005343 | Bacteria | 2191 |
| 51 | Ga0070687_100505186 | 3300005343 | Bacteria | 814 |
| 52 | Ga0070687_100521384 | 3300005343 | Unclassified | 803 |
| 53 | Ga0070661_101193586 | 3300005344 | Bacteria | 636 |
| 54 | Ga0070692_10341604 | 3300005345 | Bacteria | 927 |
| 55 | Ga0070668_100000154 | 3300005347 | Bacteria | 43788 |
| 56 | Ga0070668_100035316 | 3300005347 | Bacteria | 3812 |
| 57 | Ga0070668_100221798 | 3300005347 | Bacteria | 1560 |
| 58 | Ga0070668_100404316 | 3300005347 | Bacteria | 1166 |
| 59 | Ga0070668_100861682 | 3300005347 | Unclassified | 808 |
| 60 | Ga0070668_101800123 | 3300005347 | Bacteria | 563 |
| 61 | Ga0070669_100003025 | 3300005353 | Bacteria | 12090 |
| 62 | Ga0070669_100006016 | 3300005353 | Bacteria | 8750 |
| 63 | Ga0070669_100214312 | 3300005353 | Bacteria | 1520 |
| 64 | Ga0070669_100769731 | 3300005353 | Bacteria | 816 |
| 65 | Ga0070669_101597342 | 3300005353 | Bacteria | 568 |
| 66 | Ga0070675_100005755 | 3300005354 | Bacteria | 9482 |
| 67 | Ga0070675_100080415 | 3300005354 | Bacteria | 2716 |
| 68 | Ga0070675_101603116 | 3300005354 | Bacteria | 600 |
| 69 | Ga0070671_100017163 | 3300005355 | Bacteria | 5859 |
| 70 | Ga0070671_100843408 | 3300005355 | Bacteria | 799 |
| 71 | Ga0070674_100122880 | 3300005356 | Bacteria | 1924 |
| 72 | Ga0070674_100413658 | 3300005356 | Bacteria | 1105 |
| 73 | Ga0070674_101063817 | 3300005356 | Bacteria | 713 |
| 74 | Ga0070674_101229134 | 3300005356 | Unclassified | 666 |
| 75 | Ga0070673_100001017 | 3300005364 | Bacteria | 15874 |
| 76 | Ga0070673_100020510 | 3300005364 | Bacteria | 4768 |
| 77 | Ga0070673_100030274 | 3300005364 | Bacteria | 4047 |
| 78 | Ga0070673_100046319 | 3300005364 | Bacteria | 3377 |
| 79 | Ga0070673_101516161 | 3300005364 | Bacteria | 632 |
| 80 | Ga0070688_100023656 | 3300005365 | Unclassified | 3616 |
| 81 | Ga0070688_100053524 | 3300005365 | Bacteria | 2525 |
| 82 | Ga0070688_100354789 | 3300005365 | Bacteria | 1074 |
| 83 | Ga0070688_100619284 | 3300005365 | Bacteria | 830 |
| 84 | Ga0070667_100001203 | 3300005367 | Bacteria | 23556 |
| 85 | Ga0070667_100128225 | 3300005367 | Bacteria | 2212 |
| 86 | Ga0070667_100227853 | 3300005367 | Bacteria | 1661 |
| 87 | Ga0070667_100242765 | 3300005367 | Bacteria | 1609 |
| 88 | Ga0070667_100303957 | 3300005367 | Bacteria | 1437 |
| 89 | Ga0070667_100771627 | 3300005367 | Bacteria | 892 |
| 90 | Ga0070667_101434151 | 3300005367 | Bacteria | 648 |
| 91 | Ga0070705_100899648 | 3300005440 | Bacteria | 712 |
| 92 | Ga0070700_100068909 | 3300005441 | Bacteria | 2251 |
| 93 | Ga0070700_100185339 | 3300005441 | Bacteria | 1451 |
| 94 | Ga0070700_100211890 | 3300005441 | Bacteria | 1367 |
| 95 | Ga0070700_100885706 | 3300005441 | Bacteria | 726 |
| 96 | Ga0070663_100149260 | 3300005455 | Unclassified | 1791 |
| 97 | Ga0070663_100366089 | 3300005455 | Bacteria | 1170 |
| 98 | Ga0070678_100027407 | 3300005456 | Unclassified | 3868 |
| 99 | Ga0070678_100145245 | 3300005456 | Bacteria | 1903 |
| 100 | Ga0070678_101633003 | 3300005456 | Bacteria | 606 |
| 101 | Ga0070662_100004216 | 3300005457 | Bacteria | 9057 |
| 102 | Ga0070662_100010256 | 3300005457 | Bacteria | 6142 |
| 103 | Ga0070662_100168155 | 3300005457 | Bacteria | 1720 |
| 104 | Ga0068867_100001830 | 3300005459 | Bacteria | 14826 |
| 105 | Ga0068867_100105504 | 3300005459 | Bacteria | 2158 |
| 106 | Ga0068867_100111234 | 3300005459 | Bacteria | 2104 |
| 107 | Ga0068867_100587030 | 3300005459 | Bacteria | 970 |
| 108 | Ga0070685_10081682 | 3300005466 | Bacteria | 1938 |
| 109 | Ga0070685_11325362 | 3300005466 | Unclassified | 550 |
| 110 | Ga0070698_100002094 | 3300005471 | Bacteria | 22141 |
| 111 | Ga0070698_100006624 | 3300005471 | Bacteria | 12560 |
| 112 | Ga0068853_100014617 | 3300005539 | Bacteria | 6438 |
| 113 | Ga0068853_100049869 | 3300005539 | Unclassified | 3599 |
| 114 | Ga0068853_100052295 | 3300005539 | Bacteria | 3519 |
| 115 | Ga0068853_102071117 | 3300005539 | Bacteria | 552 |
| 116 | Ga0070672_100000048 | 3300005543 | Bacteria | 52547 |
| 117 | Ga0070672_100008700 | 3300005543 | Bacteria | 6963 |
| 118 | Ga0070672_100330345 | 3300005543 | Bacteria | 1297 |
| 119 | Ga0070672_101690240 | 3300005543 | Bacteria | 568 |
| 120 | Ga0070686_100361545 | 3300005544 | Unclassified | 1093 |
| 121 | Ga0070693_101082102 | 3300005547 | Bacteria | 610 |
| 122 | Ga0070665_100003379 | 3300005548 | Bacteria | 17072 |
| 123 | Ga0070665_100071165 | 3300005548 | Bacteria | 3484 |
| 124 | Ga0070665_101258312 | 3300005548 | Unclassified | 750 |
| 125 | Ga0068855_100095276 | 3300005563 | Unclassified | 3431 |
| 126 | Ga0070664_101185467 | 3300005564 | Bacteria | 720 |
| 127 | Ga0068857_100132871 | 3300005577 | Bacteria | 2245 |
| 128 | Ga0068857_100382856 | 3300005577 | Bacteria | 1307 |
| 129 | Ga0068857_100586298 | 3300005577 | Bacteria | 1053 |
| 130 | Ga0068854_100717046 | 3300005578 | Bacteria | 865 |
| 131 | Ga0068856_101424176 | 3300005614 | Unclassified | 707 |
| 132 | Ga0068852_100105336 | 3300005616 | Unclassified | 2555 |
| 133 | Ga0068852_100781872 | 3300005616 | Bacteria | 968 |
| 134 | Ga0068852_101406589 | 3300005616 | Unclassified | 720 |
| 135 | Ga0068859_100007565 | 3300005617 | Bacteria | 11034 |
| 136 | Ga0068859_100027468 | 3300005617 | Bacteria | 5707 |
| 137 | Ga0068859_100205833 | 3300005617 | Unclassified | 2053 |
| 138 | Ga0068859_100432566 | 3300005617 | Bacteria | 1412 |
| 139 | Ga0068859_100514640 | 3300005617 | Unclassified | 1292 |
| 140 | Ga0068859_100802538 | 3300005617 | Bacteria | 1029 |
| 141 | Ga0068859_100962911 | 3300005617 | Bacteria | 936 |
| 142 | Ga0068859_101032159 | 3300005617 | Bacteria | 903 |
| 143 | Ga0068864_100026182 | 3300005618 | Unclassified | 4917 |
| 144 | Ga0068864_100079101 | 3300005618 | Unclassified | 2878 |
| 145 | Ga0068864_100328351 | 3300005618 | Bacteria | 1438 |
| 146 | Ga0068864_101115940 | 3300005618 | Bacteria | 785 |
| 147 | Ga0068864_101872215 | 3300005618 | Bacteria | 605 |
| 148 | Ga0068866_10061456 | 3300005718 | Bacteria | 1951 |
| 149 | Ga0068866_10172262 | 3300005718 | Bacteria | 1271 |
| 150 | Ga0068866_10491455 | 3300005718 | Bacteria | 810 |
| 151 | Ga0068861_100008514 | 3300005719 | Bacteria | 7062 |
| 152 | Ga0068861_100013356 | 3300005719 | Bacteria | 5747 |
| 153 | Ga0068861_100031759 | 3300005719 | Bacteria | 3882 |
| 154 | Ga0068861_100055850 | 3300005719 | Bacteria | 3012 |
| 155 | Ga0068861_100139662 | 3300005719 | Unclassified | 1976 |
| 156 | Ga0068861_100584343 | 3300005719 | Bacteria | 1023 |
| 157 | Ga0068861_101402953 | 3300005719 | Unclassified | 682 |
| 158 | Ga0068861_101709345 | 3300005719 | Bacteria | 622 |
| 159 | Ga0068861_102049644 | 3300005719 | Bacteria | 571 |
| 160 | Ga0068851_10004047 | 3300005834 | Bacteria | 6581 |
| 161 | Ga0068870_10002573 | 3300005840 | Bacteria | 7587 |
| 162 | Ga0068870_10002679 | 3300005840 | Bacteria | 7457 |
| 163 | Ga0068870_10214484 | 3300005840 | Unclassified | 1174 |
| 164 | Ga0068870_11143518 | 3300005840 | Bacteria | 561 |
| 165 | Ga0068863_100005521 | 3300005841 | Bacteria | 12439 |
| 166 | Ga0068863_100033403 | 3300005841 | Bacteria | 4901 |
| 167 | Ga0068863_100095798 | 3300005841 | Bacteria | 2817 |
| 168 | Ga0068863_100269041 | 3300005841 | Bacteria | 1649 |
| 169 | Ga0068863_100325905 | 3300005841 | Bacteria | 1493 |
| 170 | Ga0068863_100848295 | 3300005841 | Unclassified | 912 |
| 171 | Ga0068858_100001355 | 3300005842 | Bacteria | 25204 |
| 172 | Ga0068858_100913907 | 3300005842 | Bacteria | 858 |
| 173 | Ga0068858_101563734 | 3300005842 | Bacteria | 651 |
| 174 | Ga0068860_100005349 | 3300005843 | Bacteria | 13024 |
| 175 | Ga0068860_100011687 | 3300005843 | Bacteria | 8655 |
| 176 | Ga0068860_100092303 | 3300005843 | Bacteria | 2885 |
| 177 | Ga0068860_100325752 | 3300005843 | Bacteria | 1508 |
| 178 | Ga0068860_100460023 | 3300005843 | Bacteria | 1266 |
| 179 | Ga0068860_100808090 | 3300005843 | Bacteria | 951 |
| 180 | Ga0068862_100050077 | 3300005844 | Bacteria | 3569 |
| 181 | Ga0068862_100166306 | 3300005844 | Bacteria | 1972 |
| 182 | Ga0068862_100294371 | 3300005844 | Bacteria | 1492 |
| 183 | Ga0068862_100906719 | 3300005844 | Bacteria | 867 |
| 184 | Ga0068862_101490526 | 3300005844 | Unclassified | 682 |
| 185 | Ga0068862_102740873 | 3300005844 | Unclassified | 504 |
| 186 | Ga0070715_10158131 | 3300006163 | Bacteria | 1117 |
| 187 | Ga0070715_10243824 | 3300006163 | Unclassified | 936 |
| 188 | Ga0070716_100050453 | 3300006173 | Bacteria | 2362 |
| 189 | Ga0075427_10053032 | 3300006194 | Bacteria | 701 |
| 190 | Ga0075366_10011207 | 3300006195 | Bacteria | 5056 |
| 191 | Ga0097621_100002545 | 3300006237 | Bacteria | 12488 |
| 192 | Ga0097621_100022140 | 3300006237 | Bacteria | 4929 |
| 193 | Ga0097621_100076545 | 3300006237 | Unclassified | 2776 |
| 194 | Ga0097621_100453399 | 3300006237 | Bacteria | 1156 |
| 195 | Ga0097621_101951294 | 3300006237 | Bacteria | 560 |
| 196 | Ga0075370_10487625 | 3300006353 | Unclassified | 743 |
| 197 | Ga0068871_100003156 | 3300006358 | Bacteria | 11319 |
| 198 | Ga0068871_100048716 | 3300006358 | Bacteria | 3422 |
| 199 | Ga0068871_100104372 | 3300006358 | Bacteria | 2377 |
| 200 | Ga0068871_100186135 | 3300006358 | Bacteria | 1787 |
| 201 | Ga0068871_100360679 | 3300006358 | Unclassified | 1287 |
| 202 | Ga0068871_100452626 | 3300006358 | Bacteria | 1151 |
| 203 | Ga0068871_100634297 | 3300006358 | Bacteria | 974 |
| 204 | Ga0075428_100133868 | 3300006844 | Bacteria | 2695 |
| 205 | Ga0075428_100186483 | 3300006844 | Bacteria | 2244 |
| 206 | Ga0075428_100235074 | 3300006844 | Unclassified | 1977 |
| 207 | Ga0075428_102047621 | 3300006844 | Bacteria | 593 |
| 208 | Ga0075430_100003135 | 3300006846 | Bacteria | 13825 |
| 209 | Ga0075430_100044213 | 3300006846 | Bacteria | 3767 |
| 210 | Ga0075431_100202278 | 3300006847 | Bacteria | 2032 |
| 211 | Ga0075431_100345451 | 3300006847 | Bacteria | 1497 |
| 212 | Ga0075431_101490277 | 3300006847 | Bacteria | 635 |
| 213 | Ga0075433_10517232 | 3300006852 | Bacteria | 1050 |
| 214 | Ga0075429_100167295 | 3300006880 | Unclassified | 1926 |
| 215 | Ga0075429_100274449 | 3300006880 | Unclassified | 1476 |
| 216 | Ga0075429_101445106 | 3300006880 | Unclassified | 599 |
| 217 | Ga0068865_100001341 | 3300006881 | Bacteria | 14328 |
| 218 | Ga0068865_100053256 | 3300006881 | Bacteria | 2807 |
| 219 | Ga0068865_100536648 | 3300006881 | Bacteria | 980 |
| 220 | Ga0068865_100811983 | 3300006881 | Bacteria | 808 |
| 221 | Ga0097620_100007565 | 3300006931 | Bacteria | 11034 |
| 222 | Ga0097620_100027468 | 3300006931 | Bacteria | 5707 |
| 223 | Ga0097620_100205847 | 3300006931 | Unclassified | 2053 |
| 224 | Ga0097620_100432560 | 3300006931 | Bacteria | 1412 |
| 225 | Ga0097620_100514666 | 3300006931 | Unclassified | 1292 |
| 226 | Ga0097620_100802620 | 3300006931 | Bacteria | 1029 |
| 227 | Ga0097620_100962838 | 3300006931 | Bacteria | 936 |
| 228 | Ga0097620_101032091 | 3300006931 | Bacteria | 903 |
| 229 | Ga0105240_10066684 | 3300009093 | Unclassified | 4464 |
| 230 | Ga0111539_10023974 | 3300009094 | Bacteria | 7495 |
| 231 | Ga0111539_10399820 | 3300009094 | Bacteria | 1600 |
| 232 | Ga0111539_10519150 | 3300009094 | Bacteria | 1388 |
| 233 | Ga0105245_10070211 | 3300009098 | Unclassified | 3178 |
| 234 | Ga0105245_10447724 | 3300009098 | Bacteria | 1299 |
| 235 | Ga0105245_11160076 | 3300009098 | Bacteria | 820 |
| 236 | Ga0105247_10948164 | 3300009101 | Bacteria | 668 |
| 237 | Ga0114129_10364637 | 3300009147 | Bacteria | 1911 |
| 238 | Ga0114129_11261763 | 3300009147 | Unclassified | 917 |
| 239 | Ga0114129_13086625 | 3300009147 | Bacteria | 545 |
| 240 | Ga0105243_10223480 | 3300009148 | Unclassified | 1666 |
| 241 | Ga0105241_10150429 | 3300009174 | Bacteria | 1904 |
| 242 | Ga0105241_10436437 | 3300009174 | Bacteria | 1156 |
| 243 | Ga0105241_10967330 | 3300009174 | Bacteria | 794 |
| 244 | Ga0105241_12696762 | 3300009174 | Bacteria | 500 |
| 245 | Ga0105242_10025455 | 3300009176 | Bacteria | 4684 |
| 246 | Ga0105242_10068251 | 3300009176 | Bacteria | 2941 |
| 247 | Ga0105242_10553337 | 3300009176 | Bacteria | 1103 |
| 248 | Ga0105242_10635598 | 3300009176 | Bacteria | 1036 |
| 249 | Ga0105242_10945275 | 3300009176 | Bacteria | 865 |
| 250 | Ga0105242_12953651 | 3300009176 | Unclassified | 526 |
| 251 | Ga0105242_13206256 | 3300009176 | Bacteria | 508 |
| 252 | Ga0105248_10128000 | 3300009177 | Bacteria | 2865 |
| 253 | Ga0105248_12780078 | 3300009177 | Bacteria | 558 |
| 254 | Ga0105237_10330937 | 3300009545 | Unclassified | 1527 |
| 255 | Ga0105237_11535979 | 3300009545 | Bacteria | 673 |
| 256 | Ga0105249_10003125 | 3300009553 | Bacteria | 14313 |
| 257 | Ga0105249_10003218 | 3300009553 | Bacteria | 14139 |
| 258 | Ga0105249_10004834 | 3300009553 | Bacteria | 11632 |
| 259 | Ga0105249_10056524 | 3300009553 | Bacteria | 3593 |
| 260 | Ga0105249_10179071 | 3300009553 | Bacteria | 2061 |
| 261 | Ga0105249_10243512 | 3300009553 | Unclassified | 1779 |
| 262 | Ga0105249_10316937 | 3300009553 | Unclassified | 1570 |
| 263 | Ga0105249_10446226 | 3300009553 | Bacteria | 1332 |
| 264 | Ga0105249_10891508 | 3300009553 | Bacteria | 956 |
| 265 | Ga0105249_11684389 | 3300009553 | Bacteria | 707 |
| 266 | Ga0105249_11734010 | 3300009553 | Bacteria | 697 |
| 267 | Ga0105249_12244194 | 3300009553 | Bacteria | 619 |
| 268 | Ga0105239_10288495 | 3300010375 | Bacteria | 1848 |
| 269 | Ga0105239_10637411 | 3300010375 | Unclassified | 1217 |
| 270 | Ga0105246_10009910 | 3300011119 | Bacteria | 5877 |
| 271 | Ga0105246_10203726 | 3300011119 | Bacteria | 1540 |
| 272 | Ga0105246_10467507 | 3300011119 | Unclassified | 1064 |
| 273 | Ga0105246_10845059 | 3300011119 | Bacteria | 816 |
| 274 | Ga0157370_10017114 | 3300013104 | Bacteria | 7320 |
| 275 | Ga0157370_10017652 | 3300013104 | Bacteria | 7193 |
| 276 | Ga0157370_11300313 | 3300013104 | Unclassified | 655 |
| 277 | Ga0157369_11660651 | 3300013105 | Unclassified | 649 |
| 278 | Ga0157369_12222305 | 3300013105 | Bacteria | 556 |
| 279 | Ga0157374_10000314 | 3300013296 | Bacteria | 44972 |
| 280 | Ga0157374_10100813 | 3300013296 | Bacteria | 2768 |
| 281 | Ga0157374_10479636 | 3300013296 | Bacteria | 1247 |
| 282 | Ga0157374_10514754 | 3300013296 | Bacteria | 1202 |
| 283 | Ga0157378_10001556 | 3300013297 | Bacteria | 20709 |
| 284 | Ga0157378_10492247 | 3300013297 | Unclassified | 1223 |
| 285 | Ga0157378_11079495 | 3300013297 | Bacteria | 839 |
| 286 | Ga0157378_11287322 | 3300013297 | Bacteria | 772 |
| 287 | Ga0163162_10000224 | 3300013306 | Bacteria | 51849 |
| 288 | Ga0163162_10000231 | 3300013306 | Bacteria | 51138 |
| 289 | Ga0163162_10000318 | 3300013306 | Bacteria | 44343 |
| 290 | Ga0163162_10002781 | 3300013306 | Bacteria | 16627 |
| 291 | Ga0163162_10009899 | 3300013306 | Bacteria | 9271 |
| 292 | Ga0163162_10055575 | 3300013306 | Bacteria | 3986 |
| 293 | Ga0163162_10062519 | 3300013306 | Bacteria | 3763 |
| 294 | Ga0163162_10109079 | 3300013306 | Bacteria | 2865 |
| 295 | Ga0163162_10250702 | 3300013306 | Bacteria | 1902 |
| 296 | Ga0163162_10251650 | 3300013306 | Bacteria | 1899 |
| 297 | Ga0163162_10326309 | 3300013306 | Bacteria | 1667 |
| 298 | Ga0163162_10783451 | 3300013306 | Bacteria | 1072 |
| 299 | Ga0157372_10136366 | 3300013307 | Unclassified | 2826 |
| 300 | Ga0157372_11483281 | 3300013307 | Unclassified | 781 |
| 301 | Ga0157375_10000073 | 3300013308 | Bacteria | 105972 |
| 302 | Ga0157375_10000272 | 3300013308 | Bacteria | 46932 |
| 303 | Ga0157375_10021346 | 3300013308 | Bacteria | 5935 |
| 304 | Ga0157375_10098056 | 3300013308 | Bacteria | 3007 |
| 305 | Ga0157375_10606785 | 3300013308 | Bacteria | 1253 |
| 306 | Ga0157375_10706277 | 3300013308 | Bacteria | 1162 |
| 307 | Ga0157375_11537787 | 3300013308 | Bacteria | 786 |
| 308 | Ga0157375_11601731 | 3300013308 | Unclassified | 770 |
| 309 | Ga0157375_11923004 | 3300013308 | Unclassified | 702 |
| 310 | Ga0157375_12490430 | 3300013308 | Bacteria | 618 |
| 311 | Ga0157375_13048253 | 3300013308 | Unclassified | 559 |
| 312 | Ga0163163_10000129 | 3300014325 | Bacteria | 77897 |
| 313 | Ga0163163_10000347 | 3300014325 | Bacteria | 44548 |
| 314 | Ga0163163_10435822 | 3300014325 | Bacteria | 1370 |
| 315 | Ga0163163_10728490 | 3300014325 | Bacteria | 1055 |
| 316 | Ga0163163_10736684 | 3300014325 | Bacteria | 1049 |
| 317 | Ga0163163_10880387 | 3300014325 | Bacteria | 959 |
| 318 | Ga0163163_12289764 | 3300014325 | Unclassified | 599 |
| 319 | Ga0157380_10013692 | 3300014326 | Bacteria | 5921 |
| 320 | Ga0157380_10590765 | 3300014326 | Bacteria | 1097 |
| 321 | Ga0157380_11722044 | 3300014326 | Unclassified | 685 |
| 322 | Ga0157377_10002157 | 3300014745 | Bacteria | 8642 |
| 323 | Ga0157377_10061358 | 3300014745 | Bacteria | 2148 |
| 324 | Ga0157377_10135847 | 3300014745 | Bacteria | 1507 |
| 325 | Ga0157377_11002983 | 3300014745 | Bacteria | 632 |
| 326 | Ga0157377_11230127 | 3300014745 | Unclassified | 581 |
| 327 | Ga0157379_10000120 | 3300014968 | Bacteria | 54605 |
| 328 | Ga0157379_10380397 | 3300014968 | Bacteria | 1295 |
| 329 | Ga0157379_10632225 | 3300014968 | Bacteria | 1001 |
| 330 | Ga0157379_10828694 | 3300014968 | Unclassified | 874 |
| 331 | Ga0157379_10897515 | 3300014968 | Bacteria | 841 |
| 332 | Ga0157379_11372497 | 3300014968 | Unclassified | 684 |
| 333 | Ga0157379_12043932 | 3300014968 | Bacteria | 567 |
| 334 | Ga0157376_10000271 | 3300014969 | Bacteria | 35219 |
| 335 | Ga0157376_10000774 | 3300014969 | Bacteria | 20877 |
| 336 | Ga0157376_10032084 | 3300014969 | Bacteria | 4214 |
| 337 | Ga0157376_10193197 | 3300014969 | Bacteria | 1868 |
| 338 | Ga0157376_10197202 | 3300014969 | Bacteria | 1850 |
| 339 | Ga0157376_10246399 | 3300014969 | Bacteria | 1667 |
| 340 | Ga0157376_10271107 | 3300014969 | Bacteria | 1594 |
| 341 | Ga0163161_10011166 | 3300017792 | Bacteria | 6223 |
| 342 | Ga0163161_10021878 | 3300017792 | Bacteria | 4497 |
| 343 | Ga0163161_10058069 | 3300017792 | Unclassified | 2812 |
| 344 | Ga0163161_10083144 | 3300017792 | Bacteria | 2359 |
| 345 | Ga0163161_10385984 | 3300017792 | Bacteria | 1120 |
| 346 | Ga0163161_11686295 | 3300017792 | Bacteria | 561 |
| 347 | Ga0163161_11926432 | 3300017792 | Bacteria | 526 |
| 348 | Ga0207697_10009721 | 3300025315 | Bacteria | 4143 |
| 349 | Ga0207656_10002217 | 3300025321 | Bacteria | 6506 |
| 350 | Ga0207656_10074325 | 3300025321 | Bacteria | 1516 |
| 351 | Ga0207682_10087645 | 3300025893 | Bacteria | 1345 |
| 352 | Ga0207682_10461528 | 3300025893 | Unclassified | 601 |
| 353 | Ga0207642_10442005 | 3300025899 | Bacteria | 786 |
| 354 | Ga0207642_10826158 | 3300025899 | Bacteria | 590 |
| 355 | Ga0207688_10135229 | 3300025901 | Bacteria | 1447 |
| 356 | Ga0207680_10000165 | 3300025903 | Bacteria | 32266 |
| 357 | Ga0207680_10042466 | 3300025903 | Bacteria | 2660 |
| 358 | Ga0207680_10133108 | 3300025903 | Bacteria | 1640 |
| 359 | Ga0207647_10051653 | 3300025904 | Unclassified | 2540 |
| 360 | Ga0207647_10357526 | 3300025904 | Bacteria | 826 |
| 361 | Ga0207685_10265341 | 3300025905 | Unclassified | 836 |
| 362 | Ga0207645_10000263 | 3300025907 | Bacteria | 43560 |
| 363 | Ga0207645_10001368 | 3300025907 | Bacteria | 20023 |
| 364 | Ga0207645_10052338 | 3300025907 | Bacteria | 2608 |
| 365 | Ga0207643_10002440 | 3300025908 | Bacteria | 10046 |
| 366 | Ga0207643_10004417 | 3300025908 | Bacteria | 7561 |
| 367 | Ga0207643_10195392 | 3300025908 | Unclassified | 1230 |
| 368 | Ga0207705_10008997 | 3300025909 | Bacteria | 7276 |
| 369 | Ga0207654_10596115 | 3300025911 | Bacteria | 788 |
| 370 | Ga0207662_10094232 | 3300025918 | Bacteria | 1846 |
| 371 | Ga0207662_10401390 | 3300025918 | Bacteria | 930 |
| 372 | Ga0207662_10562837 | 3300025918 | Bacteria | 790 |
| 373 | Ga0207649_11069718 | 3300025920 | Bacteria | 636 |
| 374 | Ga0207681_10042542 | 3300025923 | Bacteria | 3035 |
| 375 | Ga0207681_10047551 | 3300025923 | Bacteria | 2891 |
| 376 | Ga0207681_10374259 | 3300025923 | Bacteria | 1145 |
| 377 | Ga0207681_10460829 | 3300025923 | Bacteria | 1035 |
| 378 | Ga0207650_10113773 | 3300025925 | Bacteria | 2098 |
| 379 | Ga0207650_10135789 | 3300025925 | Bacteria | 1929 |
| 380 | Ga0207650_10219152 | 3300025925 | Bacteria | 1531 |
| 381 | Ga0207650_10283504 | 3300025925 | Bacteria | 1349 |
| 382 | Ga0207650_11047692 | 3300025925 | Bacteria | 694 |
| 383 | Ga0207659_10044504 | 3300025926 | Bacteria | 3123 |
| 384 | Ga0207659_10143270 | 3300025926 | Bacteria | 1857 |
| 385 | Ga0207659_10554345 | 3300025926 | Bacteria | 977 |
| 386 | Ga0207644_10009824 | 3300025931 | Bacteria | 6294 |
| 387 | Ga0207644_10780109 | 3300025931 | Bacteria | 799 |
| 388 | Ga0207706_10021277 | 3300025933 | Bacteria | 5827 |
| 389 | Ga0207706_10052672 | 3300025933 | Unclassified | 3593 |
| 390 | Ga0207706_10194915 | 3300025933 | Bacteria | 1777 |
| 391 | Ga0207686_10007206 | 3300025934 | Bacteria | 5991 |
| 392 | Ga0207686_10053723 | 3300025934 | Bacteria | 2520 |
| 393 | Ga0207686_10408285 | 3300025934 | Bacteria | 1036 |
| 394 | Ga0207686_11687276 | 3300025934 | Unclassified | 524 |
| 395 | Ga0207686_11852283 | 3300025934 | Bacteria | 500 |
| 396 | Ga0207709_10173575 | 3300025935 | Unclassified | 1515 |
| 397 | Ga0207670_10064208 | 3300025936 | Bacteria | 2516 |
| 398 | Ga0207670_10427255 | 3300025936 | Unclassified | 1064 |
| 399 | Ga0207670_10496736 | 3300025936 | Bacteria | 990 |
| 400 | Ga0207669_10027963 | 3300025937 | Bacteria | 3096 |
| 401 | Ga0207669_10152289 | 3300025937 | Bacteria | 1621 |
| 402 | Ga0207704_10000986 | 3300025938 | Bacteria | 12639 |
| 403 | Ga0207704_10057274 | 3300025938 | Bacteria | 2393 |
| 404 | Ga0207704_10508301 | 3300025938 | Unclassified | 972 |
| 405 | Ga0207704_10777157 | 3300025938 | Bacteria | 798 |
| 406 | Ga0207665_10300867 | 3300025939 | Unclassified | 1199 |
| 407 | Ga0207691_10000245 | 3300025940 | Bacteria | 53608 |
| 408 | Ga0207691_10003243 | 3300025940 | Bacteria | 15850 |
| 409 | Ga0207691_10766138 | 3300025940 | Unclassified | 812 |
| 410 | Ga0207691_10973129 | 3300025940 | Bacteria | 709 |
| 411 | Ga0207691_11443784 | 3300025940 | Bacteria | 564 |
| 412 | Ga0207711_10144727 | 3300025941 | Unclassified | 2141 |
| 413 | Ga0207689_10007704 | 3300025942 | Bacteria | 9423 |
| 414 | Ga0207689_10018354 | 3300025942 | Bacteria | 5903 |
| 415 | Ga0207689_10034355 | 3300025942 | Unclassified | 4212 |
| 416 | Ga0207689_10110922 | 3300025942 | Bacteria | 2254 |
| 417 | Ga0207689_10350872 | 3300025942 | Bacteria | 1226 |
| 418 | Ga0207689_10491444 | 3300025942 | Bacteria | 1028 |
| 419 | Ga0207679_11781498 | 3300025945 | Bacteria | 563 |
| 420 | Ga0207667_10088148 | 3300025949 | Unclassified | 3210 |
| 421 | Ga0207651_10009691 | 3300025960 | Bacteria | 5293 |
| 422 | Ga0207651_10133394 | 3300025960 | Bacteria | 1905 |
| 423 | Ga0207651_10230096 | 3300025960 | Bacteria | 1504 |
| 424 | Ga0207651_10392678 | 3300025960 | Bacteria | 1178 |
| 425 | Ga0207651_10582341 | 3300025960 | Bacteria | 976 |
| 426 | Ga0207651_10870530 | 3300025960 | Unclassified | 801 |
| 427 | Ga0207651_10896550 | 3300025960 | Bacteria | 790 |
| 428 | Ga0207651_11045601 | 3300025960 | Bacteria | 731 |
| 429 | Ga0207712_10001366 | 3300025961 | Bacteria | 16706 |
| 430 | Ga0207712_10023399 | 3300025961 | Bacteria | 4076 |
| 431 | Ga0207712_10053484 | 3300025961 | Bacteria | 2833 |
| 432 | Ga0207712_10053502 | 3300025961 | Unclassified | 2832 |
| 433 | Ga0207712_10358221 | 3300025961 | Bacteria | 1215 |
| 434 | Ga0207712_10768054 | 3300025961 | Bacteria | 845 |
| 435 | Ga0207712_11211046 | 3300025961 | Unclassified | 674 |
| 436 | Ga0207668_10000184 | 3300025972 | Bacteria | 42493 |
| 437 | Ga0207668_10031257 | 3300025972 | Bacteria | 3505 |
| 438 | Ga0207668_10175479 | 3300025972 | Bacteria | 1685 |
| 439 | Ga0207668_10207582 | 3300025972 | Bacteria | 1564 |
| 440 | Ga0207668_11452968 | 3300025972 | Bacteria | 618 |
| 441 | Ga0207640_11027713 | 3300025981 | Unclassified | 726 |
| 442 | Ga0207658_10000452 | 3300025986 | Bacteria | 38428 |
| 443 | Ga0207658_10051664 | 3300025986 | Bacteria | 3030 |
| 444 | Ga0207658_10080711 | 3300025986 | Bacteria | 2492 |
| 445 | Ga0207658_10277636 | 3300025986 | Bacteria | 1435 |
| 446 | Ga0207658_10676452 | 3300025986 | Bacteria | 931 |
| 447 | Ga0207677_10007781 | 3300026023 | Bacteria | 5949 |
| 448 | Ga0207677_10044534 | 3300026023 | Bacteria | 2957 |
| 449 | Ga0207677_11032246 | 3300026023 | Unclassified | 747 |
| 450 | Ga0207677_11146253 | 3300026023 | Bacteria | 710 |
| 451 | Ga0207703_10000388 | 3300026035 | Bacteria | 47169 |
| 452 | Ga0207703_10184958 | 3300026035 | Unclassified | 1841 |
| 453 | Ga0207703_11301785 | 3300026035 | Bacteria | 699 |
| 454 | Ga0207703_11842410 | 3300026035 | Bacteria | 581 |
| 455 | Ga0207639_10010418 | 3300026041 | Bacteria | 6438 |
| 456 | Ga0207639_10037498 | 3300026041 | Unclassified | 3600 |
| 457 | Ga0207639_10128442 | 3300026041 | Bacteria | 2094 |
| 458 | Ga0207639_12053487 | 3300026041 | Unclassified | 533 |
| 459 | Ga0207678_10133009 | 3300026067 | Unclassified | 2122 |
| 460 | Ga0207678_10255098 | 3300026067 | Bacteria | 1503 |
| 461 | Ga0207708_10058594 | 3300026075 | Bacteria | 2938 |
| 462 | Ga0207708_10219354 | 3300026075 | Bacteria | 1523 |
| 463 | Ga0207708_10750224 | 3300026075 | Bacteria | 838 |
| 464 | Ga0207708_11005798 | 3300026075 | Bacteria | 724 |
| 465 | Ga0207641_10001405 | 3300026088 | Bacteria | 23727 |
| 466 | Ga0207641_10002172 | 3300026088 | Bacteria | 18470 |
| 467 | Ga0207641_10082161 | 3300026088 | Bacteria | 2799 |
| 468 | Ga0207641_10299891 | 3300026088 | Bacteria | 1517 |
| 469 | Ga0207641_11326362 | 3300026088 | Bacteria | 720 |
| 470 | Ga0207641_12037396 | 3300026088 | Bacteria | 575 |
| 471 | Ga0207648_10002644 | 3300026089 | Bacteria | 19132 |
| 472 | Ga0207648_10004150 | 3300026089 | Bacteria | 14988 |
| 473 | Ga0207648_10076562 | 3300026089 | Unclassified | 2916 |
| 474 | Ga0207648_10139450 | 3300026089 | Bacteria | 2137 |
| 475 | Ga0207648_10244327 | 3300026089 | Bacteria | 1599 |
| 476 | Ga0207676_10011439 | 3300026095 | Bacteria | 6342 |
| 477 | Ga0207676_10604333 | 3300026095 | Unclassified | 1054 |
| 478 | Ga0207676_10690287 | 3300026095 | Bacteria | 988 |
| 479 | Ga0207676_11003068 | 3300026095 | Bacteria | 823 |
| 480 | Ga0207674_10001856 | 3300026116 | Bacteria | 26902 |
| 481 | Ga0207674_10053595 | 3300026116 | Bacteria | 4110 |
| 482 | Ga0207674_10386839 | 3300026116 | Bacteria | 1352 |
| 483 | Ga0207674_10624581 | 3300026116 | Bacteria | 1040 |
| 484 | Ga0207674_10902001 | 3300026116 | Bacteria | 852 |
| 485 | Ga0207675_100003498 | 3300026118 | Bacteria | 15327 |
| 486 | Ga0207675_100006997 | 3300026118 | Bacteria | 10670 |
| 487 | Ga0207675_100010293 | 3300026118 | Bacteria | 8762 |
| 488 | Ga0207675_100011111 | 3300026118 | Bacteria | 8436 |
| 489 | Ga0207675_100053310 | 3300026118 | Bacteria | 3774 |
| 490 | Ga0207675_100136537 | 3300026118 | Bacteria | 2327 |
| 491 | Ga0207675_100252475 | 3300026118 | Unclassified | 1707 |
| 492 | Ga0207675_100891835 | 3300026118 | Bacteria | 905 |
| 493 | Ga0207683_10000943 | 3300026121 | Bacteria | 26669 |
| 494 | Ga0207683_10232413 | 3300026121 | Bacteria | 1682 |
| 495 | Ga0207683_10314792 | 3300026121 | Bacteria | 1433 |
| 496 | Ga0207683_10614457 | 3300026121 | Unclassified | 1006 |
| 497 | Ga0207683_10650508 | 3300026121 | Bacteria | 976 |
| 498 | Ga0207698_10084616 | 3300026142 | Unclassified | 2572 |
| 499 | Ga0207698_10784324 | 3300026142 | Bacteria | 954 |
| 500 | Ga0207698_12609638 | 3300026142 | Bacteria | 515 |
| 501 | Ga0207428_10028282 | 3300027907 | Unclassified | 4659 |
| 502 | Ga0268266_10000928 | 3300028379 | Bacteria | 37520 |
| 503 | Ga0268266_10262957 | 3300028379 | Bacteria | 1599 |
| 504 | Ga0268266_10408629 | 3300028379 | Bacteria | 1285 |
| 505 | Ga0268266_10857449 | 3300028379 | Bacteria | 878 |
| 506 | Ga0268265_10360472 | 3300028380 | Bacteria | 1331 |
| 507 | Ga0268265_10578627 | 3300028380 | Bacteria | 1070 |
| 508 | Ga0268265_10955553 | 3300028380 | Unclassified | 844 |
| 509 | Ga0268265_11085868 | 3300028380 | Bacteria | 794 |
| 510 | Ga0268265_11090925 | 3300028380 | Bacteria | 792 |
| 511 | Ga0268265_11139810 | 3300028380 | Bacteria | 775 |
| 512 | Ga0268265_11568668 | 3300028380 | Bacteria | 663 |
| 513 | Ga0268264_10001859 | 3300028381 | Bacteria | 19198 |
| 514 | Ga0268264_10039112 | 3300028381 | Unclassified | 3919 |
| 515 | Ga0268264_10077792 | 3300028381 | Unclassified | 2826 |
| 516 | Ga0268264_10198139 | 3300028381 | Bacteria | 1835 |
| 517 | Ga0268264_11345710 | 3300028381 | Bacteria | 724 |
| 518 | Ga0307515_10000002 | 3300028794 | Bacteria | 1231751 |
| 519 | Ga0307515_10631097 | 3300028794 | Bacteria | 683 |
| 520 | Ga0307408_101513119 | 3300031548 | Bacteria | 635 |
| 521 | Ga0307516_10306853 | 3300031730 | Bacteria | 1261 |
| 522 | Ga0307413_11326757 | 3300031824 | Bacteria | 630 |
| 523 | Ga0307407_10681062 | 3300031903 | Unclassified | 773 |
| 524 | Ga0307416_100989056 | 3300032002 | Bacteria | 944 |
| 525 | Ga0307416_103714075 | 3300032002 | Bacteria | 511 |
| 526 | Ga0307415_101721566 | 3300032126 | Bacteria | 605 |
| 527 | Ga0373936_0239539 | 3300035113 | Bacteria | 808 |
| 528 | Ga0373957_0238696 | 3300035120 | Bacteria | 763 |
| 529 | Ga0373943_0465097 | 3300035170 | Bacteria | 736 |
| 530 | Ga0373955_0604520 | 3300035172 | Unclassified | 672 |
| 531 | Ga0373933_0836023 | 3300035724 | Unclassified | 606 |
| 532 | Ga0373937_0157412 | 3300036401 | Bacteria | 2130 |
| 533 | Ga0373937_0288355 | 3300036401 | Unclassified | 1551 |
| 534 | Ga0373937_0543129 | 3300036401 | Bacteria | 1104 |
| 535 | Ga0373937_1527002 | 3300036401 | Unclassified | 615 |
| 536 | Ga0436365_0869194 | 3300039437 | Unclassified | 565 |
| 537 | Ga0451791_0582350 | 3300041451 | Bacteria | 638 |
| 538 | Ga0451798_1046411 | 3300041458 | Unclassified | 1248 |
| 539 | Ga0451800_0180239 | 3300041459 | Bacteria | 638 |
| 540 | Ga0451807_0115588 | 3300041486 | Bacteria | 527 |
| 541 | Ga0439441_020574 | 3300042001 | Bacteria | 1210 |
| 542 | Ga0450923_019270 | 3300042125 | Bacteria | 1313 |
| 543 | Ga0439444_0050134 | 3300042437 | Bacteria | 846 |
| 544 | Ga0439464_0178557 | 3300042439 | Unclassified | 672 |
| 545 | Ga0450918_067729 | 3300042531 | Unclassified | 667 |
| 546 | Ga0451577_1420388 | 3300042876 | Unclassified | 615 |
| 547 | Ga0466970_0719545 | 3300044765 | Unclassified | 583 |
| 548 | Ga0495629_0126232 | 3300046459 | Unclassified | 1782 |
| 549 | Ga0495650_0076336 | 3300046471 | Bacteria | 1302 |
| 550 | Ga0495580_1015429 | 3300046472 | Unclassified | 528 |
| 551 | Ga0495662_0029821 | 3300046476 | Bacteria | 2633 |
| 552 | Ga0495594_0165482 | 3300046499 | Bacteria | 1258 |
| 553 | Ga0495630_0020530 | 3300046517 | Bacteria | 4871 |
| 554 | Ga0495630_0035779 | 3300046517 | Bacteria | 3711 |
| 555 | Ga0495665_0040252 | 3300046531 | Bacteria | 2489 |
| 556 | Ga0495586_0449538 | 3300046535 | Bacteria | 743 |
| 557 | Ga0495587_0196346 | 3300046536 | Bacteria | 1142 |
| 558 | Ga0495645_0081049 | 3300046543 | Unclassified | 2329 |
| 559 | Ga0495645_0528240 | 3300046543 | Bacteria | 734 |
| 560 | Ga0495667_0738787 | 3300046559 | Unclassified | 609 |
| 561 | Ga0495635_0414322 | 3300046663 | Unclassified | 894 |
| 562 | Ga0495647_0074203 | 3300046681 | Unclassified | 1367 |
| 563 | Ga0495658_0338468 | 3300046683 | Bacteria | 955 |
| 564 | Ga0495669_0459106 | 3300046684 | Bacteria | 619 |
| 565 | Ga0495613_0156689 | 3300046689 | Unclassified | 1622 |
| 566 | Ga0495624_0157733 | 3300046690 | Unclassified | 1387 |
| 567 | Ga0495624_0386278 | 3300046690 | Unclassified | 841 |
| 568 | Ga0495600_0608583 | 3300046809 | Bacteria | 663 |
| 569 | Ga0495604_0759893 | 3300047317 | Unclassified | 613 |
| 570 | Ga0495674_0540664 | 3300047319 | Bacteria | 928 |
| 571 | Ga0495672_0012712 | 3300047320 | Bacteria | 5854 |
| 572 | Ga0495672_0046640 | 3300047320 | Bacteria | 2583 |
| 573 | Ga0495672_0056973 | 3300047320 | Bacteria | 2271 |
| 574 | Ga0495680_0752664 | 3300047322 | Unclassified | 640 |
| 575 | Ga0495675_0283314 | 3300047444 | Bacteria | 988 |
| 576 | Ga0495684_0350016 | 3300047471 | Unclassified | 1049 |
| 577 | Ga0495686_0014005 | 3300047472 | Bacteria | 5542 |
| 578 | Ga0495686_0016543 | 3300047472 | Bacteria | 5000 |
| 579 | Ga0495602_0698058 | 3300048088 | Bacteria | 689 |
| 580 | Ga0496101_1296933 | 3300048904 | Bacteria | 569 |
| 581 | Ga0496102_0152912 | 3300048905 | Bacteria | 2169 |
| 582 | Ga0496104_0837146 | 3300048907 | Bacteria | 826 |
| 583 | Ga0496104_0856706 | 3300048907 | Bacteria | 814 |
| 584 | Ga0496104_0968950 | 3300048907 | Unclassified | 755 |
| 585 | Ga0496105_0440087 | 3300048908 | Unclassified | 1030 |
| 586 | Ga0496105_1176213 | 3300048908 | Bacteria | 566 |
| 587 | Ga0496107_1116045 | 3300048910 | Bacteria | 569 |
| 588 | Ga0496108_0082978 | 3300048911 | Unclassified | 2718 |
| 589 | Ga0496109_0029361 | 3300048912 | Bacteria | 4925 |
| 590 | Ga0496114_0283711 | 3300048917 | Bacteria | 1460 |
| 591 | Ga0501031_0005392 | 3300049568 | Bacteria | 8326 |
| 592 | Ga0501031_0216466 | 3300049568 | Bacteria | 1248 |
| 593 | Ga0501032_0034263 | 3300049569 | Bacteria | 3477 |
| 594 | Ga0501032_0040483 | 3300049569 | Bacteria | 3168 |
| 595 | Ga0501034_0126078 | 3300049571 | Bacteria | 2545 |
| 596 | Ga0501036_0004749 | 3300049572 | Bacteria | 10968 |
| 597 | Ga0501036_0106987 | 3300049572 | Unclassified | 2365 |
| 598 | Ga0501037_0272204 | 3300049573 | Bacteria | 1181 |
| 599 | Ga0501038_0011074 | 3300049574 | Bacteria | 8235 |
| 600 | Ga0501038_0063668 | 3300049574 | Bacteria | 3147 |
| 601 | Ga0501039_0099538 | 3300049575 | Bacteria | 2269 |
| 602 | Ga0501043_0008703 | 3300049579 | Bacteria | 7986 |
| 603 | Ga0501043_0069093 | 3300049579 | Bacteria | 2774 |
| 604 | Ga0501046_0042558 | 3300049580 | Bacteria | 3621 |
| 605 | Ga0501046_0796391 | 3300049580 | Bacteria | 662 |
| 606 | Ga0501047_0031811 | 3300049581 | Bacteria | 5090 |
| 607 | Ga0501048_0037369 | 3300049582 | Bacteria | 3487 |
| 608 | Ga0501068_0787394 | 3300049584 | Unclassified | 623 |
| 609 | Ga0501070_0586871 | 3300049586 | Bacteria | 889 |
| 610 | Ga0501072_0235572 | 3300049588 | Bacteria | 1458 |
| 611 | Ga0501073_0051186 | 3300049589 | Bacteria | 2893 |
| 612 | Ga0501073_0999434 | 3300049589 | Unclassified | 575 |
| 613 | Ga0501074_0078227 | 3300049590 | Bacteria | 2374 |
| 614 | Ga0501075_1173551 | 3300049591 | Bacteria | 583 |
| 615 | Ga0501080_0102847 | 3300049742 | Bacteria | 2650 |
| 616 | Ga0501080_0460968 | 3300049742 | Unclassified | 1138 |
| 617 | Ga0501035_0034818 | 3300049822 | Bacteria | 4575 |
| 618 | Ga0501035_0042535 | 3300049822 | Unclassified | 4097 |
| 619 | Ga0501044_0005613 | 3300049823 | Bacteria | 13933 |
| 620 | Ga0501044_0301765 | 3300049823 | Unclassified | 1530 |
| 621 | nmdc:mga0k408_1636_c1 | 3300050493 | Bacteria | 12115 |
| 622 | nmdc:mga0k408_18606_c1 | 3300050493 | Bacteria | 3879 |
| 623 | nmdc:mga05p37_285543_c1 | 3300050507 | Bacteria | 1966 |
| 624 | nmdc:mga05p37_381519_c1 | 3300050507 | Bacteria | 1651 |
| 625 | nmdc:mga09592_124074_c1 | 3300050508 | Bacteria | 2220 |
| 626 | nmdc:mga09592_321370_c1 | 3300050508 | Bacteria | 1341 |
| 627 | nmdc:mga0qj67_10091_c1 | 3300050509 | Bacteria | 7047 |
| 628 | nmdc:mga0qj67_80584_c1 | 3300050509 | Bacteria | 2608 |
| 629 | nmdc:mga06r32_1332723_c1 | 3300050510 | Bacteria | 661 |
| 630 | nmdc:mga06r32_505653_c1 | 3300050510 | Bacteria | 1185 |
| 631 | nmdc:mga08y16_1119021_c1 | 3300050511 | Bacteria | 762 |
| 632 | nmdc:mga08y16_25548_c1 | 3300050511 | Bacteria | 6230 |
| 633 | nmdc:mga0rr50_1005601_c1 | 3300050513 | Bacteria | 710 |
| 634 | Ga0495619_0070002 | 3300053085 | Unclassified | 2346 |
| 635 | Ga0500654_087461 | 3300053099 | Bacteria | 1411 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026121 | Ga0207683_10232413 | Ga0207683_102324133 | 81 |
| 2 | 3300006353 | Ga0075370_10487625 | Ga0075370_104876252 | 82 |
| 3 | 3300005840 | Ga0068870_10214484 | Ga0068870_102144842 | 83 |
| 4 | 3300009553 | Ga0105249_10003125 | Ga0105249_100031257 | 83 |
| 5 | 3300014325 | Ga0163163_10880387 | Ga0163163_108803871 | 83 |
| 6 | 3300014326 | Ga0157380_11722044 | Ga0157380_117220441 | 83 |
| 7 | 3300025961 | Ga0207712_10001366 | Ga0207712_100013666 | 83 |
| 8 | 3300005288 | Ga0065714_10204137 | Ga0065714_102041371 | 84 |
| 9 | 3300005290 | Ga0065712_10053336 | Ga0065712_100533361 | 84 |
| 10 | 3300005333 | Ga0070677_10507306 | Ga0070677_105073061 | 84 |
| 11 | 3300005333 | Ga0070677_10879097 | Ga0070677_108790971 | 84 |
| 12 | 3300005334 | Ga0068869_100463182 | Ga0068869_1004631822 | 84 |
| 13 | 3300005337 | Ga0070682_100195368 | Ga0070682_1001953682 | 84 |
| 14 | 3300005338 | Ga0068868_100243133 | Ga0068868_1002431332 | 84 |
| 15 | 3300005343 | Ga0070687_100505186 | Ga0070687_1005051862 | 84 |
| 16 | 3300005353 | Ga0070669_100769731 | Ga0070669_1007697311 | 84 |
| 17 | 3300005367 | Ga0070667_100303957 | Ga0070667_1003039572 | 84 |
| 18 | 3300005440 | Ga0070705_100899648 | Ga0070705_1008996482 | 84 |
| 19 | 3300005441 | Ga0070700_100211890 | Ga0070700_1002118902 | 84 |
| 20 | 3300005456 | Ga0070678_101633003 | Ga0070678_1016330031 | 84 |
| 21 | 3300005617 | Ga0068859_100432566 | Ga0068859_1004325662 | 84 |
| 22 | 3300005617 | Ga0068859_101032159 | Ga0068859_1010321592 | 84 |
| 23 | 3300005718 | Ga0068866_10172262 | Ga0068866_101722622 | 84 |
| 24 | 3300006881 | Ga0068865_100536648 | Ga0068865_1005366481 | 84 |
| 25 | 3300006931 | Ga0097620_100432560 | Ga0097620_1004325602 | 84 |
| 26 | 3300006931 | Ga0097620_101032091 | Ga0097620_1010320912 | 84 |
| 27 | 3300009176 | Ga0105242_10945275 | Ga0105242_109452752 | 84 |
| 28 | 3300011119 | Ga0105246_10467507 | Ga0105246_104675072 | 84 |
| 29 | 3300013308 | Ga0157375_12490430 | Ga0157375_124904301 | 84 |
| 30 | 3300013308 | Ga0157375_13048253 | Ga0157375_130482531 | 84 |
| 31 | 3300014745 | Ga0157377_11230127 | Ga0157377_112301271 | 84 |
| 32 | 3300025893 | Ga0207682_10461528 | Ga0207682_104615281 | 84 |
| 33 | 3300025908 | Ga0207643_10195392 | Ga0207643_101953921 | 84 |
| 34 | 3300025918 | Ga0207662_10562837 | Ga0207662_105628371 | 84 |
| 35 | 3300025923 | Ga0207681_10374259 | Ga0207681_103742592 | 84 |
| 36 | 3300025926 | Ga0207659_10554345 | Ga0207659_105543452 | 84 |
| 37 | 3300025936 | Ga0207670_10427255 | Ga0207670_104272552 | 84 |
| 38 | 3300025938 | Ga0207704_10777157 | Ga0207704_107771572 | 84 |
| 39 | 3300025940 | Ga0207691_10973129 | Ga0207691_109731291 | 84 |
| 40 | 3300025942 | Ga0207689_10491444 | Ga0207689_104914442 | 84 |
| 41 | 3300025960 | Ga0207651_10870530 | Ga0207651_108705302 | 84 |
| 42 | 3300026023 | Ga0207677_11146253 | Ga0207677_111462532 | 84 |
| 43 | 3300026041 | Ga0207639_12053487 | Ga0207639_120534871 | 84 |
| 44 | 3300026075 | Ga0207708_10750224 | Ga0207708_107502242 | 84 |
| 45 | 3300026121 | Ga0207683_10314792 | Ga0207683_103147922 | 84 |
| 46 | 3300028380 | Ga0268265_11139810 | Ga0268265_111398101 | 84 |
| 47 | 3300005293 | Ga0065715_10595162 | Ga0065715_105951621 | 85 |
| 48 | 3300005331 | Ga0070670_100050349 | Ga0070670_1000503493 | 85 |
| 49 | 3300005343 | Ga0070687_100521384 | Ga0070687_1005213841 | 85 |
| 50 | 3300005365 | Ga0070688_100053524 | Ga0070688_1000535243 | 85 |
| 51 | 3300005466 | Ga0070685_10081682 | Ga0070685_100816821 | 85 |
| 52 | 3300005719 | Ga0068861_100584343 | Ga0068861_1005843431 | 85 |
| 53 | 3300005842 | Ga0068858_100913907 | Ga0068858_1009139072 | 85 |
| 54 | 3300009553 | Ga0105249_10179071 | Ga0105249_101790712 | 85 |
| 55 | 3300013306 | Ga0163162_10326309 | Ga0163162_103263091 | 85 |
| 56 | 3300013308 | Ga0157375_10606785 | Ga0157375_106067852 | 85 |
| 57 | 3300025899 | Ga0207642_10826158 | Ga0207642_108261581 | 85 |
| 58 | 3300025918 | Ga0207662_10094232 | Ga0207662_100942322 | 85 |
| 59 | 3300025925 | Ga0207650_10113773 | Ga0207650_101137732 | 85 |
| 60 | 3300026035 | Ga0207703_10184958 | Ga0207703_101849583 | 85 |
| 61 | 3300028381 | Ga0268264_11345710 | Ga0268264_113457102 | 85 |
| 62 | 3300005356 | Ga0070674_100413658 | Ga0070674_1004136582 | 86 |
| 63 | 3300009094 | Ga0111539_10519150 | Ga0111539_105191502 | 86 |
| 64 | 3300025937 | Ga0207669_10027963 | Ga0207669_100279632 | 86 |
| 65 | 3300026089 | Ga0207648_10244327 | Ga0207648_102443272 | 86 |
| 66 | 3300026118 | Ga0207675_100136537 | Ga0207675_1001365373 | 86 |
| 67 | 3300050511 | nmdc:mga08y16_1119021_c1 | nmdc:mga08y16_1119021_c1_370_675 | 86 |
| 68 | 3300005290 | Ga0065712_10092996 | Ga0065712_100929962 | 87 |
| 69 | 3300005841 | Ga0068863_100033403 | Ga0068863_1000334033 | 87 |
| 70 | 3300009553 | Ga0105249_11734010 | Ga0105249_117340102 | 87 |
| 71 | 3300013306 | Ga0163162_10250702 | Ga0163162_102507023 | 87 |
| 72 | 3300013308 | Ga0157375_10706277 | Ga0157375_107062771 | 87 |
| 73 | 3300017792 | Ga0163161_10083144 | Ga0163161_100831442 | 87 |
| 74 | 3300026088 | Ga0207641_10001405 | Ga0207641_100014057 | 87 |
| 75 | 3300026088 | Ga0207641_12037396 | Ga0207641_120373962 | 87 |
| 76 | 3300026118 | Ga0207675_100252475 | Ga0207675_1002524751 | 87 |
| 77 | 3300026121 | Ga0207683_10650508 | Ga0207683_106505082 | 87 |
| 78 | 3300006844 | Ga0075428_102047621 | Ga0075428_1020476212 | 89 |
| 79 | 3300006847 | Ga0075431_101490277 | Ga0075431_1014902771 | 89 |
| 80 | 3300042001 | Ga0439441_020574 | Ga0439441_020574_815_1120 | 89 |
| 81 | 3300050510 | nmdc:mga06r32_1332723_c1 | nmdc:mga06r32_1332723_c1_341_646 | 89 |
| 82 | 3300041458 | Ga0451798_1046411 | Ga0451798_1046411_859_1164 | 90 |
| 83 | 3300013104 | Ga0157370_10017114 | Ga0157370_100171143 | 93 |
| 84 | 3300009174 | Ga0105241_10967330 | Ga0105241_109673302 | 96 |
| 85 | 3300009176 | Ga0105242_10635598 | Ga0105242_106355982 | 96 |
| 86 | 3300013297 | Ga0157378_11287322 | Ga0157378_112873222 | 96 |
| 87 | 3300005327 | Ga0070658_10002266 | Ga0070658_1000226614 | 97 |
| 88 | 3300005328 | Ga0070676_10000458 | Ga0070676_1000045815 | 97 |
| 89 | 3300005329 | Ga0070683_101944403 | Ga0070683_1019444031 | 97 |
| 90 | 3300005331 | Ga0070670_100099508 | Ga0070670_1000995083 | 97 |
| 91 | 3300005333 | Ga0070677_10285123 | Ga0070677_102851233 | 97 |
| 92 | 3300005334 | Ga0068869_100338759 | Ga0068869_1003387592 | 97 |
| 93 | 3300005335 | Ga0070666_10053243 | Ga0070666_100532432 | 97 |
| 94 | 3300005338 | Ga0068868_100000493 | Ga0068868_10000049321 | 97 |
| 95 | 3300005338 | Ga0068868_100506649 | Ga0068868_1005066492 | 97 |
| 96 | 3300005344 | Ga0070661_101193586 | Ga0070661_1011935861 | 97 |
| 97 | 3300005345 | Ga0070692_10341604 | Ga0070692_103416042 | 97 |
| 98 | 3300005347 | Ga0070668_100000154 | Ga0070668_10000015413 | 97 |
| 99 | 3300005355 | Ga0070671_100017163 | Ga0070671_1000171638 | 97 |
| 100 | 3300005356 | Ga0070674_101229134 | Ga0070674_1012291341 | 97 |
| 101 | 3300005364 | Ga0070673_100001017 | Ga0070673_10000101714 | 97 |
| 102 | 3300005367 | Ga0070667_100001203 | Ga0070667_10000120310 | 97 |
| 103 | 3300005367 | Ga0070667_100227853 | Ga0070667_1002278531 | 97 |
| 104 | 3300005367 | Ga0070667_100242765 | Ga0070667_1002427653 | 97 |
| 105 | 3300005455 | Ga0070663_100149260 | Ga0070663_1001492601 | 97 |
| 106 | 3300005456 | Ga0070678_100027407 | Ga0070678_1000274075 | 97 |
| 107 | 3300005457 | Ga0070662_100004216 | Ga0070662_10000421611 | 97 |
| 108 | 3300005459 | Ga0068867_100001830 | Ga0068867_1000018302 | 97 |
| 109 | 3300005539 | Ga0068853_100049869 | Ga0068853_1000498693 | 97 |
| 110 | 3300005543 | Ga0070672_100000048 | Ga0070672_10000004832 | 97 |
| 111 | 3300005543 | Ga0070672_100330345 | Ga0070672_1003303452 | 97 |
| 112 | 3300005547 | Ga0070693_101082102 | Ga0070693_1010821022 | 97 |
| 113 | 3300005548 | Ga0070665_100003379 | Ga0070665_10000337916 | 97 |
| 114 | 3300005563 | Ga0068855_100095276 | Ga0068855_1000952762 | 97 |
| 115 | 3300005614 | Ga0068856_101424176 | Ga0068856_1014241762 | 97 |
| 116 | 3300005616 | Ga0068852_100105336 | Ga0068852_1001053362 | 97 |
| 117 | 3300005616 | Ga0068852_100781872 | Ga0068852_1007818722 | 97 |
| 118 | 3300005618 | Ga0068864_100079101 | Ga0068864_1000791011 | 97 |
| 119 | 3300005618 | Ga0068864_100328351 | Ga0068864_1003283512 | 97 |
| 120 | 3300005718 | Ga0068866_10491455 | Ga0068866_104914551 | 97 |
| 121 | 3300005719 | Ga0068861_100139662 | Ga0068861_1001396623 | 97 |
| 122 | 3300005834 | Ga0068851_10004047 | Ga0068851_100040472 | 97 |
| 123 | 3300005841 | Ga0068863_100005521 | Ga0068863_10000552113 | 97 |
| 124 | 3300005841 | Ga0068863_100269041 | Ga0068863_1002690412 | 97 |
| 125 | 3300005842 | Ga0068858_100001355 | Ga0068858_10000135514 | 97 |
| 126 | 3300005843 | Ga0068860_100011687 | Ga0068860_1000116877 | 97 |
| 127 | 3300006163 | Ga0070715_10158131 | Ga0070715_101581312 | 97 |
| 128 | 3300006237 | Ga0097621_100002545 | Ga0097621_1000025454 | 97 |
| 129 | 3300006237 | Ga0097621_100076545 | Ga0097621_1000765455 | 97 |
| 130 | 3300006358 | Ga0068871_100003156 | Ga0068871_1000031566 | 97 |
| 131 | 3300006358 | Ga0068871_100048716 | Ga0068871_1000487166 | 97 |
| 132 | 3300006881 | Ga0068865_100001341 | Ga0068865_1000013415 | 97 |
| 133 | 3300009093 | Ga0105240_10066684 | Ga0105240_100666842 | 97 |
| 134 | 3300009098 | Ga0105245_10070211 | Ga0105245_100702112 | 97 |
| 135 | 3300009098 | Ga0105245_11160076 | Ga0105245_111600762 | 97 |
| 136 | 3300009148 | Ga0105243_10223480 | Ga0105243_102234802 | 97 |
| 137 | 3300009176 | Ga0105242_12953651 | Ga0105242_129536512 | 97 |
| 138 | 3300009177 | Ga0105248_10128000 | Ga0105248_101280002 | 97 |
| 139 | 3300009545 | Ga0105237_10330937 | Ga0105237_103309372 | 97 |
| 140 | 3300009553 | Ga0105249_10004834 | Ga0105249_100048345 | 97 |
| 141 | 3300009553 | Ga0105249_10056524 | Ga0105249_100565244 | 97 |
| 142 | 3300010375 | Ga0105239_10637411 | Ga0105239_106374112 | 97 |
| 143 | 3300013104 | Ga0157370_10017652 | Ga0157370_100176524 | 97 |
| 144 | 3300013105 | Ga0157369_12222305 | Ga0157369_122223052 | 97 |
| 145 | 3300013296 | Ga0157374_10000314 | Ga0157374_1000031427 | 97 |
| 146 | 3300013296 | Ga0157374_10479636 | Ga0157374_104796362 | 97 |
| 147 | 3300013297 | Ga0157378_10001556 | Ga0157378_1000155618 | 97 |
| 148 | 3300013297 | Ga0157378_10492247 | Ga0157378_104922472 | 97 |
| 149 | 3300013306 | Ga0163162_10000231 | Ga0163162_1000023113 | 97 |
| 150 | 3300013306 | Ga0163162_10000318 | Ga0163162_1000031812 | 97 |
| 151 | 3300013306 | Ga0163162_10009899 | Ga0163162_1000989911 | 97 |
| 152 | 3300013306 | Ga0163162_10062519 | Ga0163162_100625193 | 97 |
| 153 | 3300013306 | Ga0163162_10109079 | Ga0163162_101090792 | 97 |
| 154 | 3300013307 | Ga0157372_10136366 | Ga0157372_101363663 | 97 |
| 155 | 3300013307 | Ga0157372_11483281 | Ga0157372_114832812 | 97 |
| 156 | 3300013308 | Ga0157375_10000073 | Ga0157375_100000735 | 97 |
| 157 | 3300013308 | Ga0157375_10000272 | Ga0157375_1000027227 | 97 |
| 158 | 3300013308 | Ga0157375_11537787 | Ga0157375_115377872 | 97 |
| 159 | 3300013308 | Ga0157375_11601731 | Ga0157375_116017312 | 97 |
| 160 | 3300014325 | Ga0163163_10000129 | Ga0163163_1000012916 | 97 |
| 161 | 3300014325 | Ga0163163_10000347 | Ga0163163_1000034726 | 97 |
| 162 | 3300014968 | Ga0157379_10000120 | Ga0157379_1000012015 | 97 |
| 163 | 3300014968 | Ga0157379_10380397 | Ga0157379_103803972 | 97 |
| 164 | 3300014969 | Ga0157376_10000271 | Ga0157376_1000027126 | 97 |
| 165 | 3300014969 | Ga0157376_10000774 | Ga0157376_1000077410 | 97 |
| 166 | 3300014969 | Ga0157376_10197202 | Ga0157376_101972022 | 97 |
| 167 | 3300017792 | Ga0163161_10011166 | Ga0163161_100111662 | 97 |
| 168 | 3300017792 | Ga0163161_10021878 | Ga0163161_100218783 | 97 |
| 169 | 3300017792 | Ga0163161_10058069 | Ga0163161_100580695 | 97 |
| 170 | 3300025321 | Ga0207656_10002217 | Ga0207656_100022176 | 97 |
| 171 | 3300025903 | Ga0207680_10000165 | Ga0207680_1000016520 | 97 |
| 172 | 3300025903 | Ga0207680_10042466 | Ga0207680_100424662 | 97 |
| 173 | 3300025904 | Ga0207647_10051653 | Ga0207647_100516532 | 97 |
| 174 | 3300025905 | Ga0207685_10265341 | Ga0207685_102653412 | 97 |
| 175 | 3300025907 | Ga0207645_10001368 | Ga0207645_1000136810 | 97 |
| 176 | 3300025909 | Ga0207705_10008997 | Ga0207705_100089974 | 97 |
| 177 | 3300025920 | Ga0207649_11069718 | Ga0207649_110697181 | 97 |
| 178 | 3300025925 | Ga0207650_10219152 | Ga0207650_102191522 | 97 |
| 179 | 3300025931 | Ga0207644_10009824 | Ga0207644_100098244 | 97 |
| 180 | 3300025933 | Ga0207706_10052672 | Ga0207706_100526723 | 97 |
| 181 | 3300025934 | Ga0207686_11687276 | Ga0207686_116872761 | 97 |
| 182 | 3300025935 | Ga0207709_10173575 | Ga0207709_101735752 | 97 |
| 183 | 3300025938 | Ga0207704_10000986 | Ga0207704_1000098614 | 97 |
| 184 | 3300025940 | Ga0207691_10000245 | Ga0207691_1000024513 | 97 |
| 185 | 3300025940 | Ga0207691_10766138 | Ga0207691_107661382 | 97 |
| 186 | 3300025941 | Ga0207711_10144727 | Ga0207711_101447273 | 97 |
| 187 | 3300025942 | Ga0207689_10350872 | Ga0207689_103508722 | 97 |
| 188 | 3300025949 | Ga0207667_10088148 | Ga0207667_100881482 | 97 |
| 189 | 3300025960 | Ga0207651_10009691 | Ga0207651_100096912 | 97 |
| 190 | 3300025961 | Ga0207712_10053502 | Ga0207712_100535023 | 97 |
| 191 | 3300025961 | Ga0207712_10358221 | Ga0207712_103582212 | 97 |
| 192 | 3300025972 | Ga0207668_10000184 | Ga0207668_1000018413 | 97 |
| 193 | 3300025986 | Ga0207658_10000452 | Ga0207658_100004525 | 97 |
| 194 | 3300025986 | Ga0207658_10080711 | Ga0207658_100807113 | 97 |
| 195 | 3300026023 | Ga0207677_10007781 | Ga0207677_100077816 | 97 |
| 196 | 3300026023 | Ga0207677_11032246 | Ga0207677_110322462 | 97 |
| 197 | 3300026035 | Ga0207703_10000388 | Ga0207703_1000038812 | 97 |
| 198 | 3300026041 | Ga0207639_10037498 | Ga0207639_100374983 | 97 |
| 199 | 3300026067 | Ga0207678_10133009 | Ga0207678_101330092 | 97 |
| 200 | 3300026088 | Ga0207641_10002172 | Ga0207641_1000217212 | 97 |
| 201 | 3300026088 | Ga0207641_11326362 | Ga0207641_113263622 | 97 |
| 202 | 3300026089 | Ga0207648_10004150 | Ga0207648_1000415013 | 97 |
| 203 | 3300026095 | Ga0207676_10011439 | Ga0207676_100114396 | 97 |
| 204 | 3300026095 | Ga0207676_10690287 | Ga0207676_106902871 | 97 |
| 205 | 3300026118 | Ga0207675_100010293 | Ga0207675_1000102932 | 97 |
| 206 | 3300026121 | Ga0207683_10614457 | Ga0207683_106144572 | 97 |
| 207 | 3300026142 | Ga0207698_10084616 | Ga0207698_100846162 | 97 |
| 208 | 3300026142 | Ga0207698_10784324 | Ga0207698_107843242 | 97 |
| 209 | 3300028379 | Ga0268266_10000928 | Ga0268266_1000092827 | 97 |
| 210 | 3300028379 | Ga0268266_10408629 | Ga0268266_104086291 | 97 |
| 211 | 3300028381 | Ga0268264_10039112 | Ga0268264_100391124 | 97 |
| 212 | 3300041451 | Ga0451791_0582350 | Ga0451791_0582350_333_626 | 97 |
| 213 | 3300041486 | Ga0451807_0115588 | Ga0451807_0115588_174_467 | 97 |
| 214 | 3300046472 | Ga0495580_1015429 | Ga0495580_1015429_91_387 | 97 |
| 215 | 3300046517 | Ga0495630_0035779 | Ga0495630_0035779_2619_2915 | 97 |
| 216 | 3300046690 | Ga0495624_0386278 | Ga0495624_0386278_138_434 | 97 |
| 217 | 3300047322 | Ga0495680_0752664 | Ga0495680_0752664_145_441 | 97 |
| 218 | 3300048904 | Ga0496101_1296933 | Ga0496101_1296933_13_312 | 97 |
| 219 | 3300048905 | Ga0496102_0152912 | Ga0496102_0152912_965_1264 | 97 |
| 220 | 3300048907 | Ga0496104_0837146 | Ga0496104_0837146_420_719 | 97 |
| 221 | 3300048907 | Ga0496104_0968950 | Ga0496104_0968950_55_351 | 97 |
| 222 | 3300048908 | Ga0496105_0440087 | Ga0496105_0440087_559_855 | 97 |
| 223 | 3300048911 | Ga0496108_0082978 | Ga0496108_0082978_2211_2510 | 97 |
| 224 | 3300048912 | Ga0496109_0029361 | Ga0496109_0029361_1528_1827 | 97 |
| 225 | 3300048917 | Ga0496114_0283711 | Ga0496114_0283711_881_1180 | 97 |
| 226 | 3300050513 | nmdc:mga0rr50_1005601_c1 | nmdc:mga0rr50_1005601_c1_406_699 | 97 |
| 227 | 3300053099 | Ga0500654_087461 | Ga0500654_087461_192_485 | 97 |
| 228 | 2162886011 | MRS1b_contig_1278685 | MRS1b_0273.00003440 | 98 |
| 229 | 2162886012 | MBSR1b_contig_4982930 | MBSR1b_0817.00003530 | 98 |
| 230 | 3300001991 | JGI24743J22301_10048807 | JGI24743J22301_100488072 | 98 |
| 231 | 3300002077 | JGI24744J21845_10014200 | JGI24744J21845_100142002 | 98 |
| 232 | 3300002244 | JGI24742J22300_10077530 | JGI24742J22300_100775302 | 98 |
| 233 | 3300003322 | rootL2_10213118 | rootL2_102131183 | 98 |
| 234 | 3300005290 | Ga0065712_10009117 | Ga0065712_100091172 | 98 |
| 235 | 3300005290 | Ga0065712_10426193 | Ga0065712_104261932 | 98 |
| 236 | 3300005293 | Ga0065715_10125870 | Ga0065715_101258702 | 98 |
| 237 | 3300005295 | Ga0065707_10007663 | Ga0065707_100076633 | 98 |
| 238 | 3300005328 | Ga0070676_10003200 | Ga0070676_100032007 | 98 |
| 239 | 3300005330 | Ga0070690_100044227 | Ga0070690_1000442273 | 98 |
| 240 | 3300005330 | Ga0070690_100465837 | Ga0070690_1004658371 | 98 |
| 241 | 3300005331 | Ga0070670_100080535 | Ga0070670_1000805352 | 98 |
| 242 | 3300005331 | Ga0070670_100318657 | Ga0070670_1003186573 | 98 |
| 243 | 3300005331 | Ga0070670_100438223 | Ga0070670_1004382232 | 98 |
| 244 | 3300005331 | Ga0070670_100786966 | Ga0070670_1007869661 | 98 |
| 245 | 3300005333 | Ga0070677_10013498 | Ga0070677_100134982 | 98 |
| 246 | 3300005334 | Ga0068869_100011037 | Ga0068869_1000110376 | 98 |
| 247 | 3300005334 | Ga0068869_100032741 | Ga0068869_1000327413 | 98 |
| 248 | 3300005334 | Ga0068869_100045035 | Ga0068869_1000450353 | 98 |
| 249 | 3300005334 | Ga0068869_100172105 | Ga0068869_1001721052 | 98 |
| 250 | 3300005334 | Ga0068869_100820240 | Ga0068869_1008202402 | 98 |
| 251 | 3300005335 | Ga0070666_10035829 | Ga0070666_100358292 | 98 |
| 252 | 3300005335 | Ga0070666_10278456 | Ga0070666_102784561 | 98 |
| 253 | 3300005338 | Ga0068868_100016265 | Ga0068868_1000162656 | 98 |
| 254 | 3300005338 | Ga0068868_101777251 | Ga0068868_1017772511 | 98 |
| 255 | 3300005340 | Ga0070689_100052227 | Ga0070689_1000522272 | 98 |
| 256 | 3300005340 | Ga0070689_100935374 | Ga0070689_1009353742 | 98 |
| 257 | 3300005340 | Ga0070689_101143030 | Ga0070689_1011430302 | 98 |
| 258 | 3300005343 | Ga0070687_100048101 | Ga0070687_1000481012 | 98 |
| 259 | 3300005347 | Ga0070668_100035316 | Ga0070668_1000353165 | 98 |
| 260 | 3300005347 | Ga0070668_100221798 | Ga0070668_1002217983 | 98 |
| 261 | 3300005347 | Ga0070668_100404316 | Ga0070668_1004043161 | 98 |
| 262 | 3300005347 | Ga0070668_100861682 | Ga0070668_1008616822 | 98 |
| 263 | 3300005347 | Ga0070668_101800123 | Ga0070668_1018001232 | 98 |
| 264 | 3300005353 | Ga0070669_100003025 | Ga0070669_1000030255 | 98 |
| 265 | 3300005353 | Ga0070669_100006016 | Ga0070669_1000060165 | 98 |
| 266 | 3300005353 | Ga0070669_100214312 | Ga0070669_1002143122 | 98 |
| 267 | 3300005353 | Ga0070669_101597342 | Ga0070669_1015973422 | 98 |
| 268 | 3300005354 | Ga0070675_100005755 | Ga0070675_1000057554 | 98 |
| 269 | 3300005354 | Ga0070675_100080415 | Ga0070675_1000804154 | 98 |
| 270 | 3300005354 | Ga0070675_101603116 | Ga0070675_1016031162 | 98 |
| 271 | 3300005355 | Ga0070671_100843408 | Ga0070671_1008434081 | 98 |
| 272 | 3300005356 | Ga0070674_100122880 | Ga0070674_1001228803 | 98 |
| 273 | 3300005356 | Ga0070674_101063817 | Ga0070674_1010638171 | 98 |
| 274 | 3300005364 | Ga0070673_100020510 | Ga0070673_1000205102 | 98 |
| 275 | 3300005364 | Ga0070673_100030274 | Ga0070673_1000302741 | 98 |
| 276 | 3300005364 | Ga0070673_100046319 | Ga0070673_1000463191 | 98 |
| 277 | 3300005364 | Ga0070673_101516161 | Ga0070673_1015161612 | 98 |
| 278 | 3300005365 | Ga0070688_100023656 | Ga0070688_1000236562 | 98 |
| 279 | 3300005365 | Ga0070688_100354789 | Ga0070688_1003547892 | 98 |
| 280 | 3300005365 | Ga0070688_100619284 | Ga0070688_1006192842 | 98 |
| 281 | 3300005367 | Ga0070667_100128225 | Ga0070667_1001282251 | 98 |
| 282 | 3300005367 | Ga0070667_100771627 | Ga0070667_1007716272 | 98 |
| 283 | 3300005367 | Ga0070667_101434151 | Ga0070667_1014341512 | 98 |
| 284 | 3300005441 | Ga0070700_100068909 | Ga0070700_1000689093 | 98 |
| 285 | 3300005441 | Ga0070700_100185339 | Ga0070700_1001853392 | 98 |
| 286 | 3300005441 | Ga0070700_100885706 | Ga0070700_1008857061 | 98 |
| 287 | 3300005455 | Ga0070663_100366089 | Ga0070663_1003660892 | 98 |
| 288 | 3300005456 | Ga0070678_100145245 | Ga0070678_1001452453 | 98 |
| 289 | 3300005457 | Ga0070662_100010256 | Ga0070662_1000102567 | 98 |
| 290 | 3300005457 | Ga0070662_100168155 | Ga0070662_1001681552 | 98 |
| 291 | 3300005459 | Ga0068867_100105504 | Ga0068867_1001055042 | 98 |
| 292 | 3300005459 | Ga0068867_100111234 | Ga0068867_1001112344 | 98 |
| 293 | 3300005459 | Ga0068867_100587030 | Ga0068867_1005870302 | 98 |
| 294 | 3300005466 | Ga0070685_11325362 | Ga0070685_113253621 | 98 |
| 295 | 3300005471 | Ga0070698_100002094 | Ga0070698_10000209416 | 98 |
| 296 | 3300005471 | Ga0070698_100006624 | Ga0070698_1000066247 | 98 |
| 297 | 3300005539 | Ga0068853_100014617 | Ga0068853_1000146176 | 98 |
| 298 | 3300005539 | Ga0068853_100052295 | Ga0068853_1000522952 | 98 |
| 299 | 3300005539 | Ga0068853_102071117 | Ga0068853_1020711172 | 98 |
| 300 | 3300005543 | Ga0070672_100008700 | Ga0070672_1000087007 | 98 |
| 301 | 3300005543 | Ga0070672_101690240 | Ga0070672_1016902401 | 98 |
| 302 | 3300005544 | Ga0070686_100361545 | Ga0070686_1003615452 | 98 |
| 303 | 3300005548 | Ga0070665_100071165 | Ga0070665_1000711654 | 98 |
| 304 | 3300005548 | Ga0070665_101258312 | Ga0070665_1012583121 | 98 |
| 305 | 3300005564 | Ga0070664_101185467 | Ga0070664_1011854673 | 98 |
| 306 | 3300005577 | Ga0068857_100132871 | Ga0068857_1001328713 | 98 |
| 307 | 3300005577 | Ga0068857_100382856 | Ga0068857_1003828562 | 98 |
| 308 | 3300005577 | Ga0068857_100586298 | Ga0068857_1005862983 | 98 |
| 309 | 3300005578 | Ga0068854_100717046 | Ga0068854_1007170462 | 98 |
| 310 | 3300005616 | Ga0068852_101406589 | Ga0068852_1014065892 | 98 |
| 311 | 3300005617 | Ga0068859_100007565 | Ga0068859_1000075658 | 98 |
| 312 | 3300005617 | Ga0068859_100027468 | Ga0068859_1000274685 | 98 |
| 313 | 3300005617 | Ga0068859_100205833 | Ga0068859_1002058332 | 98 |
| 314 | 3300005617 | Ga0068859_100514640 | Ga0068859_1005146402 | 98 |
| 315 | 3300005617 | Ga0068859_100802538 | Ga0068859_1008025382 | 98 |
| 316 | 3300005617 | Ga0068859_100962911 | Ga0068859_1009629112 | 98 |
| 317 | 3300005618 | Ga0068864_100026182 | Ga0068864_1000261822 | 98 |
| 318 | 3300005618 | Ga0068864_101115940 | Ga0068864_1011159402 | 98 |
| 319 | 3300005618 | Ga0068864_101872215 | Ga0068864_1018722152 | 98 |
| 320 | 3300005718 | Ga0068866_10061456 | Ga0068866_100614563 | 98 |
| 321 | 3300005719 | Ga0068861_100008514 | Ga0068861_1000085145 | 98 |
| 322 | 3300005719 | Ga0068861_100013356 | Ga0068861_1000133562 | 98 |
| 323 | 3300005719 | Ga0068861_100031759 | Ga0068861_1000317595 | 98 |
| 324 | 3300005719 | Ga0068861_100055850 | Ga0068861_1000558501 | 98 |
| 325 | 3300005719 | Ga0068861_101402953 | Ga0068861_1014029532 | 98 |
| 326 | 3300005719 | Ga0068861_101709345 | Ga0068861_1017093452 | 98 |
| 327 | 3300005719 | Ga0068861_102049644 | Ga0068861_1020496442 | 98 |
| 328 | 3300005840 | Ga0068870_10002573 | Ga0068870_100025735 | 98 |
| 329 | 3300005840 | Ga0068870_10002679 | Ga0068870_100026794 | 98 |
| 330 | 3300005840 | Ga0068870_11143518 | Ga0068870_111435181 | 98 |
| 331 | 3300005841 | Ga0068863_100095798 | Ga0068863_1000957983 | 98 |
| 332 | 3300005841 | Ga0068863_100325905 | Ga0068863_1003259052 | 98 |
| 333 | 3300005841 | Ga0068863_100848295 | Ga0068863_1008482952 | 98 |
| 334 | 3300005842 | Ga0068858_101563734 | Ga0068858_1015637342 | 98 |
| 335 | 3300005843 | Ga0068860_100005349 | Ga0068860_10000534912 | 98 |
| 336 | 3300005843 | Ga0068860_100092303 | Ga0068860_1000923035 | 98 |
| 337 | 3300005843 | Ga0068860_100325752 | Ga0068860_1003257522 | 98 |
| 338 | 3300005843 | Ga0068860_100460023 | Ga0068860_1004600232 | 98 |
| 339 | 3300005843 | Ga0068860_100808090 | Ga0068860_1008080902 | 98 |
| 340 | 3300005844 | Ga0068862_100050077 | Ga0068862_1000500774 | 98 |
| 341 | 3300005844 | Ga0068862_100166306 | Ga0068862_1001663063 | 98 |
| 342 | 3300005844 | Ga0068862_100294371 | Ga0068862_1002943712 | 98 |
| 343 | 3300005844 | Ga0068862_100906719 | Ga0068862_1009067192 | 98 |
| 344 | 3300005844 | Ga0068862_101490526 | Ga0068862_1014905262 | 98 |
| 345 | 3300005844 | Ga0068862_102740873 | Ga0068862_1027408732 | 98 |
| 346 | 3300006163 | Ga0070715_10243824 | Ga0070715_102438242 | 98 |
| 347 | 3300006173 | Ga0070716_100050453 | Ga0070716_1000504533 | 98 |
| 348 | 3300006194 | Ga0075427_10053032 | Ga0075427_100530322 | 98 |
| 349 | 3300006195 | Ga0075366_10011207 | Ga0075366_100112076 | 98 |
| 350 | 3300006237 | Ga0097621_100022140 | Ga0097621_1000221404 | 98 |
| 351 | 3300006237 | Ga0097621_100453399 | Ga0097621_1004533992 | 98 |
| 352 | 3300006237 | Ga0097621_101951294 | Ga0097621_1019512942 | 98 |
| 353 | 3300006358 | Ga0068871_100104372 | Ga0068871_1001043722 | 98 |
| 354 | 3300006358 | Ga0068871_100186135 | Ga0068871_1001861352 | 98 |
| 355 | 3300006358 | Ga0068871_100360679 | Ga0068871_1003606792 | 98 |
| 356 | 3300006358 | Ga0068871_100452626 | Ga0068871_1004526262 | 98 |
| 357 | 3300006358 | Ga0068871_100634297 | Ga0068871_1006342971 | 98 |
| 358 | 3300006844 | Ga0075428_100133868 | Ga0075428_1001338683 | 98 |
| 359 | 3300006844 | Ga0075428_100186483 | Ga0075428_1001864833 | 98 |
| 360 | 3300006844 | Ga0075428_100235074 | Ga0075428_1002350742 | 98 |
| 361 | 3300006846 | Ga0075430_100003135 | Ga0075430_1000031355 | 98 |
| 362 | 3300006846 | Ga0075430_100044213 | Ga0075430_1000442134 | 98 |
| 363 | 3300006847 | Ga0075431_100202278 | Ga0075431_1002022783 | 98 |
| 364 | 3300006847 | Ga0075431_100345451 | Ga0075431_1003454512 | 98 |
| 365 | 3300006852 | Ga0075433_10517232 | Ga0075433_105172321 | 98 |
| 366 | 3300006880 | Ga0075429_100167295 | Ga0075429_1001672952 | 98 |
| 367 | 3300006880 | Ga0075429_100274449 | Ga0075429_1002744491 | 98 |
| 368 | 3300006880 | Ga0075429_101445106 | Ga0075429_1014451061 | 98 |
| 369 | 3300006881 | Ga0068865_100053256 | Ga0068865_1000532564 | 98 |
| 370 | 3300006881 | Ga0068865_100811983 | Ga0068865_1008119832 | 98 |
| 371 | 3300006931 | Ga0097620_100007565 | Ga0097620_1000075658 | 98 |
| 372 | 3300006931 | Ga0097620_100027468 | Ga0097620_1000274685 | 98 |
| 373 | 3300006931 | Ga0097620_100205847 | Ga0097620_1002058472 | 98 |
| 374 | 3300006931 | Ga0097620_100514666 | Ga0097620_1005146662 | 98 |
| 375 | 3300006931 | Ga0097620_100802620 | Ga0097620_1008026202 | 98 |
| 376 | 3300006931 | Ga0097620_100962838 | Ga0097620_1009628382 | 98 |
| 377 | 3300009094 | Ga0111539_10023974 | Ga0111539_100239747 | 98 |
| 378 | 3300009094 | Ga0111539_10399820 | Ga0111539_103998201 | 98 |
| 379 | 3300009098 | Ga0105245_10447724 | Ga0105245_104477242 | 98 |
| 380 | 3300009101 | Ga0105247_10948164 | Ga0105247_109481642 | 98 |
| 381 | 3300009147 | Ga0114129_10364637 | Ga0114129_103646373 | 98 |
| 382 | 3300009147 | Ga0114129_11261763 | Ga0114129_112617631 | 98 |
| 383 | 3300009147 | Ga0114129_13086625 | Ga0114129_130866252 | 98 |
| 384 | 3300009174 | Ga0105241_10150429 | Ga0105241_101504293 | 98 |
| 385 | 3300009174 | Ga0105241_10436437 | Ga0105241_104364372 | 98 |
| 386 | 3300009174 | Ga0105241_12696762 | Ga0105241_126967621 | 98 |
| 387 | 3300009176 | Ga0105242_10025455 | Ga0105242_100254555 | 98 |
| 388 | 3300009176 | Ga0105242_10068251 | Ga0105242_100682513 | 98 |
| 389 | 3300009176 | Ga0105242_10553337 | Ga0105242_105533372 | 98 |
| 390 | 3300009176 | Ga0105242_13206256 | Ga0105242_132062562 | 98 |
| 391 | 3300009177 | Ga0105248_12780078 | Ga0105248_127800781 | 98 |
| 392 | 3300009545 | Ga0105237_11535979 | Ga0105237_115359792 | 98 |
| 393 | 3300009553 | Ga0105249_10003218 | Ga0105249_100032187 | 98 |
| 394 | 3300009553 | Ga0105249_10243512 | Ga0105249_102435122 | 98 |
| 395 | 3300009553 | Ga0105249_10316937 | Ga0105249_103169372 | 98 |
| 396 | 3300009553 | Ga0105249_10446226 | Ga0105249_104462262 | 98 |
| 397 | 3300009553 | Ga0105249_10891508 | Ga0105249_108915082 | 98 |
| 398 | 3300009553 | Ga0105249_11684389 | Ga0105249_116843892 | 98 |
| 399 | 3300009553 | Ga0105249_12244194 | Ga0105249_122441941 | 98 |
| 400 | 3300010375 | Ga0105239_10288495 | Ga0105239_102884953 | 98 |
| 401 | 3300011119 | Ga0105246_10009910 | Ga0105246_100099102 | 98 |
| 402 | 3300011119 | Ga0105246_10203726 | Ga0105246_102037262 | 98 |
| 403 | 3300011119 | Ga0105246_10845059 | Ga0105246_108450591 | 98 |
| 404 | 3300013104 | Ga0157370_11300313 | Ga0157370_113003131 | 98 |
| 405 | 3300013105 | Ga0157369_11660651 | Ga0157369_116606512 | 98 |
| 406 | 3300013296 | Ga0157374_10100813 | Ga0157374_101008131 | 98 |
| 407 | 3300013296 | Ga0157374_10514754 | Ga0157374_105147542 | 98 |
| 408 | 3300013297 | Ga0157378_11079495 | Ga0157378_110794952 | 98 |
| 409 | 3300013306 | Ga0163162_10000224 | Ga0163162_1000022424 | 98 |
| 410 | 3300013306 | Ga0163162_10002781 | Ga0163162_100027812 | 98 |
| 411 | 3300013306 | Ga0163162_10055575 | Ga0163162_100555753 | 98 |
| 412 | 3300013306 | Ga0163162_10251650 | Ga0163162_102516502 | 98 |
| 413 | 3300013306 | Ga0163162_10783451 | Ga0163162_107834512 | 98 |
| 414 | 3300013308 | Ga0157375_10021346 | Ga0157375_100213462 | 98 |
| 415 | 3300013308 | Ga0157375_10098056 | Ga0157375_100980564 | 98 |
| 416 | 3300013308 | Ga0157375_11923004 | Ga0157375_119230041 | 98 |
| 417 | 3300014325 | Ga0163163_10435822 | Ga0163163_104358222 | 98 |
| 418 | 3300014325 | Ga0163163_10728490 | Ga0163163_107284901 | 98 |
| 419 | 3300014325 | Ga0163163_10736684 | Ga0163163_107366842 | 98 |
| 420 | 3300014325 | Ga0163163_12289764 | Ga0163163_122897641 | 98 |
| 421 | 3300014326 | Ga0157380_10013692 | Ga0157380_100136924 | 98 |
| 422 | 3300014326 | Ga0157380_10590765 | Ga0157380_105907652 | 98 |
| 423 | 3300014745 | Ga0157377_10002157 | Ga0157377_100021572 | 98 |
| 424 | 3300014745 | Ga0157377_10061358 | Ga0157377_100613583 | 98 |
| 425 | 3300014745 | Ga0157377_10135847 | Ga0157377_101358472 | 98 |
| 426 | 3300014745 | Ga0157377_11002983 | Ga0157377_110029832 | 98 |
| 427 | 3300014968 | Ga0157379_10632225 | Ga0157379_106322251 | 98 |
| 428 | 3300014968 | Ga0157379_10828694 | Ga0157379_108286941 | 98 |
| 429 | 3300014968 | Ga0157379_10897515 | Ga0157379_108975152 | 98 |
| 430 | 3300014968 | Ga0157379_11372497 | Ga0157379_113724972 | 98 |
| 431 | 3300014968 | Ga0157379_12043932 | Ga0157379_120439322 | 98 |
| 432 | 3300014969 | Ga0157376_10032084 | Ga0157376_100320844 | 98 |
| 433 | 3300014969 | Ga0157376_10193197 | Ga0157376_101931972 | 98 |
| 434 | 3300014969 | Ga0157376_10246399 | Ga0157376_102463992 | 98 |
| 435 | 3300014969 | Ga0157376_10271107 | Ga0157376_102711072 | 98 |
| 436 | 3300017792 | Ga0163161_10385984 | Ga0163161_103859842 | 98 |
| 437 | 3300017792 | Ga0163161_11686295 | Ga0163161_116862952 | 98 |
| 438 | 3300017792 | Ga0163161_11926432 | Ga0163161_119264322 | 98 |
| 439 | 3300025315 | Ga0207697_10009721 | Ga0207697_100097214 | 98 |
| 440 | 3300025321 | Ga0207656_10074325 | Ga0207656_100743252 | 98 |
| 441 | 3300025893 | Ga0207682_10087645 | Ga0207682_100876451 | 98 |
| 442 | 3300025899 | Ga0207642_10442005 | Ga0207642_104420052 | 98 |
| 443 | 3300025901 | Ga0207688_10135229 | Ga0207688_101352292 | 98 |
| 444 | 3300025903 | Ga0207680_10133108 | Ga0207680_101331082 | 98 |
| 445 | 3300025904 | Ga0207647_10357526 | Ga0207647_103575262 | 98 |
| 446 | 3300025907 | Ga0207645_10000263 | Ga0207645_1000026310 | 98 |
| 447 | 3300025907 | Ga0207645_10052338 | Ga0207645_100523384 | 98 |
| 448 | 3300025908 | Ga0207643_10002440 | Ga0207643_100024402 | 98 |
| 449 | 3300025908 | Ga0207643_10004417 | Ga0207643_100044175 | 98 |
| 450 | 3300025911 | Ga0207654_10596115 | Ga0207654_105961152 | 98 |
| 451 | 3300025918 | Ga0207662_10401390 | Ga0207662_104013902 | 98 |
| 452 | 3300025923 | Ga0207681_10042542 | Ga0207681_100425424 | 98 |
| 453 | 3300025923 | Ga0207681_10047551 | Ga0207681_100475512 | 98 |
| 454 | 3300025923 | Ga0207681_10460829 | Ga0207681_104608292 | 98 |
| 455 | 3300025925 | Ga0207650_10135789 | Ga0207650_101357892 | 98 |
| 456 | 3300025925 | Ga0207650_10283504 | Ga0207650_102835041 | 98 |
| 457 | 3300025925 | Ga0207650_11047692 | Ga0207650_110476922 | 98 |
| 458 | 3300025926 | Ga0207659_10044504 | Ga0207659_100445042 | 98 |
| 459 | 3300025926 | Ga0207659_10143270 | Ga0207659_101432702 | 98 |
| 460 | 3300025931 | Ga0207644_10780109 | Ga0207644_107801092 | 98 |
| 461 | 3300025933 | Ga0207706_10021277 | Ga0207706_100212777 | 98 |
| 462 | 3300025933 | Ga0207706_10194915 | Ga0207706_101949152 | 98 |
| 463 | 3300025934 | Ga0207686_10007206 | Ga0207686_100072063 | 98 |
| 464 | 3300025934 | Ga0207686_10053723 | Ga0207686_100537232 | 98 |
| 465 | 3300025934 | Ga0207686_10408285 | Ga0207686_104082852 | 98 |
| 466 | 3300025934 | Ga0207686_11852283 | Ga0207686_118522832 | 98 |
| 467 | 3300025936 | Ga0207670_10064208 | Ga0207670_100642082 | 98 |
| 468 | 3300025936 | Ga0207670_10496736 | Ga0207670_104967362 | 98 |
| 469 | 3300025937 | Ga0207669_10152289 | Ga0207669_101522892 | 98 |
| 470 | 3300025938 | Ga0207704_10057274 | Ga0207704_100572743 | 98 |
| 471 | 3300025938 | Ga0207704_10508301 | Ga0207704_105083012 | 98 |
| 472 | 3300025939 | Ga0207665_10300867 | Ga0207665_103008673 | 98 |
| 473 | 3300025940 | Ga0207691_10003243 | Ga0207691_1000324311 | 98 |
| 474 | 3300025940 | Ga0207691_11443784 | Ga0207691_114437841 | 98 |
| 475 | 3300025942 | Ga0207689_10007704 | Ga0207689_100077045 | 98 |
| 476 | 3300025942 | Ga0207689_10018354 | Ga0207689_100183542 | 98 |
| 477 | 3300025942 | Ga0207689_10034355 | Ga0207689_100343554 | 98 |
| 478 | 3300025942 | Ga0207689_10110922 | Ga0207689_101109222 | 98 |
| 479 | 3300025945 | Ga0207679_11781498 | Ga0207679_117814981 | 98 |
| 480 | 3300025960 | Ga0207651_10133394 | Ga0207651_101333942 | 98 |
| 481 | 3300025960 | Ga0207651_10230096 | Ga0207651_102300962 | 98 |
| 482 | 3300025960 | Ga0207651_10392678 | Ga0207651_103926782 | 98 |
| 483 | 3300025960 | Ga0207651_10582341 | Ga0207651_105823412 | 98 |
| 484 | 3300025960 | Ga0207651_10896550 | Ga0207651_108965501 | 98 |
| 485 | 3300025960 | Ga0207651_11045601 | Ga0207651_110456012 | 98 |
| 486 | 3300025961 | Ga0207712_10023399 | Ga0207712_100233993 | 98 |
| 487 | 3300025961 | Ga0207712_10053484 | Ga0207712_100534841 | 98 |
| 488 | 3300025961 | Ga0207712_10768054 | Ga0207712_107680542 | 98 |
| 489 | 3300025961 | Ga0207712_11211046 | Ga0207712_112110461 | 98 |
| 490 | 3300025972 | Ga0207668_10031257 | Ga0207668_100312574 | 98 |
| 491 | 3300025972 | Ga0207668_10175479 | Ga0207668_101754792 | 98 |
| 492 | 3300025972 | Ga0207668_10207582 | Ga0207668_102075822 | 98 |
| 493 | 3300025972 | Ga0207668_11452968 | Ga0207668_114529682 | 98 |
| 494 | 3300025981 | Ga0207640_11027713 | Ga0207640_110277132 | 98 |
| 495 | 3300025986 | Ga0207658_10051664 | Ga0207658_100516643 | 98 |
| 496 | 3300025986 | Ga0207658_10277636 | Ga0207658_102776362 | 98 |
| 497 | 3300025986 | Ga0207658_10676452 | Ga0207658_106764522 | 98 |
| 498 | 3300026023 | Ga0207677_10044534 | Ga0207677_100445342 | 98 |
| 499 | 3300026035 | Ga0207703_11301785 | Ga0207703_113017852 | 98 |
| 500 | 3300026035 | Ga0207703_11842410 | Ga0207703_118424101 | 98 |
| 501 | 3300026041 | Ga0207639_10010418 | Ga0207639_100104183 | 98 |
| 502 | 3300026041 | Ga0207639_10128442 | Ga0207639_101284422 | 98 |
| 503 | 3300026067 | Ga0207678_10255098 | Ga0207678_102550983 | 98 |
| 504 | 3300026075 | Ga0207708_10058594 | Ga0207708_100585942 | 98 |
| 505 | 3300026075 | Ga0207708_10219354 | Ga0207708_102193542 | 98 |
| 506 | 3300026075 | Ga0207708_11005798 | Ga0207708_110057982 | 98 |
| 507 | 3300026088 | Ga0207641_10082161 | Ga0207641_100821612 | 98 |
| 508 | 3300026088 | Ga0207641_10299891 | Ga0207641_102998912 | 98 |
| 509 | 3300026089 | Ga0207648_10002644 | Ga0207648_100026447 | 98 |
| 510 | 3300026089 | Ga0207648_10076562 | Ga0207648_100765622 | 98 |
| 511 | 3300026089 | Ga0207648_10139450 | Ga0207648_101394503 | 98 |
| 512 | 3300026095 | Ga0207676_10604333 | Ga0207676_106043332 | 98 |
| 513 | 3300026095 | Ga0207676_11003068 | Ga0207676_110030682 | 98 |
| 514 | 3300026116 | Ga0207674_10001856 | Ga0207674_100018566 | 98 |
| 515 | 3300026116 | Ga0207674_10053595 | Ga0207674_100535954 | 98 |
| 516 | 3300026116 | Ga0207674_10386839 | Ga0207674_103868392 | 98 |
| 517 | 3300026116 | Ga0207674_10624581 | Ga0207674_106245811 | 98 |
| 518 | 3300026116 | Ga0207674_10902001 | Ga0207674_109020012 | 98 |
| 519 | 3300026118 | Ga0207675_100003498 | Ga0207675_1000034989 | 98 |
| 520 | 3300026118 | Ga0207675_100006997 | Ga0207675_1000069976 | 98 |
| 521 | 3300026118 | Ga0207675_100011111 | Ga0207675_1000111118 | 98 |
| 522 | 3300026118 | Ga0207675_100053310 | Ga0207675_1000533103 | 98 |
| 523 | 3300026118 | Ga0207675_100891835 | Ga0207675_1008918352 | 98 |
| 524 | 3300026121 | Ga0207683_10000943 | Ga0207683_1000094319 | 98 |
| 525 | 3300026142 | Ga0207698_12609638 | Ga0207698_126096382 | 98 |
| 526 | 3300027907 | Ga0207428_10028282 | Ga0207428_100282826 | 98 |
| 527 | 3300028379 | Ga0268266_10262957 | Ga0268266_102629572 | 98 |
| 528 | 3300028379 | Ga0268266_10857449 | Ga0268266_108574491 | 98 |
| 529 | 3300028380 | Ga0268265_10360472 | Ga0268265_103604721 | 98 |
| 530 | 3300028380 | Ga0268265_10578627 | Ga0268265_105786272 | 98 |
| 531 | 3300028380 | Ga0268265_10955553 | Ga0268265_109555532 | 98 |
| 532 | 3300028380 | Ga0268265_11085868 | Ga0268265_110858682 | 98 |
| 533 | 3300028380 | Ga0268265_11090925 | Ga0268265_110909251 | 98 |
| 534 | 3300028380 | Ga0268265_11568668 | Ga0268265_115686682 | 98 |
| 535 | 3300028381 | Ga0268264_10001859 | Ga0268264_100018597 | 98 |
| 536 | 3300028381 | Ga0268264_10077792 | Ga0268264_100777922 | 98 |
| 537 | 3300028381 | Ga0268264_10198139 | Ga0268264_101981392 | 98 |
| 538 | 3300028794 | Ga0307515_10000002 | Ga0307515_10000002394 | 98 |
| 539 | 3300028794 | Ga0307515_10631097 | Ga0307515_106310972 | 98 |
| 540 | 3300031548 | Ga0307408_101513119 | Ga0307408_1015131192 | 98 |
| 541 | 3300031730 | Ga0307516_10306853 | Ga0307516_103068532 | 98 |
| 542 | 3300031824 | Ga0307413_11326757 | Ga0307413_113267572 | 98 |
| 543 | 3300031903 | Ga0307407_10681062 | Ga0307407_106810622 | 98 |
| 544 | 3300032002 | Ga0307416_100989056 | Ga0307416_1009890562 | 98 |
| 545 | 3300032002 | Ga0307416_103714075 | Ga0307416_1037140751 | 98 |
| 546 | 3300032126 | Ga0307415_101721566 | Ga0307415_1017215662 | 98 |
| 547 | 3300035113 | Ga0373936_0239539 | Ga0373936_0239539_440_739 | 98 |
| 548 | 3300035120 | Ga0373957_0238696 | Ga0373957_0238696_188_487 | 98 |
| 549 | 3300035170 | Ga0373943_0465097 | Ga0373943_0465097_104_403 | 98 |
| 550 | 3300035172 | Ga0373955_0604520 | Ga0373955_0604520_107_406 | 98 |
| 551 | 3300035724 | Ga0373933_0836023 | Ga0373933_0836023_225_524 | 98 |
| 552 | 3300036401 | Ga0373937_0157412 | Ga0373937_0157412_831_1130 | 98 |
| 553 | 3300036401 | Ga0373937_0288355 | Ga0373937_0288355_1175_1480 | 98 |
| 554 | 3300036401 | Ga0373937_0543129 | Ga0373937_0543129_442_747 | 98 |
| 555 | 3300036401 | Ga0373937_1527002 | Ga0373937_1527002_272_571 | 98 |
| 556 | 3300039437 | Ga0436365_0869194 | Ga0436365_0869194_136_432 | 98 |
| 557 | 3300041459 | Ga0451800_0180239 | Ga0451800_0180239_145_450 | 98 |
| 558 | 3300042125 | Ga0450923_019270 | Ga0450923_019270_340_645 | 98 |
| 559 | 3300042437 | Ga0439444_0050134 | Ga0439444_0050134_80_385 | 98 |
| 560 | 3300042439 | Ga0439464_0178557 | Ga0439464_0178557_266_571 | 98 |
| 561 | 3300042531 | Ga0450918_067729 | Ga0450918_067729_315_620 | 98 |
| 562 | 3300042876 | Ga0451577_1420388 | Ga0451577_1420388_129_425 | 98 |
| 563 | 3300044765 | Ga0466970_0719545 | Ga0466970_0719545_224_538 | 98 |
| 564 | 3300046459 | Ga0495629_0126232 | Ga0495629_0126232_318_617 | 98 |
| 565 | 3300046471 | Ga0495650_0076336 | Ga0495650_0076336_627_932 | 98 |
| 566 | 3300046476 | Ga0495662_0029821 | Ga0495662_0029821_114_413 | 98 |
| 567 | 3300046499 | Ga0495594_0165482 | Ga0495594_0165482_723_1028 | 98 |
| 568 | 3300046517 | Ga0495630_0020530 | Ga0495630_0020530_3981_4280 | 98 |
| 569 | 3300046531 | Ga0495665_0040252 | Ga0495665_0040252_1747_2046 | 98 |
| 570 | 3300046535 | Ga0495586_0449538 | Ga0495586_0449538_216_515 | 98 |
| 571 | 3300046536 | Ga0495587_0196346 | Ga0495587_0196346_244_543 | 98 |
| 572 | 3300046543 | Ga0495645_0081049 | Ga0495645_0081049_157_456 | 98 |
| 573 | 3300046543 | Ga0495645_0528240 | Ga0495645_0528240_97_396 | 98 |
| 574 | 3300046559 | Ga0495667_0738787 | Ga0495667_0738787_58_357 | 98 |
| 575 | 3300046663 | Ga0495635_0414322 | Ga0495635_0414322_361_660 | 98 |
| 576 | 3300046681 | Ga0495647_0074203 | Ga0495647_0074203_352_651 | 98 |
| 577 | 3300046683 | Ga0495658_0338468 | Ga0495658_0338468_637_936 | 98 |
| 578 | 3300046684 | Ga0495669_0459106 | Ga0495669_0459106_135_440 | 98 |
| 579 | 3300046689 | Ga0495613_0156689 | Ga0495613_0156689_1144_1443 | 98 |
| 580 | 3300046690 | Ga0495624_0157733 | Ga0495624_0157733_957_1256 | 98 |
| 581 | 3300046809 | Ga0495600_0608583 | Ga0495600_0608583_109_408 | 98 |
| 582 | 3300047317 | Ga0495604_0759893 | Ga0495604_0759893_55_354 | 98 |
| 583 | 3300047319 | Ga0495674_0540664 | Ga0495674_0540664_396_695 | 98 |
| 584 | 3300047320 | Ga0495672_0012712 | Ga0495672_0012712_2632_2937 | 98 |
| 585 | 3300047320 | Ga0495672_0046640 | Ga0495672_0046640_1274_1573 | 98 |
| 586 | 3300047320 | Ga0495672_0056973 | Ga0495672_0056973_872_1180 | 98 |
| 587 | 3300047444 | Ga0495675_0283314 | Ga0495675_0283314_146_445 | 98 |
| 588 | 3300047471 | Ga0495684_0350016 | Ga0495684_0350016_17_316 | 98 |
| 589 | 3300047472 | Ga0495686_0014005 | Ga0495686_0014005_3999_4301 | 98 |
| 590 | 3300047472 | Ga0495686_0016543 | Ga0495686_0016543_2400_2702 | 98 |
| 591 | 3300048088 | Ga0495602_0698058 | Ga0495602_0698058_357_656 | 98 |
| 592 | 3300048907 | Ga0496104_0856706 | Ga0496104_0856706_71_370 | 98 |
| 593 | 3300048908 | Ga0496105_1176213 | Ga0496105_1176213_21_320 | 98 |
| 594 | 3300048910 | Ga0496107_1116045 | Ga0496107_1116045_87_386 | 98 |
| 595 | 3300049568 | Ga0501031_0005392 | Ga0501031_0005392_4511_4816 | 98 |
| 596 | 3300049568 | Ga0501031_0216466 | Ga0501031_0216466_41_337 | 98 |
| 597 | 3300049569 | Ga0501032_0034263 | Ga0501032_0034263_2969_3265 | 98 |
| 598 | 3300049569 | Ga0501032_0040483 | Ga0501032_0040483_2126_2431 | 98 |
| 599 | 3300049571 | Ga0501034_0126078 | Ga0501034_0126078_1402_1707 | 98 |
| 600 | 3300049572 | Ga0501036_0004749 | Ga0501036_0004749_3307_3612 | 98 |
| 601 | 3300049572 | Ga0501036_0106987 | Ga0501036_0106987_1703_1999 | 98 |
| 602 | 3300049573 | Ga0501037_0272204 | Ga0501037_0272204_22_327 | 98 |
| 603 | 3300049574 | Ga0501038_0011074 | Ga0501038_0011074_1243_1548 | 98 |
| 604 | 3300049574 | Ga0501038_0063668 | Ga0501038_0063668_2730_3026 | 98 |
| 605 | 3300049575 | Ga0501039_0099538 | Ga0501039_0099538_389_685 | 98 |
| 606 | 3300049579 | Ga0501043_0008703 | Ga0501043_0008703_1490_1795 | 98 |
| 607 | 3300049579 | Ga0501043_0069093 | Ga0501043_0069093_225_521 | 98 |
| 608 | 3300049580 | Ga0501046_0042558 | Ga0501046_0042558_2651_2956 | 98 |
| 609 | 3300049580 | Ga0501046_0796391 | Ga0501046_0796391_56_352 | 98 |
| 610 | 3300049581 | Ga0501047_0031811 | Ga0501047_0031811_4688_4984 | 98 |
| 611 | 3300049582 | Ga0501048_0037369 | Ga0501048_0037369_266_562 | 98 |
| 612 | 3300049584 | Ga0501068_0787394 | Ga0501068_0787394_60_365 | 98 |
| 613 | 3300049586 | Ga0501070_0586871 | Ga0501070_0586871_502_798 | 98 |
| 614 | 3300049588 | Ga0501072_0235572 | Ga0501072_0235572_847_1152 | 98 |
| 615 | 3300049589 | Ga0501073_0051186 | Ga0501073_0051186_374_670 | 98 |
| 616 | 3300049589 | Ga0501073_0999434 | Ga0501073_0999434_37_342 | 98 |
| 617 | 3300049590 | Ga0501074_0078227 | Ga0501074_0078227_288_584 | 98 |
| 618 | 3300049591 | Ga0501075_1173551 | Ga0501075_1173551_267_572 | 98 |
| 619 | 3300049742 | Ga0501080_0102847 | Ga0501080_0102847_1491_1796 | 98 |
| 620 | 3300049742 | Ga0501080_0460968 | Ga0501080_0460968_374_670 | 98 |
| 621 | 3300049822 | Ga0501035_0034818 | Ga0501035_0034818_926_1222 | 98 |
| 622 | 3300049822 | Ga0501035_0042535 | Ga0501035_0042535_548_853 | 98 |
| 623 | 3300049823 | Ga0501044_0005613 | Ga0501044_0005613_13592_13897 | 98 |
| 624 | 3300049823 | Ga0501044_0301765 | Ga0501044_0301765_901_1197 | 98 |
| 625 | 3300050493 | nmdc:mga0k408_1636_c1 | nmdc:mga0k408_1636_c1_5078_5380 | 98 |
| 626 | 3300050493 | nmdc:mga0k408_18606_c1 | nmdc:mga0k408_18606_c1_2341_2643 | 98 |
| 627 | 3300050507 | nmdc:mga05p37_285543_c1 | nmdc:mga05p37_285543_c1_565_870 | 98 |
| 628 | 3300050507 | nmdc:mga05p37_381519_c1 | nmdc:mga05p37_381519_c1_336_647 | 98 |
| 629 | 3300050508 | nmdc:mga09592_124074_c1 | nmdc:mga09592_124074_c1_1706_2011 | 98 |
| 630 | 3300050508 | nmdc:mga09592_321370_c1 | nmdc:mga09592_321370_c1_547_858 | 98 |
| 631 | 3300050509 | nmdc:mga0qj67_10091_c1 | nmdc:mga0qj67_10091_c1_3044_3349 | 98 |
| 632 | 3300050509 | nmdc:mga0qj67_80584_c1 | nmdc:mga0qj67_80584_c1_100_411 | 98 |
| 633 | 3300050510 | nmdc:mga06r32_505653_c1 | nmdc:mga06r32_505653_c1_477_788 | 98 |
| 634 | 3300050511 | nmdc:mga08y16_25548_c1 | nmdc:mga08y16_25548_c1_5879_6175 | 98 |
| 635 | 3300053085 | Ga0495619_0070002 | Ga0495619_0070002_1217_1516 | 98 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8acy-assembly1.cif.gz_D | x-ray structure of na+-nqr from vibrio cholerae at 3.5 a resolution | 0.4983 | 6 | 87 |
| 8acy-assembly1.cif.gz_D | x-ray structure of na+-nqr from vibrio cholerae at 3.5 a resolution | 0.4018 | 6 | 87 |
| 1q16-assembly1.cif.gz_C | crystal structure of nitrate reductase a, narghi, from escherichia coli | 0.3659 | 4 | 96 |
| 1q16-assembly1.cif.gz_C | crystal structure of nitrate reductase a, narghi, from escherichia coli | 0.3492 | 4 | 96 |
| 3urz-assembly2.cif.gz_B | crystal structure of a putative protein binding protein (bacova_03105) from bacteroides ovatus atcc 8483 at 2.19 a resolution | 0.2801 | 3 | 87 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G0A8_1_95_1.20.58.80 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit | 0.6054 | 9 | 97 | 1.20.58.80 |
| af_Q46867_3_109_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.5901 | 11 | 95 | 1.20.1070.10 |
| af_Q21780_16_146_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.5296 | 21 | 95 | 1.20.140.150 |
| af_Q46867_3_109_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.5139 | 11 | 95 | 1.20.1070.10 |
| af_Q17953_1_158_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.5133 | 10 | 94 | 1.20.140.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A352CJH6-F1-model_v4 | Uncharacterized protein | 0.998 | 1 | 98 |
GO:0016020
|
| AF-A0A4Q6AKG0-F1-model_v4 | Uncharacterized protein | 0.9656 | 4 | 96 |
GO:0016020
|
| AF-A0A7V9K2P5-F1-model_v4 | DUF368 domain-containing protein | 0.9474 | 1 | 98 |
GO:0016020
|
| AF-A0A2W2BA27-F1-model_v4 | Uncharacterized protein | 0.9428 | 3 | 98 |
GO:0016020
|
| AF-A0A136NL37-F1-model_v4 | deleted | 0.9324 | 8 | 96 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar