F471233

General Info

Members Datasets Scaffolds Average Seq Length
635 264 1270 115

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10564857|Ga0070676_105648572
Length 121
Sequence MKGGVTMLDRDGGLLRGTLDVLILKSLSWGPRHGYAVAEWINVITDGDLLVEEGPLYTALHRLERNGWLDAEWGYSENNRRAKYYELSRSGRQQLRAEVSSWERYARAVGKALSAAAPLSA

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
174 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
178 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
179 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
180 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
181 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
182 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
183 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
184 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
185 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
186 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
187 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
188 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
189 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
190 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
192 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
193 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
194 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
195 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
196 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
197 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
198 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
199 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
200 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
201 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
202 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
203 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
204 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
205 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
206 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
207 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
208 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
209 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
210 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
211 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
212 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
213 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
214 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
215 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
216 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
217 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
218 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
219 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
220 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
221 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
222 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
223 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
224 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
225 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
226 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
227 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
228 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
229 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
230 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
231 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
232 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
233 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
234 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
235 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
236 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
237 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
238 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
239 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
240 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
241 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
251 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
252 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
254 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
255 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
256 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
257 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
258 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
259 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
260 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
261 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
262 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
263 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
264 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.84
Metatranscriptomes 0.16
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.16
Nodule 0
Rhizoplane 0.79
Rhizosphere 98.27
Stem 0
Stem Tuber 0
Unclassified 25.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10564857 3300005328 Bacteria 816
2 Ga0065712_10179368 3300005290 Bacteria 1201
3 Ga0065712_10371000 3300005290 Bacteria 763
4 Ga0065715_10609403 3300005293 Archaea 702
5 Ga0065707_10008806 3300005295 Viruses 3028
6 Ga0065707_11029016 3300005295 Unclassified 532
7 Ga0070658_10181929 3300005327 Bacteria 1769
8 Ga0070676_10178638 3300005328 Unclassified 1378
9 Ga0070676_10624183 3300005328 Bacteria 780
10 Ga0070676_11147098 3300005328 Unclassified 589
11 Ga0070683_100001464 3300005329 Bacteria 18154
12 Ga0070683_100070128 3300005329 Bacteria 3269
13 Ga0070683_100118991 3300005329 Bacteria 2495
14 Ga0070683_100130587 3300005329 Bacteria 2377
15 Ga0070683_100212655 3300005329 Bacteria 1837
16 Ga0070683_100218274 3300005329 Unclassified 1812
17 Ga0070683_100336594 3300005329 Bacteria 1437
18 Ga0070683_100548343 3300005329 Bacteria 1105
19 Ga0070683_100631765 3300005329 Unclassified 1025
20 Ga0070683_101278798 3300005329 Unclassified 705
21 Ga0070690_100008433 3300005330 Bacteria 5934
22 Ga0070690_100017782 3300005330 Bacteria 4283
23 Ga0070670_100001330 3300005331 Bacteria 19746
24 Ga0070670_100093987 3300005331 Unclassified 2579
25 Ga0070670_100441058 3300005331 Bacteria 1153
26 Ga0070670_101129269 3300005331 Unclassified 715
27 Ga0070670_101677435 3300005331 Bacteria 585
28 Ga0070677_10339453 3300005333 Bacteria 775
29 Ga0070677_10526803 3300005333 Unclassified 644
30 Ga0068869_100017064 3300005334 Bacteria 4912
31 Ga0068869_100121433 3300005334 Bacteria 1998
32 Ga0068869_100483889 3300005334 Bacteria 1031
33 Ga0068869_100851634 3300005334 Bacteria 786
34 Ga0070666_10111954 3300005335 Bacteria 1888
35 Ga0070666_10874573 3300005335 Bacteria 664
36 Ga0070680_100000191 3300005336 Bacteria 39498
37 Ga0070680_100007409 3300005336 Bacteria 8376
38 Ga0070680_100011420 3300005336 Bacteria 6870
39 Ga0070680_100158757 3300005336 Bacteria 1900
40 Ga0070680_100207671 3300005336 Bacteria 1652
41 Ga0070680_100243791 3300005336 Unclassified 1519
42 Ga0070680_101182799 3300005336 Bacteria 661
43 Ga0070682_100023254 3300005337 Bacteria 3679
44 Ga0070682_100641613 3300005337 Unclassified 844
45 Ga0070682_101625941 3300005337 Bacteria 559
46 Ga0068868_100048860 3300005338 Bacteria 3320
47 Ga0068868_100399187 3300005338 Bacteria 1186
48 Ga0070660_100033326 3300005339 Bacteria 3883
49 Ga0070660_100178576 3300005339 Bacteria 1717
50 Ga0070689_100040908 3300005340 Bacteria 3555
51 Ga0070687_100015134 3300005343 Bacteria 3479
52 Ga0070687_100075604 3300005343 Bacteria 1822
53 Ga0070687_100215186 3300005343 Bacteria 1173
54 Ga0070661_100002337 3300005344 Bacteria 12999
55 Ga0070661_100086561 3300005344 Bacteria 2317
56 Ga0070661_101357952 3300005344 Unclassified 597
57 Ga0070692_10056076 3300005345 Bacteria 2062
58 Ga0070668_100120956 3300005347 Unclassified 2092
59 Ga0070668_100137626 3300005347 Unclassified 1965
60 Ga0070668_101474075 3300005347 Unclassified 622
61 Ga0070669_100001303 3300005353 Bacteria 18012
62 Ga0070675_100018288 3300005354 Bacteria 5579
63 Ga0070675_100040690 3300005354 Unclassified 3795
64 Ga0070675_100040965 3300005354 Bacteria 3783
65 Ga0070675_100557180 3300005354 Unclassified 1037
66 Ga0070675_101496228 3300005354 Bacteria 623
67 Ga0070671_100080401 3300005355 Bacteria 2725
68 Ga0070671_100681464 3300005355 Bacteria 891
69 Ga0070671_100757824 3300005355 Unclassified 844
70 Ga0070674_100206444 3300005356 Unclassified 1520
71 Ga0070673_100012012 3300005364 Bacteria 5931
72 Ga0070673_100040686 3300005364 Unclassified 3568
73 Ga0070688_100029682 3300005365 Unclassified 3276
74 Ga0070688_100046353 3300005365 Bacteria 2692
75 Ga0070659_100012295 3300005366 Bacteria 6346
76 Ga0070659_100012375 3300005366 Bacteria 6326
77 Ga0070709_10030862 3300005434 Bacteria 3219
78 Ga0070714_100009879 3300005435 Bacteria 7525
79 Ga0070714_100029090 3300005435 Bacteria 4590
80 Ga0070713_100030669 3300005436 Bacteria 4272
81 Ga0070713_100513333 3300005436 Bacteria 1132
82 Ga0070713_101813001 3300005436 Bacteria 592
83 Ga0070710_10901833 3300005437 Bacteria 638
84 Ga0070701_10059569 3300005438 Unclassified 2008
85 Ga0070711_100292216 3300005439 Unclassified 1293
86 Ga0070711_101058707 3300005439 Bacteria 698
87 Ga0070711_101493007 3300005439 Bacteria 589
88 Ga0070705_100677464 3300005440 Bacteria 807
89 Ga0070705_100792449 3300005440 Unclassified 753
90 Ga0070700_100048040 3300005441 Bacteria 2644
91 Ga0070700_101306992 3300005441 Unclassified 610
92 Ga0070694_100076937 3300005444 Bacteria 2311
93 Ga0070694_100812742 3300005444 Unclassified 767
94 Ga0070708_100000082 3300005445 Bacteria 61560
95 Ga0070708_100344090 3300005445 Bacteria 1405
96 Ga0070663_101997713 3300005455 Bacteria 522
97 Ga0070662_100029105 3300005457 Bacteria 3853
98 Ga0070662_100116164 3300005457 Bacteria 2045
99 Ga0070662_100177939 3300005457 Bacteria 1675
100 Ga0070662_101924687 3300005457 Unclassified 511
101 Ga0070681_10005948 3300005458 Bacteria 11812
102 Ga0070681_10007460 3300005458 Bacteria 10690
103 Ga0070681_10028223 3300005458 Bacteria 5642
104 Ga0070681_10349389 3300005458 Bacteria 1389
105 Ga0070681_10360717 3300005458 Bacteria 1363
106 Ga0070681_10857801 3300005458 Bacteria 826
107 Ga0068867_100417537 3300005459 Unclassified 1136
108 Ga0070685_10024272 3300005466 Unclassified 3328
109 Ga0070685_10074953 3300005466 Unclassified 2014
110 Ga0070685_10748778 3300005466 Bacteria 716
111 Ga0070706_100253141 3300005467 Bacteria 1644
112 Ga0070707_100267886 3300005468 Unclassified 1661
113 Ga0070707_100373905 3300005468 Bacteria 1384
114 Ga0070698_100167619 3300005471 Bacteria 2138
115 Ga0070698_100310137 3300005471 Unclassified 1509
116 Ga0070698_100636745 3300005471 Unclassified 1007
117 Ga0070698_101325250 3300005471 Bacteria 670
118 Ga0070699_100790640 3300005518 Bacteria 868
119 Ga0070679_100005588 3300005530 Bacteria 11650
120 Ga0070679_100014440 3300005530 Bacteria 7584
121 Ga0070679_100063168 3300005530 Bacteria 3691
122 Ga0070679_100145358 3300005530 Bacteria 2349
123 Ga0070679_100163935 3300005530 Bacteria 2197
124 Ga0070679_100211752 3300005530 Bacteria 1902
125 Ga0070679_100225966 3300005530 Bacteria 1832
126 Ga0070679_101438600 3300005530 Bacteria 636
127 Ga0070679_102105665 3300005530 Unclassified 514
128 Ga0070684_100017164 3300005535 Bacteria 5933
129 Ga0070684_100023272 3300005535 Bacteria 5178
130 Ga0070684_100023438 3300005535 Bacteria 5164
131 Ga0070684_100093176 3300005535 Bacteria 2681
132 Ga0070684_100138001 3300005535 Bacteria 2203
133 Ga0070684_100154944 3300005535 Unclassified 2077
134 Ga0070684_100161937 3300005535 Unclassified 2030
135 Ga0070684_100170515 3300005535 Bacteria 1976
136 Ga0070684_101712742 3300005535 Bacteria 593
137 Ga0068853_100017109 3300005539 Bacteria 5980
138 Ga0068853_100396992 3300005539 Bacteria 1290
139 Ga0068853_100776775 3300005539 Bacteria 916
140 Ga0070672_100039285 3300005543 Bacteria 3624
141 Ga0070672_100535505 3300005543 Bacteria 1016
142 Ga0070672_100667781 3300005543 Bacteria 908
143 Ga0070686_100253194 3300005544 Bacteria 1287
144 Ga0070695_100108869 3300005545 Unclassified 1877
145 Ga0070693_100011330 3300005547 Bacteria 4489
146 Ga0070693_101091630 3300005547 Unclassified 608
147 Ga0070665_100016594 3300005548 Bacteria 7383
148 Ga0070665_100412448 3300005548 Bacteria 1359
149 Ga0070665_100679094 3300005548 Unclassified 1043
150 Ga0068855_100277447 3300005563 Unclassified 1862
151 Ga0068855_100429205 3300005563 Bacteria 1445
152 Ga0068855_100794688 3300005563 Unclassified 1006
153 Ga0068855_100960427 3300005563 Bacteria 900
154 Ga0068855_102443720 3300005563 Unclassified 521
155 Ga0070664_100018164 3300005564 Bacteria 5773
156 Ga0070664_100057319 3300005564 Bacteria 3311
157 Ga0070664_100968020 3300005564 Unclassified 799
158 Ga0068857_100074474 3300005577 Bacteria 3025
159 Ga0068857_100089279 3300005577 Bacteria 2758
160 Ga0068857_100173583 3300005577 Unclassified 1960
161 Ga0068857_100576432 3300005577 Bacteria 1062
162 Ga0068857_101387629 3300005577 Bacteria 683
163 Ga0068854_100790960 3300005578 Bacteria 826
164 Ga0068854_101256020 3300005578 Bacteria 665
165 Ga0068856_100002684 3300005614 Bacteria 18232
166 Ga0068856_100004353 3300005614 Bacteria 14111
167 Ga0068856_100013979 3300005614 Bacteria 7762
168 Ga0068856_102056282 3300005614 Unclassified 581
169 Ga0068856_102668722 3300005614 Bacteria 505
170 Ga0070702_100026178 3300005615 Bacteria 3132
171 Ga0070702_100130844 3300005615 Bacteria 1585
172 Ga0068852_100005713 3300005616 Bacteria 8924
173 Ga0068852_100042788 3300005616 Bacteria 3837
174 Ga0068852_100599380 3300005616 Bacteria 1106
175 Ga0068852_101032536 3300005616 Unclassified 841
176 Ga0068859_100012014 3300005617 Bacteria 8699
177 Ga0068859_100020065 3300005617 Bacteria 6710
178 Ga0068859_100398340 3300005617 Unclassified 1472
179 Ga0068859_100756221 3300005617 Unclassified 1061
180 Ga0068864_100015579 3300005618 Bacteria 6322
181 Ga0068864_100169803 3300005618 Bacteria 1988
182 Ga0068864_100347862 3300005618 Bacteria 1398
183 Ga0068864_101151651 3300005618 Unclassified 773
184 Ga0068864_102117819 3300005618 Bacteria 569
185 Ga0068866_10780428 3300005718 Unclassified 662
186 Ga0068861_100013213 3300005719 Bacteria 5776
187 Ga0068861_100492352 3300005719 Unclassified 1107
188 Ga0068851_10067544 3300005834 Bacteria 1844
189 Ga0068870_10001964 3300005840 Bacteria 8500
190 Ga0068863_100102676 3300005841 Unclassified 2719
191 Ga0068863_100180182 3300005841 Bacteria 2028
192 Ga0068863_101975906 3300005841 Bacteria 593
193 Ga0068858_100115399 3300005842 Bacteria 2509
194 Ga0068858_100519215 3300005842 Unclassified 1152
195 Ga0068858_100598639 3300005842 Unclassified 1069
196 Ga0068858_101082422 3300005842 Unclassified 787
197 Ga0068860_100008585 3300005843 Bacteria 10184
198 Ga0068860_100381270 3300005843 Unclassified 1392
199 Ga0068862_100000284 3300005844 Bacteria 56346
200 Ga0068862_100032996 3300005844 Bacteria 4374
201 Ga0068862_102262438 3300005844 Unclassified 555
202 Ga0070712_100652965 3300006175 Bacteria 894
203 Ga0070712_100699886 3300006175 Unclassified 864
204 Ga0097621_100087075 3300006237 Bacteria 2607
205 Ga0097621_100308851 3300006237 Bacteria 1398
206 Ga0068871_100003680 3300006358 Bacteria 10536
207 Ga0068871_100720215 3300006358 Bacteria 915
208 Ga0068871_101056232 3300006358 Unclassified 758
209 Ga0075428_100123732 3300006844 Bacteria 2815
210 Ga0075428_101715922 3300006844 Unclassified 655
211 Ga0075430_100011261 3300006846 Bacteria 7587
212 Ga0075431_100012345 3300006847 Bacteria 8620
213 Ga0075431_100166238 3300006847 Bacteria 2268
214 Ga0075431_100178031 3300006847 Unclassified 2183
215 Ga0075431_100497390 3300006847 Viruses 1211
216 Ga0075433_10153940 3300006852 Unclassified 2045
217 Ga0075434_100190440 3300006871 Bacteria 2071
218 Ga0075434_100237581 3300006871 Bacteria 1842
219 Ga0075434_100286154 3300006871 Bacteria 1668
220 Ga0075429_100120697 3300006880 Bacteria 2291
221 Ga0068865_100168839 3300006881 Bacteria 1675
222 Ga0068865_100234285 3300006881 Unclassified 1442
223 Ga0097620_100012012 3300006931 Bacteria 8699
224 Ga0097620_100020065 3300006931 Bacteria 6710
225 Ga0097620_100398346 3300006931 Unclassified 1472
226 Ga0097620_100756101 3300006931 Unclassified 1061
227 Ga0075435_100682599 3300007076 Bacteria 892
228 Ga0105240_10192816 3300009093 Bacteria 2395
229 Ga0105240_10421787 3300009093 Unclassified 1499
230 Ga0105240_10586217 3300009093 Unclassified 1229
231 Ga0111539_10161217 3300009094 Bacteria 2623
232 Ga0111539_10624828 3300009094 Unclassified 1254
233 Ga0111539_13498343 3300009094 Bacteria 504
234 Ga0105245_10006141 3300009098 Bacteria 10570
235 Ga0105245_10047058 3300009098 Unclassified 3856
236 Ga0105245_11983573 3300009098 Unclassified 635
237 Ga0105245_12794261 3300009098 Unclassified 541
238 Ga0105245_12811906 3300009098 Unclassified 539
239 Ga0114129_10020591 3300009147 Bacteria 9380
240 Ga0114129_10509804 3300009147 Unclassified 1570
241 Ga0105243_10166417 3300009148 Bacteria 1906
242 Ga0105241_10004705 3300009174 Bacteria 10068
243 Ga0105241_10194769 3300009174 Bacteria 1689
244 Ga0105241_10487039 3300009174 Bacteria 1097
245 Ga0105241_10916204 3300009174 Bacteria 815
246 Ga0105242_10029345 3300009176 Bacteria 4386
247 Ga0105242_11145460 3300009176 Unclassified 794
248 Ga0105248_10012425 3300009177 Bacteria 9391
249 Ga0105248_10095475 3300009177 Bacteria 3348
250 Ga0105248_10104451 3300009177 Bacteria 3194
251 Ga0105248_10336634 3300009177 Unclassified 1699
252 Ga0105248_10428085 3300009177 Unclassified 1491
253 Ga0105237_10170094 3300009545 Bacteria 2179
254 Ga0105237_10312960 3300009545 Bacteria 1573
255 Ga0105237_10550920 3300009545 Bacteria 1160
256 Ga0105237_10792253 3300009545 Bacteria 955
257 Ga0105237_12594617 3300009545 Bacteria 517
258 Ga0105238_10061187 3300009551 Bacteria 3768
259 Ga0105238_10237393 3300009551 Bacteria 1800
260 Ga0105238_10582545 3300009551 Bacteria 1125
261 Ga0105238_11156366 3300009551 Unclassified 797
262 Ga0105238_11925923 3300009551 Unclassified 624
263 Ga0105249_10000753 3300009553 Bacteria 29119
264 Ga0105249_10215792 3300009553 Bacteria 1885
265 Ga0105239_10241484 3300010375 Bacteria 2027
266 Ga0105239_10909143 3300010375 Bacteria 1010
267 Ga0105239_11884722 3300010375 Unclassified 693
268 Ga0105246_10025787 3300011119 Bacteria 3832
269 Ga0105246_10419613 3300011119 Bacteria 1116
270 Ga0105246_10680146 3300011119 Unclassified 899
271 Ga0105246_10807761 3300011119 Unclassified 833
272 Ga0157373_10007843 3300013100 Bacteria 7939
273 Ga0157373_10436791 3300013100 Bacteria 941
274 Ga0157371_10009492 3300013102 Bacteria 7653
275 Ga0157371_10698210 3300013102 Bacteria 759
276 Ga0157370_10000931 3300013104 Bacteria 37069
277 Ga0157370_10054405 3300013104 Bacteria 3815
278 Ga0157370_11614743 3300013104 Unclassified 582
279 Ga0157369_10124042 3300013105 Unclassified 2740
280 Ga0157369_10188403 3300013105 Bacteria 2168
281 Ga0157369_10311426 3300013105 Unclassified 1637
282 Ga0157369_11431291 3300013105 Unclassified 703
283 Ga0157369_11472344 3300013105 Bacteria 693
284 Ga0157374_10028741 3300013296 Bacteria 5026
285 Ga0157374_10672548 3300013296 Unclassified 1048
286 Ga0157374_12620577 3300013296 Bacteria 532
287 Ga0157378_10752185 3300013297 Unclassified 998
288 Ga0157378_10999029 3300013297 Bacteria 871
289 Ga0157378_11300850 3300013297 Bacteria 768
290 Ga0163162_10678158 3300013306 Bacteria 1153
291 Ga0163162_10935267 3300013306 Unclassified 979
292 Ga0163162_11975392 3300013306 Unclassified 668
293 Ga0157372_10001096 3300013307 Bacteria 29445
294 Ga0157372_10011366 3300013307 Bacteria 9469
295 Ga0157372_10062848 3300013307 Bacteria 4161
296 Ga0157372_10320300 3300013307 Bacteria 1805
297 Ga0157372_10573233 3300013307 Bacteria 1315
298 Ga0157372_10583665 3300013307 Bacteria 1303
299 Ga0157372_12010878 3300013307 Bacteria 664
300 Ga0157372_13101353 3300013307 Bacteria 530
301 Ga0157375_10035826 3300013308 Unclassified 4741
302 Ga0157375_10053748 3300013308 Bacteria 3964
303 Ga0157375_10368387 3300013308 Bacteria 1603
304 Ga0157375_10454917 3300013308 Bacteria 1446
305 Ga0163163_10058566 3300014325 Bacteria 3809
306 Ga0163163_11908580 3300014325 Bacteria 654
307 Ga0157380_10001385 3300014326 Bacteria 15818
308 Ga0157377_10002819 3300014745 Bacteria 7753
309 Ga0157377_11265000 3300014745 Bacteria 575
310 Ga0157379_10652361 3300014968 Bacteria 985
311 Ga0157376_10397263 3300014969 Bacteria 1332
312 Ga0157376_10848557 3300014969 Unclassified 929
313 Ga0163161_11904326 3300017792 Unclassified 529
314 Ga0206353_10624632 3300020082 Bacteria 727
315 Ga0213876_10106420 3300021384 Unclassified 1488
316 Ga0213876_10151538 3300021384 Bacteria 1233
317 Ga0207656_10079914 3300025321 Bacteria 1468
318 Ga0207692_11154390 3300025898 Bacteria 514
319 Ga0207642_10580707 3300025899 Bacteria 695
320 Ga0207680_10080935 3300025903 Bacteria 2040
321 Ga0207680_11190671 3300025903 Unclassified 543
322 Ga0207645_10126679 3300025907 Bacteria 1660
323 Ga0207645_10984035 3300025907 Unclassified 572
324 Ga0207645_11056920 3300025907 Bacteria 549
325 Ga0207643_10003933 3300025908 Bacteria 7992
326 Ga0207643_10021277 3300025908 Bacteria 3562
327 Ga0207705_10176793 3300025909 Bacteria 1609
328 Ga0207684_10026151 3300025910 Bacteria 4974
329 Ga0207684_10212892 3300025910 Bacteria 1667
330 Ga0207654_10066170 3300025911 Bacteria 2131
331 Ga0207654_10352308 3300025911 Bacteria 1014
332 Ga0207654_10363058 3300025911 Bacteria 999
333 Ga0207707_10009854 3300025912 Bacteria 8282
334 Ga0207707_10029820 3300025912 Bacteria 4771
335 Ga0207707_10377369 3300025912 Bacteria 1219
336 Ga0207707_10511459 3300025912 Bacteria 1023
337 Ga0207707_10719489 3300025912 Bacteria 837
338 Ga0207707_10842907 3300025912 Unclassified 761
339 Ga0207695_10111555 3300025913 Bacteria 2714
340 Ga0207695_10141036 3300025913 Bacteria 2359
341 Ga0207671_10189640 3300025914 Bacteria 1603
342 Ga0207671_11248783 3300025914 Unclassified 580
343 Ga0207671_11396628 3300025914 Bacteria 543
344 Ga0207693_10345921 3300025915 Bacteria 1164
345 Ga0207663_11087977 3300025916 Bacteria 642
346 Ga0207660_10000011 3300025917 Bacteria 89179
347 Ga0207660_10020737 3300025917 Bacteria 4416
348 Ga0207660_10074650 3300025917 Unclassified 2475
349 Ga0207660_10196796 3300025917 Bacteria 1572
350 Ga0207660_10354842 3300025917 Unclassified 1176
351 Ga0207660_10540087 3300025917 Bacteria 948
352 Ga0207660_10803712 3300025917 Bacteria 767
353 Ga0207662_10024354 3300025918 Bacteria 3484
354 Ga0207662_10116566 3300025918 Bacteria 1670
355 Ga0207662_10206874 3300025918 Bacteria 1273
356 Ga0207662_10690718 3300025918 Bacteria 715
357 Ga0207657_10000706 3300025919 Bacteria 35487
358 Ga0207657_10045290 3300025919 Bacteria 3862
359 Ga0207649_10073667 3300025920 Bacteria 2188
360 Ga0207649_10250998 3300025920 Bacteria 1274
361 Ga0207649_10712259 3300025920 Bacteria 779
362 Ga0207652_10006661 3300025921 Bacteria 9305
363 Ga0207652_10011121 3300025921 Bacteria 7254
364 Ga0207652_10046306 3300025921 Bacteria 3711
365 Ga0207652_10056419 3300025921 Bacteria 3381
366 Ga0207652_10161586 3300025921 Bacteria 2008
367 Ga0207652_10278606 3300025921 Bacteria 1508
368 Ga0207652_10428574 3300025921 Bacteria 1193
369 Ga0207652_10536997 3300025921 Bacteria 1052
370 Ga0207652_10696057 3300025921 Bacteria 907
371 Ga0207652_10718748 3300025921 Bacteria 890
372 Ga0207646_10705299 3300025922 Bacteria 902
373 Ga0207681_10000807 3300025923 Bacteria 20624
374 Ga0207681_10106993 3300025923 Bacteria 2028
375 Ga0207681_10355314 3300025923 Bacteria 1174
376 Ga0207681_11296517 3300025923 Unclassified 612
377 Ga0207681_11648798 3300025923 Bacteria 536
378 Ga0207694_10066049 3300025924 Bacteria 2821
379 Ga0207694_10513356 3300025924 Bacteria 1004
380 Ga0207694_10839492 3300025924 Bacteria 776
381 Ga0207694_11265804 3300025924 Unclassified 624
382 Ga0207650_10063192 3300025925 Bacteria 2767
383 Ga0207650_10126361 3300025925 Unclassified 1996
384 Ga0207650_10432404 3300025925 Bacteria 1093
385 Ga0207650_10584483 3300025925 Bacteria 938
386 Ga0207650_10891448 3300025925 Bacteria 755
387 Ga0207659_10041233 3300025926 Unclassified 3232
388 Ga0207659_10049899 3300025926 Bacteria 2970
389 Ga0207659_10252498 3300025926 Unclassified 1431
390 Ga0207659_10663659 3300025926 Unclassified 892
391 Ga0207659_10790145 3300025926 Unclassified 815
392 Ga0207659_11161157 3300025926 Unclassified 664
393 Ga0207659_11523897 3300025926 Unclassified 572
394 Ga0207687_10061052 3300025927 Bacteria 2661
395 Ga0207687_10636896 3300025927 Bacteria 901
396 Ga0207687_11334319 3300025927 Bacteria 617
397 Ga0207700_10043783 3300025928 Bacteria 3291
398 Ga0207700_10700453 3300025928 Unclassified 904
399 Ga0207700_11901969 3300025928 Bacteria 521
400 Ga0207700_11917237 3300025928 Bacteria 519
401 Ga0207664_10058744 3300025929 Bacteria 3061
402 Ga0207664_10355815 3300025929 Bacteria 1296
403 Ga0207664_10559265 3300025929 Bacteria 1026
404 Ga0207644_10022108 3300025931 Bacteria 4342
405 Ga0207690_10069680 3300025932 Bacteria 2420
406 Ga0207690_10167323 3300025932 Bacteria 1644
407 Ga0207706_10018776 3300025933 Bacteria 6219
408 Ga0207706_10128618 3300025933 Bacteria 2227
409 Ga0207706_10163081 3300025933 Bacteria 1959
410 Ga0207706_10323942 3300025933 Bacteria 1341
411 Ga0207686_10101598 3300025934 Bacteria 1921
412 Ga0207709_10680050 3300025935 Unclassified 822
413 Ga0207670_10031449 3300025936 Unclassified 3402
414 Ga0207670_10526249 3300025936 Unclassified 963
415 Ga0207669_10323174 3300025937 Bacteria 1182
416 Ga0207704_10098688 3300025938 Bacteria 1941
417 Ga0207704_10711074 3300025938 Unclassified 833
418 Ga0207704_10862582 3300025938 Bacteria 759
419 Ga0207711_10093868 3300025941 Bacteria 2643
420 Ga0207711_10127194 3300025941 Bacteria 2281
421 Ga0207711_10191955 3300025941 Bacteria 1862
422 Ga0207711_10754048 3300025941 Bacteria 907
423 Ga0207711_11001380 3300025941 Bacteria 775
424 Ga0207711_11809490 3300025941 Unclassified 554
425 Ga0207689_10003025 3300025942 Bacteria 15492
426 Ga0207689_10026579 3300025942 Unclassified 4848
427 Ga0207689_10353922 3300025942 Unclassified 1221
428 Ga0207661_10001815 3300025944 Bacteria 14600
429 Ga0207661_10003734 3300025944 Bacteria 10606
430 Ga0207661_10017097 3300025944 Bacteria 5359
431 Ga0207661_10034323 3300025944 Bacteria 3944
432 Ga0207661_10108904 3300025944 Bacteria 2340
433 Ga0207661_10170145 3300025944 Bacteria 1896
434 Ga0207661_10235652 3300025944 Unclassified 1622
435 Ga0207661_10302009 3300025944 Unclassified 1435
436 Ga0207661_10511707 3300025944 Bacteria 1097
437 Ga0207661_11198866 3300025944 Bacteria 699
438 Ga0207679_10003366 3300025945 Bacteria 9869
439 Ga0207679_10030681 3300025945 Bacteria 3756
440 Ga0207679_10039853 3300025945 Unclassified 3358
441 Ga0207679_11842123 3300025945 Bacteria 552
442 Ga0207667_10244784 3300025949 Bacteria 1835
443 Ga0207667_10517414 3300025949 Bacteria 1209
444 Ga0207667_11592435 3300025949 Bacteria 622
445 Ga0207651_11443930 3300025960 Bacteria 619
446 Ga0207712_10002714 3300025961 Bacteria 11305
447 Ga0207712_10347850 3300025961 Bacteria 1231
448 Ga0207712_11203187 3300025961 Unclassified 676
449 Ga0207668_10122506 3300025972 Unclassified 1971
450 Ga0207668_11292610 3300025972 Bacteria 657
451 Ga0207668_11990705 3300025972 Unclassified 523
452 Ga0207658_10268996 3300025986 Unclassified 1456
453 Ga0207658_10620451 3300025986 Unclassified 973
454 Ga0207658_10660290 3300025986 Bacteria 943
455 Ga0207677_10257165 3300026023 Bacteria 1421
456 Ga0207677_11982987 3300026023 Unclassified 541
457 Ga0207703_10093832 3300026035 Bacteria 2528
458 Ga0207703_10861343 3300026035 Unclassified 867
459 Ga0207703_11156532 3300026035 Bacteria 744
460 Ga0207639_10027543 3300026041 Bacteria 4141
461 Ga0207639_10086769 3300026041 Bacteria 2493
462 Ga0207639_10096170 3300026041 Bacteria 2382
463 Ga0207639_10763335 3300026041 Bacteria 900
464 Ga0207678_10918948 3300026067 Bacteria 774
465 Ga0207708_10042857 3300026075 Bacteria 3448
466 Ga0207708_10149769 3300026075 Bacteria 1836
467 Ga0207702_10020409 3300026078 Bacteria 5489
468 Ga0207702_10026272 3300026078 Bacteria 4832
469 Ga0207702_10321437 3300026078 Bacteria 1474
470 Ga0207702_11933508 3300026078 Unclassified 581
471 Ga0207641_10017059 3300026088 Bacteria 5941
472 Ga0207641_10170181 3300026088 Bacteria 1988
473 Ga0207641_10715148 3300026088 Unclassified 987
474 Ga0207648_10300026 3300026089 Bacteria 1440
475 Ga0207648_11245675 3300026089 Bacteria 699
476 Ga0207676_10020281 3300026095 Bacteria 4861
477 Ga0207676_10186842 3300026095 Unclassified 1820
478 Ga0207676_10365238 3300026095 Bacteria 1339
479 Ga0207676_10687871 3300026095 Unclassified 990
480 Ga0207674_10000227 3300026116 Bacteria 70334
481 Ga0207674_10014219 3300026116 Bacteria 8795
482 Ga0207674_10104031 3300026116 Bacteria 2818
483 Ga0207674_10564058 3300026116 Bacteria 1100
484 Ga0207675_100018037 3300026118 Bacteria 6582
485 Ga0207675_100437339 3300026118 Bacteria 1294
486 Ga0207698_10302467 3300026142 Bacteria 1489
487 Ga0207698_10842992 3300026142 Bacteria 921
488 Ga0268266_10053642 3300028379 Bacteria 3464
489 Ga0268266_10559467 3300028379 Unclassified 1096
490 Ga0268265_10011564 3300028380 Bacteria 5967
491 Ga0268265_10074569 3300028380 Bacteria 2655
492 Ga0268264_10038496 3300028381 Bacteria 3947
493 Ga0268264_10133086 3300028381 Unclassified 2207
494 Ga0268264_11338018 3300028381 Unclassified 727
495 Ga0265331_10312019 3300031250 Bacteria 704
496 Ga0307405_11132025 3300031731 Unclassified 674
497 Ga0307412_11966549 3300031911 Bacteria 541
498 Ga0307412_11972407 3300031911 Unclassified 540
499 Ga0307416_100950609 3300032002 Bacteria 961
500 Ga0373958_0077743 3300034819 Unclassified 747
501 Ga0373926_0107705 3300035083 Unclassified 1046
502 Ga0373934_0001667 3300035086 Bacteria 8156
503 Ga0373936_0165622 3300035113 Bacteria 965
504 Ga0373941_0033952 3300035115 Bacteria 1536
505 Ga0373953_0006997 3300035117 Unclassified 3753
506 Ga0373954_0022074 3300035118 Bacteria 2886
507 Ga0373956_0032740 3300035119 Bacteria 2282
508 Ga0373956_0258034 3300035119 Bacteria 829
509 Ga0373957_0050896 3300035120 Unclassified 1584
510 Ga0373943_0170459 3300035170 Bacteria 1191
511 Ga0373955_0007590 3300035172 Unclassified 4993
512 Ga0373955_0210972 3300035172 Bacteria 1158
513 Ga0373924_0370385 3300035410 Bacteria 639
514 Ga0373931_0129224 3300035691 Bacteria 1452
515 Ga0373935_0160907 3300035692 Bacteria 1530
516 Ga0373935_0497218 3300035692 Bacteria 885
517 Ga0373927_0050306 3300035695 Bacteria 2694
518 Ga0373927_0277681 3300035695 Bacteria 1102
519 Ga0373927_0659434 3300035695 Bacteria 691
520 Ga0373933_0025916 3300035724 Unclassified 3364
521 Ga0373933_0039935 3300035724 Bacteria 2762
522 Ga0373947_0203832 3300035725 Bacteria 1295
523 Ga0373947_0254417 3300035725 Bacteria 1162
524 Ga0373937_0012133 3300036401 Bacteria 7564
525 Ga0373937_0027726 3300036401 Bacteria 5124
526 Ga0395901_1568011 3300038443 Bacteria 613
527 Ga0436365_0324979 3300039437 Bacteria 856
528 Ga0436365_1421576 3300039437 Bacteria 1563
529 Ga0436365_1446180 3300039437 Unclassified 2998
530 Ga0466963_0253083 3300044694 Bacteria 1236
531 Ga0466957_0155759 3300044842 Bacteria 1481
532 Ga0466957_0879204 3300044842 Bacteria 640
533 Ga0451576_0093494 3300045051 Bacteria 3127
534 Ga0466967_0013129 3300045976 Bacteria 6383
535 Ga0466967_0105237 3300045976 Bacteria 2585
536 Ga0466967_0561491 3300045976 Bacteria 1124
537 Ga0466967_1959344 3300045976 Bacteria 582
538 Ga0495592_0402625 3300046454 Bacteria 866
539 Ga0495629_0055296 3300046459 Bacteria 2775
540 Ga0495629_0140321 3300046459 Bacteria 1682
541 Ga0495629_0340228 3300046459 Bacteria 1024
542 Ga0495651_0004956 3300046462 Bacteria 10169
543 Ga0495653_0032333 3300046463 Unclassified 4155
544 Ga0495580_0038348 3300046472 Bacteria 3432
545 Ga0495580_0042850 3300046472 Unclassified 3222
546 Ga0495582_0038397 3300046473 Bacteria 2635
547 Ga0495582_0217297 3300046473 Bacteria 1093
548 Ga0495639_0170883 3300046475 Bacteria 1055
549 Ga0495662_0496025 3300046476 Bacteria 599
550 Ga0495594_0007965 3300046499 Bacteria 5447
551 Ga0495594_0013751 3300046499 Bacteria 4230
552 Ga0495594_0479444 3300046499 Unclassified 707
553 Ga0495594_0728149 3300046499 Unclassified 560
554 Ga0495608_0167378 3300046511 Bacteria 1395
555 Ga0495618_0099696 3300046514 Bacteria 1859
556 Ga0495628_0067279 3300046516 Unclassified 2798
557 Ga0495630_0090320 3300046517 Bacteria 2314
558 Ga0495666_0032125 3300046526 Bacteria 2571
559 Ga0495666_0044157 3300046526 Bacteria 2152
560 Ga0495652_0037262 3300046529 Unclassified 4219
561 Ga0495652_0732848 3300046529 Unclassified 663
562 Ga0495665_0010277 3300046531 Bacteria 5066
563 Ga0495586_0085973 3300046535 Bacteria 1733
564 Ga0495586_0112182 3300046535 Bacteria 1518
565 Ga0495587_0000927 3300046536 Bacteria 19295
566 Ga0495645_0000527 3300046543 Bacteria 26354
567 Ga0495645_0005444 3300046543 Bacteria 8738
568 Ga0495667_0002052 3300046559 Bacteria 13360
569 Ga0495667_0041581 3300046559 Bacteria 3048
570 Ga0495625_0133499 3300046660 Bacteria 1680
571 Ga0495635_0041545 3300046663 Unclassified 3176
572 Ga0495588_0546988 3300046674 Unclassified 607
573 Ga0495657_0030449 3300046675 Bacteria 3779
574 Ga0495657_0170895 3300046675 Unclassified 1339
575 Ga0495599_0034405 3300046678 Unclassified 3183
576 Ga0495646_0137397 3300046680 Bacteria 1370
577 Ga0495658_0033402 3300046683 Bacteria 2817
578 Ga0495658_0229501 3300046683 Bacteria 1164
579 Ga0495624_0288873 3300046690 Bacteria 990
580 Ga0495581_0013502 3300047315 Bacteria 4738
581 Ga0495581_0267610 3300047315 Bacteria 999
582 Ga0495604_0011541 3300047317 Bacteria 7021
583 Ga0495674_0118383 3300047319 Bacteria 2239
584 Ga0495674_0153406 3300047319 Bacteria 1931
585 Ga0495674_0991167 3300047319 Bacteria 644
586 Ga0495672_0019791 3300047320 Bacteria 4430
587 Ga0495675_0041322 3300047444 Unclassified 2940
588 Ga0495675_0165679 3300047444 Bacteria 1359
589 Ga0495684_0004869 3300047471 Bacteria 10474
590 Ga0495684_0005973 3300047471 Bacteria 9457
591 Ga0495684_0554064 3300047471 Bacteria 782
592 Ga0495684_0779731 3300047471 Unclassified 626
593 Ga0495593_0623569 3300047673 Unclassified 541
594 Ga0495602_0634839 3300048088 Bacteria 731
595 Ga0496104_0318279 3300048907 Unclassified 1469
596 Ga0496108_0294051 3300048911 Bacteria 1414
597 Ga0496112_0037232 3300048915 Bacteria 4748
598 Ga0496112_0727883 3300048915 Bacteria 919
599 Ga0496115_0748744 3300048918 Unclassified 764
600 Ga0501031_1044917 3300049568 Bacteria 522
601 Ga0501032_0225411 3300049569 Bacteria 1219
602 Ga0501033_0216960 3300049570 Bacteria 1363
603 Ga0501033_0251682 3300049570 Bacteria 1252
604 Ga0501036_0522633 3300049572 Bacteria 987
605 Ga0501036_1343320 3300049572 Bacteria 580
606 Ga0501037_0637415 3300049573 Bacteria 713
607 Ga0501038_0251941 3300049574 Bacteria 1398
608 Ga0501039_0286966 3300049575 Bacteria 1294
609 Ga0501043_0839357 3300049579 Bacteria 662
610 Ga0501047_0091501 3300049581 Bacteria 2920
611 Ga0501070_0212813 3300049586 Bacteria 1586
612 Ga0501070_1212599 3300049586 Bacteria 579
613 Ga0501073_0106128 3300049589 Bacteria 1949
614 Ga0501035_0234994 3300049822 Bacteria 1561
615 Ga0501044_1148999 3300049823 Bacteria 645
616 nmdc:mga05p37_1788851_c1 3300050507 Unclassified 594
617 nmdc:mga05p37_33030_c1 3300050507 Bacteria 6336
618 nmdc:mga09592_112088_c1 3300050508 Bacteria 2340
619 nmdc:mga09592_182564_c1 3300050508 Unclassified 1815
620 nmdc:mga0qj67_72440_c1 3300050509 Bacteria 2751
621 nmdc:mga06r32_1013091_c1 3300050510 Bacteria 783
622 nmdc:mga06r32_27407_c1 3300050510 Bacteria 5322
623 nmdc:mga06r32_803395_c1 3300050510 Bacteria 901
624 nmdc:mga08y16_1730020_c1 3300050511 Bacteria 580
625 nmdc:mga08y16_51545_c1 3300050511 Bacteria 4305
626 nmdc:mga08y16_617074_c1 3300050511 Bacteria 1092
627 nmdc:mga0n895_205333_c1 3300050512 Bacteria 2001
628 nmdc:mga0n895_234132_c1 3300050512 Bacteria 1864
629 nmdc:mga0rr50_1547690_c1 3300050513 Unclassified 560
630 nmdc:mga0rr50_435467_c1 3300050513 Bacteria 1110
631 nmdc:mga0a205_131026_c1 3300050515 Unclassified 2408
632 nmdc:mga0a205_16536_c1 3300050515 Bacteria 6910
633 Ga0495601_0056103 3300053077 Bacteria 2495
634 Ga0495619_0262754 3300053085 Bacteria 1196
635 Ga0500641_0389225 3300053096 Bacteria 551
636 Ga0070676_10564857
637 Ga0065712_10179368
638 Ga0065712_10371000
639 Ga0065715_10609403
640 Ga0065707_10008806
641 Ga0065707_11029016
642 Ga0070658_10181929
643 Ga0070676_10178638
644 Ga0070676_10624183
645 Ga0070676_11147098
646 Ga0070683_100001464
647 Ga0070683_100070128
648 Ga0070683_100118991
649 Ga0070683_100130587
650 Ga0070683_100212655
651 Ga0070683_100218274
652 Ga0070683_100336594
653 Ga0070683_100548343
654 Ga0070683_100631765
655 Ga0070683_101278798
656 Ga0070690_100008433
657 Ga0070690_100017782
658 Ga0070670_100001330
659 Ga0070670_100093987
660 Ga0070670_100441058
661 Ga0070670_101129269
662 Ga0070670_101677435
663 Ga0070677_10339453
664 Ga0070677_10526803
665 Ga0068869_100017064
666 Ga0068869_100121433
667 Ga0068869_100483889
668 Ga0068869_100851634
669 Ga0070666_10111954
670 Ga0070666_10874573
671 Ga0070680_100000191
672 Ga0070680_100007409
673 Ga0070680_100011420
674 Ga0070680_100158757
675 Ga0070680_100207671
676 Ga0070680_100243791
677 Ga0070680_101182799
678 Ga0070682_100023254
679 Ga0070682_100641613
680 Ga0070682_101625941
681 Ga0068868_100048860
682 Ga0068868_100399187
683 Ga0070660_100033326
684 Ga0070660_100178576
685 Ga0070689_100040908
686 Ga0070687_100015134
687 Ga0070687_100075604
688 Ga0070687_100215186
689 Ga0070661_100002337
690 Ga0070661_100086561
691 Ga0070661_101357952
692 Ga0070692_10056076
693 Ga0070668_100120956
694 Ga0070668_100137626
695 Ga0070668_101474075
696 Ga0070669_100001303
697 Ga0070675_100018288
698 Ga0070675_100040690
699 Ga0070675_100040965
700 Ga0070675_100557180
701 Ga0070675_101496228
702 Ga0070671_100080401
703 Ga0070671_100681464
704 Ga0070671_100757824
705 Ga0070674_100206444
706 Ga0070673_100012012
707 Ga0070673_100040686
708 Ga0070688_100029682
709 Ga0070688_100046353
710 Ga0070659_100012295
711 Ga0070659_100012375
712 Ga0070709_10030862
713 Ga0070714_100009879
714 Ga0070714_100029090
715 Ga0070713_100030669
716 Ga0070713_100513333
717 Ga0070713_101813001
718 Ga0070710_10901833
719 Ga0070701_10059569
720 Ga0070711_100292216
721 Ga0070711_101058707
722 Ga0070711_101493007
723 Ga0070705_100677464
724 Ga0070705_100792449
725 Ga0070700_100048040
726 Ga0070700_101306992
727 Ga0070694_100076937
728 Ga0070694_100812742
729 Ga0070708_100000082
730 Ga0070708_100344090
731 Ga0070663_101997713
732 Ga0070662_100029105
733 Ga0070662_100116164
734 Ga0070662_100177939
735 Ga0070662_101924687
736 Ga0070681_10005948
737 Ga0070681_10007460
738 Ga0070681_10028223
739 Ga0070681_10349389
740 Ga0070681_10360717
741 Ga0070681_10857801
742 Ga0068867_100417537
743 Ga0070685_10024272
744 Ga0070685_10074953
745 Ga0070685_10748778
746 Ga0070706_100253141
747 Ga0070707_100267886
748 Ga0070707_100373905
749 Ga0070698_100167619
750 Ga0070698_100310137
751 Ga0070698_100636745
752 Ga0070698_101325250
753 Ga0070699_100790640
754 Ga0070679_100005588
755 Ga0070679_100014440
756 Ga0070679_100063168
757 Ga0070679_100145358
758 Ga0070679_100163935
759 Ga0070679_100211752
760 Ga0070679_100225966
761 Ga0070679_101438600
762 Ga0070679_102105665
763 Ga0070684_100017164
764 Ga0070684_100023272
765 Ga0070684_100023438
766 Ga0070684_100093176
767 Ga0070684_100138001
768 Ga0070684_100154944
769 Ga0070684_100161937
770 Ga0070684_100170515
771 Ga0070684_101712742
772 Ga0068853_100017109
773 Ga0068853_100396992
774 Ga0068853_100776775
775 Ga0070672_100039285
776 Ga0070672_100535505
777 Ga0070672_100667781
778 Ga0070686_100253194
779 Ga0070695_100108869
780 Ga0070693_100011330
781 Ga0070693_101091630
782 Ga0070665_100016594
783 Ga0070665_100412448
784 Ga0070665_100679094
785 Ga0068855_100277447
786 Ga0068855_100429205
787 Ga0068855_100794688
788 Ga0068855_100960427
789 Ga0068855_102443720
790 Ga0070664_100018164
791 Ga0070664_100057319
792 Ga0070664_100968020
793 Ga0068857_100074474
794 Ga0068857_100089279
795 Ga0068857_100173583
796 Ga0068857_100576432
797 Ga0068857_101387629
798 Ga0068854_100790960
799 Ga0068854_101256020
800 Ga0068856_100002684
801 Ga0068856_100004353
802 Ga0068856_100013979
803 Ga0068856_102056282
804 Ga0068856_102668722
805 Ga0070702_100026178
806 Ga0070702_100130844
807 Ga0068852_100005713
808 Ga0068852_100042788
809 Ga0068852_100599380
810 Ga0068852_101032536
811 Ga0068859_100012014
812 Ga0068859_100020065
813 Ga0068859_100398340
814 Ga0068859_100756221
815 Ga0068864_100015579
816 Ga0068864_100169803
817 Ga0068864_100347862
818 Ga0068864_101151651
819 Ga0068864_102117819
820 Ga0068866_10780428
821 Ga0068861_100013213
822 Ga0068861_100492352
823 Ga0068851_10067544
824 Ga0068870_10001964
825 Ga0068863_100102676
826 Ga0068863_100180182
827 Ga0068863_101975906
828 Ga0068858_100115399
829 Ga0068858_100519215
830 Ga0068858_100598639
831 Ga0068858_101082422
832 Ga0068860_100008585
833 Ga0068860_100381270
834 Ga0068862_100000284
835 Ga0068862_100032996
836 Ga0068862_102262438
837 Ga0070712_100652965
838 Ga0070712_100699886
839 Ga0097621_100087075
840 Ga0097621_100308851
841 Ga0068871_100003680
842 Ga0068871_100720215
843 Ga0068871_101056232
844 Ga0075428_100123732
845 Ga0075428_101715922
846 Ga0075430_100011261
847 Ga0075431_100012345
848 Ga0075431_100166238
849 Ga0075431_100178031
850 Ga0075431_100497390
851 Ga0075433_10153940
852 Ga0075434_100190440
853 Ga0075434_100237581
854 Ga0075434_100286154
855 Ga0075429_100120697
856 Ga0068865_100168839
857 Ga0068865_100234285
858 Ga0097620_100012012
859 Ga0097620_100020065
860 Ga0097620_100398346
861 Ga0097620_100756101
862 Ga0075435_100682599
863 Ga0105240_10192816
864 Ga0105240_10421787
865 Ga0105240_10586217
866 Ga0111539_10161217
867 Ga0111539_10624828
868 Ga0111539_13498343
869 Ga0105245_10006141
870 Ga0105245_10047058
871 Ga0105245_11983573
872 Ga0105245_12794261
873 Ga0105245_12811906
874 Ga0114129_10020591
875 Ga0114129_10509804
876 Ga0105243_10166417
877 Ga0105241_10004705
878 Ga0105241_10194769
879 Ga0105241_10487039
880 Ga0105241_10916204
881 Ga0105242_10029345
882 Ga0105242_11145460
883 Ga0105248_10012425
884 Ga0105248_10095475
885 Ga0105248_10104451
886 Ga0105248_10336634
887 Ga0105248_10428085
888 Ga0105237_10170094
889 Ga0105237_10312960
890 Ga0105237_10550920
891 Ga0105237_10792253
892 Ga0105237_12594617
893 Ga0105238_10061187
894 Ga0105238_10237393
895 Ga0105238_10582545
896 Ga0105238_11156366
897 Ga0105238_11925923
898 Ga0105249_10000753
899 Ga0105249_10215792
900 Ga0105239_10241484
901 Ga0105239_10909143
902 Ga0105239_11884722
903 Ga0105246_10025787
904 Ga0105246_10419613
905 Ga0105246_10680146
906 Ga0105246_10807761
907 Ga0157373_10007843
908 Ga0157373_10436791
909 Ga0157371_10009492
910 Ga0157371_10698210
911 Ga0157370_10000931
912 Ga0157370_10054405
913 Ga0157370_11614743
914 Ga0157369_10124042
915 Ga0157369_10188403
916 Ga0157369_10311426
917 Ga0157369_11431291
918 Ga0157369_11472344
919 Ga0157374_10028741
920 Ga0157374_10672548
921 Ga0157374_12620577
922 Ga0157378_10752185
923 Ga0157378_10999029
924 Ga0157378_11300850
925 Ga0163162_10678158
926 Ga0163162_10935267
927 Ga0163162_11975392
928 Ga0157372_10001096
929 Ga0157372_10011366
930 Ga0157372_10062848
931 Ga0157372_10320300
932 Ga0157372_10573233
933 Ga0157372_10583665
934 Ga0157372_12010878
935 Ga0157372_13101353
936 Ga0157375_10035826
937 Ga0157375_10053748
938 Ga0157375_10368387
939 Ga0157375_10454917
940 Ga0163163_10058566
941 Ga0163163_11908580
942 Ga0157380_10001385
943 Ga0157377_10002819
944 Ga0157377_11265000
945 Ga0157379_10652361
946 Ga0157376_10397263
947 Ga0157376_10848557
948 Ga0163161_11904326
949 Ga0206353_10624632
950 Ga0213876_10106420
951 Ga0213876_10151538
952 Ga0207656_10079914
953 Ga0207692_11154390
954 Ga0207642_10580707
955 Ga0207680_10080935
956 Ga0207680_11190671
957 Ga0207645_10126679
958 Ga0207645_10984035
959 Ga0207645_11056920
960 Ga0207643_10003933
961 Ga0207643_10021277
962 Ga0207705_10176793
963 Ga0207684_10026151
964 Ga0207684_10212892
965 Ga0207654_10066170
966 Ga0207654_10352308
967 Ga0207654_10363058
968 Ga0207707_10009854
969 Ga0207707_10029820
970 Ga0207707_10377369
971 Ga0207707_10511459
972 Ga0207707_10719489
973 Ga0207707_10842907
974 Ga0207695_10111555
975 Ga0207695_10141036
976 Ga0207671_10189640
977 Ga0207671_11248783
978 Ga0207671_11396628
979 Ga0207693_10345921
980 Ga0207663_11087977
981 Ga0207660_10000011
982 Ga0207660_10020737
983 Ga0207660_10074650
984 Ga0207660_10196796
985 Ga0207660_10354842
986 Ga0207660_10540087
987 Ga0207660_10803712
988 Ga0207662_10024354
989 Ga0207662_10116566
990 Ga0207662_10206874
991 Ga0207662_10690718
992 Ga0207657_10000706
993 Ga0207657_10045290
994 Ga0207649_10073667
995 Ga0207649_10250998
996 Ga0207649_10712259
997 Ga0207652_10006661
998 Ga0207652_10011121
999 Ga0207652_10046306
1000 Ga0207652_10056419
1001 Ga0207652_10161586
1002 Ga0207652_10278606
1003 Ga0207652_10428574
1004 Ga0207652_10536997
1005 Ga0207652_10696057
1006 Ga0207652_10718748
1007 Ga0207646_10705299
1008 Ga0207681_10000807
1009 Ga0207681_10106993
1010 Ga0207681_10355314
1011 Ga0207681_11296517
1012 Ga0207681_11648798
1013 Ga0207694_10066049
1014 Ga0207694_10513356
1015 Ga0207694_10839492
1016 Ga0207694_11265804
1017 Ga0207650_10063192
1018 Ga0207650_10126361
1019 Ga0207650_10432404
1020 Ga0207650_10584483
1021 Ga0207650_10891448
1022 Ga0207659_10041233
1023 Ga0207659_10049899
1024 Ga0207659_10252498
1025 Ga0207659_10663659
1026 Ga0207659_10790145
1027 Ga0207659_11161157
1028 Ga0207659_11523897
1029 Ga0207687_10061052
1030 Ga0207687_10636896
1031 Ga0207687_11334319
1032 Ga0207700_10043783
1033 Ga0207700_10700453
1034 Ga0207700_11901969
1035 Ga0207700_11917237
1036 Ga0207664_10058744
1037 Ga0207664_10355815
1038 Ga0207664_10559265
1039 Ga0207644_10022108
1040 Ga0207690_10069680
1041 Ga0207690_10167323
1042 Ga0207706_10018776
1043 Ga0207706_10128618
1044 Ga0207706_10163081
1045 Ga0207706_10323942
1046 Ga0207686_10101598
1047 Ga0207709_10680050
1048 Ga0207670_10031449
1049 Ga0207670_10526249
1050 Ga0207669_10323174
1051 Ga0207704_10098688
1052 Ga0207704_10711074
1053 Ga0207704_10862582
1054 Ga0207711_10093868
1055 Ga0207711_10127194
1056 Ga0207711_10191955
1057 Ga0207711_10754048
1058 Ga0207711_11001380
1059 Ga0207711_11809490
1060 Ga0207689_10003025
1061 Ga0207689_10026579
1062 Ga0207689_10353922
1063 Ga0207661_10001815
1064 Ga0207661_10003734
1065 Ga0207661_10017097
1066 Ga0207661_10034323
1067 Ga0207661_10108904
1068 Ga0207661_10170145
1069 Ga0207661_10235652
1070 Ga0207661_10302009
1071 Ga0207661_10511707
1072 Ga0207661_11198866
1073 Ga0207679_10003366
1074 Ga0207679_10030681
1075 Ga0207679_10039853
1076 Ga0207679_11842123
1077 Ga0207667_10244784
1078 Ga0207667_10517414
1079 Ga0207667_11592435
1080 Ga0207651_11443930
1081 Ga0207712_10002714
1082 Ga0207712_10347850
1083 Ga0207712_11203187
1084 Ga0207668_10122506
1085 Ga0207668_11292610
1086 Ga0207668_11990705
1087 Ga0207658_10268996
1088 Ga0207658_10620451
1089 Ga0207658_10660290
1090 Ga0207677_10257165
1091 Ga0207677_11982987
1092 Ga0207703_10093832
1093 Ga0207703_10861343
1094 Ga0207703_11156532
1095 Ga0207639_10027543
1096 Ga0207639_10086769
1097 Ga0207639_10096170
1098 Ga0207639_10763335
1099 Ga0207678_10918948
1100 Ga0207708_10042857
1101 Ga0207708_10149769
1102 Ga0207702_10020409
1103 Ga0207702_10026272
1104 Ga0207702_10321437
1105 Ga0207702_11933508
1106 Ga0207641_10017059
1107 Ga0207641_10170181
1108 Ga0207641_10715148
1109 Ga0207648_10300026
1110 Ga0207648_11245675
1111 Ga0207676_10020281
1112 Ga0207676_10186842
1113 Ga0207676_10365238
1114 Ga0207676_10687871
1115 Ga0207674_10000227
1116 Ga0207674_10014219
1117 Ga0207674_10104031
1118 Ga0207674_10564058
1119 Ga0207675_100018037
1120 Ga0207675_100437339
1121 Ga0207698_10302467
1122 Ga0207698_10842992
1123 Ga0268266_10053642
1124 Ga0268266_10559467
1125 Ga0268265_10011564
1126 Ga0268265_10074569
1127 Ga0268264_10038496
1128 Ga0268264_10133086
1129 Ga0268264_11338018
1130 Ga0265331_10312019
1131 Ga0307405_11132025
1132 Ga0307412_11966549
1133 Ga0307412_11972407
1134 Ga0307416_100950609
1135 Ga0373958_0077743
1136 Ga0373926_0107705
1137 Ga0373934_0001667
1138 Ga0373936_0165622
1139 Ga0373941_0033952
1140 Ga0373953_0006997
1141 Ga0373954_0022074
1142 Ga0373956_0032740
1143 Ga0373956_0258034
1144 Ga0373957_0050896
1145 Ga0373943_0170459
1146 Ga0373955_0007590
1147 Ga0373955_0210972
1148 Ga0373924_0370385
1149 Ga0373931_0129224
1150 Ga0373935_0160907
1151 Ga0373935_0497218
1152 Ga0373927_0050306
1153 Ga0373927_0277681
1154 Ga0373927_0659434
1155 Ga0373933_0025916
1156 Ga0373933_0039935
1157 Ga0373947_0203832
1158 Ga0373947_0254417
1159 Ga0373937_0012133
1160 Ga0373937_0027726
1161 Ga0395901_1568011
1162 Ga0436365_0324979
1163 Ga0436365_1421576
1164 Ga0436365_1446180
1165 Ga0466963_0253083
1166 Ga0466957_0155759
1167 Ga0466957_0879204
1168 Ga0451576_0093494
1169 Ga0466967_0013129
1170 Ga0466967_0105237
1171 Ga0466967_0561491
1172 Ga0466967_1959344
1173 Ga0495592_0402625
1174 Ga0495629_0055296
1175 Ga0495629_0140321
1176 Ga0495629_0340228
1177 Ga0495651_0004956
1178 Ga0495653_0032333
1179 Ga0495580_0038348
1180 Ga0495580_0042850
1181 Ga0495582_0038397
1182 Ga0495582_0217297
1183 Ga0495639_0170883
1184 Ga0495662_0496025
1185 Ga0495594_0007965
1186 Ga0495594_0013751
1187 Ga0495594_0479444
1188 Ga0495594_0728149
1189 Ga0495608_0167378
1190 Ga0495618_0099696
1191 Ga0495628_0067279
1192 Ga0495630_0090320
1193 Ga0495666_0032125
1194 Ga0495666_0044157
1195 Ga0495652_0037262
1196 Ga0495652_0732848
1197 Ga0495665_0010277
1198 Ga0495586_0085973
1199 Ga0495586_0112182
1200 Ga0495587_0000927
1201 Ga0495645_0000527
1202 Ga0495645_0005444
1203 Ga0495667_0002052
1204 Ga0495667_0041581
1205 Ga0495625_0133499
1206 Ga0495635_0041545
1207 Ga0495588_0546988
1208 Ga0495657_0030449
1209 Ga0495657_0170895
1210 Ga0495599_0034405
1211 Ga0495646_0137397
1212 Ga0495658_0033402
1213 Ga0495658_0229501
1214 Ga0495624_0288873
1215 Ga0495581_0013502
1216 Ga0495581_0267610
1217 Ga0495604_0011541
1218 Ga0495674_0118383
1219 Ga0495674_0153406
1220 Ga0495674_0991167
1221 Ga0495672_0019791
1222 Ga0495675_0041322
1223 Ga0495675_0165679
1224 Ga0495684_0004869
1225 Ga0495684_0005973
1226 Ga0495684_0554064
1227 Ga0495684_0779731
1228 Ga0495593_0623569
1229 Ga0495602_0634839
1230 Ga0496104_0318279
1231 Ga0496108_0294051
1232 Ga0496112_0037232
1233 Ga0496112_0727883
1234 Ga0496115_0748744
1235 Ga0501031_1044917
1236 Ga0501032_0225411
1237 Ga0501033_0216960
1238 Ga0501033_0251682
1239 Ga0501036_0522633
1240 Ga0501036_1343320
1241 Ga0501037_0637415
1242 Ga0501038_0251941
1243 Ga0501039_0286966
1244 Ga0501043_0839357
1245 Ga0501047_0091501
1246 Ga0501070_0212813
1247 Ga0501070_1212599
1248 Ga0501073_0106128
1249 Ga0501035_0234994
1250 Ga0501044_1148999
1251 nmdc:mga05p37_1788851_c1
1252 nmdc:mga05p37_33030_c1
1253 nmdc:mga09592_112088_c1
1254 nmdc:mga09592_182564_c1
1255 nmdc:mga0qj67_72440_c1
1256 nmdc:mga06r32_1013091_c1
1257 nmdc:mga06r32_27407_c1
1258 nmdc:mga06r32_803395_c1
1259 nmdc:mga08y16_1730020_c1
1260 nmdc:mga08y16_51545_c1
1261 nmdc:mga08y16_617074_c1
1262 nmdc:mga0n895_205333_c1
1263 nmdc:mga0n895_234132_c1
1264 nmdc:mga0rr50_1547690_c1
1265 nmdc:mga0rr50_435467_c1
1266 nmdc:mga0a205_131026_c1
1267 nmdc:mga0a205_16536_c1
1268 Ga0495601_0056103
1269 Ga0495619_0262754
1270 Ga0500641_0389225

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

23

97

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9309 9 105
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9262 9 105
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9196 9 105
3l7w-assembly1.cif.gz_A-2 the crystal structure of smu.1704 from streptococcus mutans ua159 0.9024 13 114
6abq-assembly1.cif.gz_B crystal structure of transcription factor from listeria monocytogenes 0.8939 9 106
ID Description Score Start End Superfamily
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9196 9 105 1.10.10.10
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9123 10 109 1.10.10.10
3l7wA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9031 13 108 1.10.10.10
5zqhA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8858 9 104 1.10.10.10
af_P64588_52_154_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8832 8 98 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7S7NR82-F1-model_v4 PadR family transcriptional regulator 0.9936 16 110
AF-A0A3N5XMC9-F1-model_v4 PadR family transcriptional regulator 0.9907 16 110
AF-A0A5B9EGF4-F1-model_v4 PadR family transcriptional regulator 0.9891 16 107
AF-A0A1Q7C8R4-F1-model_v4 PadR family transcriptional regulator 0.9871 16 110
AF-W0RAW6-F1-model_v4 Transcriptional regulator, PadR-family 0.9813 7 114

Map