F471188

General Info

Members Datasets Scaffolds Average Seq Length
634 261 634 159

Family's Representative Sequence

Representative Sequence 3300042439|Ga0439464_0089396|Ga0439464_0089396_132_704
Length 190
Sequence MVLQRRRQIRIAKAGAARLNADNRPALDYTRQMSLRTAAETRQWIEGLQRQNRRVVFTNGVFDLLHPGHVRYLRAARERGDALVVGINSDRSVSANKGPGRPIVPEGERAELLEALAFVDAVVIFDEETPHELIATLQPDVLVKGADWAADAIVGRDLVESWGGQVERMPVEAGHSTSAIIRKIRGMNPR

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
151 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
157 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
158 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
159 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
160 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
162 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
163 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
169 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
170 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
171 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
172 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
173 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
174 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
177 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
178 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
179 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
180 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
181 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
184 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
185 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
186 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
187 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
188 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
189 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
192 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
193 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
194 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
195 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
196 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
197 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
207 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
208 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
209 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
225 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
226 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
227 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
228 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
229 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
230 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
231 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
232 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
233 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
234 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
235 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
236 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
237 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
238 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
239 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
240 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
241 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
242 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
243 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
246 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
247 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
248 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
249 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
250 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
251 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
254 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
255 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
256 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
257 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
258 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
259 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
260 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
261 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.63
Nodule 0
Rhizoplane 2.68
Rhizosphere 96.53
Stem 0
Stem Tuber 0
Unclassified 0.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10085755 3300003203 Bacteria 957
2 Ga0065715_10154999 3300005293 Bacteria 1655
3 Ga0065715_10236571 3300005293 Unclassified 1214
4 Ga0065715_10683227 3300005293 Unclassified 662
5 Ga0065707_10002739 3300005295 Bacteria 5107
6 Ga0065707_10004595 3300005295 Bacteria 6379
7 Ga0065707_10084894 3300005295 Bacteria 6667
8 Ga0065707_10163550 3300005295 Bacteria 1542
9 Ga0070658_10028504 3300005327 Bacteria 4483
10 Ga0070676_10009864 3300005328 Bacteria 5167
11 Ga0070676_10173496 3300005328 Bacteria 1397
12 Ga0070683_100098876 3300005329 Bacteria 2746
13 Ga0070670_100423309 3300005331 Unclassified 1177
14 Ga0070677_10059521 3300005333 Bacteria 1571
15 Ga0068869_100425728 3300005334 Bacteria 1096
16 Ga0070666_10071493 3300005335 Bacteria 2361
17 Ga0070680_100631255 3300005336 Bacteria 920
18 Ga0068868_100299800 3300005338 Bacteria 1365
19 Ga0070691_10000425 3300005341 Bacteria 15505
20 Ga0070687_100020732 3300005343 Bacteria 3079
21 Ga0070687_100136273 3300005343 Bacteria 1424
22 Ga0070687_100262228 3300005343 Bacteria 1079
23 Ga0070687_100977973 3300005343 Bacteria 612
24 Ga0070692_10298977 3300005345 Bacteria 982
25 Ga0070692_10481672 3300005345 Unclassified 800
26 Ga0070668_100020029 3300005347 Bacteria 5045
27 Ga0070668_100066448 3300005347 Bacteria 2798
28 Ga0070669_100012308 3300005353 Bacteria 6070
29 Ga0070669_100027876 3300005353 Bacteria 4066
30 Ga0070669_100035365 3300005353 Bacteria 3618
31 Ga0070669_100160487 3300005353 Bacteria 1747
32 Ga0070669_100180720 3300005353 Bacteria 1650
33 Ga0070669_100570023 3300005353 Bacteria 946
34 Ga0070675_100000433 3300005354 Bacteria 28442
35 Ga0070675_100042879 3300005354 Bacteria 3697
36 Ga0070675_100219255 3300005354 Unclassified 1656
37 Ga0070675_100578898 3300005354 Bacteria 1017
38 Ga0070675_100876522 3300005354 Unclassified 822
39 Ga0070675_101308552 3300005354 Bacteria 668
40 Ga0070674_100412060 3300005356 Bacteria 1107
41 Ga0070674_100501274 3300005356 Bacteria 1011
42 Ga0070674_100639219 3300005356 Bacteria 903
43 Ga0070673_100088738 3300005364 Bacteria 2523
44 Ga0070688_100041978 3300005365 Bacteria 2811
45 Ga0070659_100311161 3300005366 Bacteria 1315
46 Ga0070659_101352784 3300005366 Archaea 632
47 Ga0070667_100709687 3300005367 Bacteria 931
48 Ga0070713_100755611 3300005436 Bacteria 930
49 Ga0070701_10188594 3300005438 Unclassified 1212
50 Ga0070705_100001128 3300005440 Bacteria 14772
51 Ga0070705_100001404 3300005440 Bacteria 12773
52 Ga0070700_100000788 3300005441 Bacteria 15603
53 Ga0070700_100005290 3300005441 Bacteria 6824
54 Ga0070700_100106845 3300005441 Bacteria 1854
55 Ga0070700_100253744 3300005441 Bacteria 1263
56 Ga0070700_101188627 3300005441 Unclassified 636
57 Ga0070694_100001406 3300005444 Bacteria 14087
58 Ga0070694_100122675 3300005444 Bacteria 1866
59 Ga0070694_100528354 3300005444 Bacteria 942
60 Ga0070663_100578049 3300005455 Unclassified 942
61 Ga0070678_100354657 3300005456 Bacteria 1262
62 Ga0070678_100529990 3300005456 Bacteria 1043
63 Ga0070662_100035211 3300005457 Bacteria 3535
64 Ga0070662_100142896 3300005457 Bacteria 1856
65 Ga0070662_100371558 3300005457 Unclassified 1175
66 Ga0070681_10387246 3300005458 Bacteria 1309
67 Ga0068867_100011464 3300005459 Bacteria 6255
68 Ga0070706_100835108 3300005467 Bacteria 852
69 Ga0070707_100900779 3300005468 Bacteria 849
70 Ga0070699_100013629 3300005518 Bacteria 6998
71 Ga0070699_100042236 3300005518 Bacteria 3945
72 Ga0070699_100819083 3300005518 Unclassified 852
73 Ga0070684_100133443 3300005535 Bacteria 2241
74 Ga0070697_100566761 3300005536 Bacteria 996
75 Ga0070686_100000153 3300005544 Bacteria 47434
76 Ga0070686_100070428 3300005544 Bacteria 2287
77 Ga0070695_100000013 3300005545 Bacteria 69322
78 Ga0070695_100032985 3300005545 Bacteria 3238
79 Ga0070695_100439617 3300005545 Bacteria 997
80 Ga0070695_100571070 3300005545 Unclassified 884
81 Ga0070695_100586122 3300005545 Unclassified 874
82 Ga0070695_100611236 3300005545 Bacteria 857
83 Ga0070695_100925443 3300005545 Unclassified 705
84 Ga0070695_100981121 3300005545 Bacteria 686
85 Ga0070696_100007129 3300005546 Bacteria 7466
86 Ga0070696_100008086 3300005546 Bacteria 7029
87 Ga0070696_100533208 3300005546 Bacteria 938
88 Ga0070696_100550875 3300005546 Bacteria 924
89 Ga0070693_100041130 3300005547 Bacteria 2599
90 Ga0070693_100248446 3300005547 Bacteria 1178
91 Ga0070693_100716098 3300005547 Unclassified 734
92 Ga0070665_100008640 3300005548 Bacteria 10308
93 Ga0070665_100117069 3300005548 Bacteria 2667
94 Ga0070704_100008665 3300005549 Bacteria 6115
95 Ga0070704_100080788 3300005549 Bacteria 2392
96 Ga0070704_100280490 3300005549 Bacteria 1380
97 Ga0070704_101008460 3300005549 Bacteria 753
98 Ga0070704_101322865 3300005549 Unclassified 660
99 Ga0068855_100317114 3300005563 Bacteria 1724
100 Ga0068857_100087396 3300005577 Bacteria 2788
101 Ga0068854_100008015 3300005578 Bacteria 6767
102 Ga0068854_100011351 3300005578 Bacteria 5795
103 Ga0068856_100031335 3300005614 Bacteria 5202
104 Ga0070702_100243735 3300005615 Bacteria 1214
105 Ga0068852_100238120 3300005616 Bacteria 1738
106 Ga0068852_100361852 3300005616 Bacteria 1419
107 Ga0068852_100472096 3300005616 Bacteria 1245
108 Ga0068859_100857192 3300005617 Unclassified 994
109 Ga0068859_101902663 3300005617 Bacteria 657
110 Ga0068864_100234757 3300005618 Bacteria 1697
111 Ga0068864_101444255 3300005618 Archaea 690
112 Ga0068866_10069929 3300005718 Bacteria 1851
113 Ga0068866_10242582 3300005718 Bacteria 1098
114 Ga0068861_100012709 3300005719 Bacteria 5875
115 Ga0068861_100051092 3300005719 Bacteria 3137
116 Ga0068861_100378213 3300005719 Bacteria 1250
117 Ga0068861_100405433 3300005719 Bacteria 1211
118 Ga0068851_10189003 3300005834 Bacteria 1144
119 Ga0068858_100017044 3300005842 Bacteria 6819
120 Ga0068858_100173908 3300005842 Bacteria 2032
121 Ga0068858_100862391 3300005842 Bacteria 885
122 Ga0068860_100061409 3300005843 Bacteria 3571
123 Ga0068860_100274970 3300005843 Bacteria 1645
124 Ga0068860_100861601 3300005843 Bacteria 921
125 Ga0068862_100010510 3300005844 Bacteria 7646
126 Ga0068862_100043918 3300005844 Bacteria 3811
127 Ga0068862_100178909 3300005844 Bacteria 1902
128 Ga0068862_100704313 3300005844 Bacteria 979
129 Ga0081539_10002012 3300005985 Bacteria 30795
130 Ga0075367_10018891 3300006178 Bacteria 3811
131 Ga0075366_10026956 3300006195 Bacteria 3369
132 Ga0097621_100000125 3300006237 Bacteria 44370
133 Ga0097621_100157874 3300006237 Bacteria 1948
134 Ga0097621_100413069 3300006237 Bacteria 1210
135 Ga0068871_100000134 3300006358 Bacteria 47412
136 Ga0075428_100006263 3300006844 Bacteria 13228
137 Ga0075428_100633123 3300006844 Bacteria 1141
138 Ga0075430_100000247 3300006846 Bacteria 37440
139 Ga0075430_100000722 3300006846 Bacteria 25248
140 Ga0075430_100784597 3300006846 Unclassified 785
141 Ga0075431_100019089 3300006847 Bacteria 6984
142 Ga0075431_100019172 3300006847 Bacteria 6972
143 Ga0075431_100425216 3300006847 Bacteria 1327
144 Ga0075431_101080915 3300006847 Unclassified 767
145 Ga0075433_10017226 3300006852 Bacteria 5979
146 Ga0075433_10019086 3300006852 Bacteria 5704
147 Ga0075433_10050842 3300006852 Bacteria 3608
148 Ga0075433_10219449 3300006852 Unclassified 1689
149 Ga0075434_100005743 3300006871 Bacteria 11328
150 Ga0075434_100192132 3300006871 Bacteria 2062
151 Ga0075434_100347945 3300006871 Bacteria 1503
152 Ga0075434_100447361 3300006871 Unclassified 1313
153 Ga0075434_100459628 3300006871 Bacteria 1294
154 Ga0075434_100944548 3300006871 Unclassified 877
155 Ga0075429_100002690 3300006880 Bacteria 14968
156 Ga0075429_100284206 3300006880 Bacteria 1449
157 Ga0075429_101187194 3300006880 Bacteria 666
158 Ga0068865_100351331 3300006881 Bacteria 1194
159 Ga0068865_100520064 3300006881 Bacteria 995
160 Ga0068865_100524618 3300006881 Bacteria 991
161 Ga0075436_100026454 3300006914 Bacteria 3994
162 Ga0075436_100035274 3300006914 Bacteria 3451
163 Ga0075436_100052587 3300006914 Bacteria 2812
164 Ga0075436_100485414 3300006914 Bacteria 902
165 Ga0097620_100314818 3300006931 Bacteria 1659
166 Ga0097620_100770166 3300006931 Unclassified 1051
167 Ga0097620_100857188 3300006931 Unclassified 994
168 Ga0097620_101902409 3300006931 Bacteria 657
169 Ga0075435_100006762 3300007076 Bacteria 8135
170 Ga0075435_100065440 3300007076 Bacteria 2955
171 Ga0105240_10342108 3300009093 Bacteria 1699
172 Ga0105240_11365940 3300009093 Bacteria 746
173 Ga0111539_10000230 3300009094 Bacteria 67127
174 Ga0111539_10003342 3300009094 Bacteria 21190
175 Ga0111539_10028028 3300009094 Bacteria 6877
176 Ga0111539_10086580 3300009094 Bacteria 3681
177 Ga0111539_10102668 3300009094 Bacteria 3356
178 Ga0111539_10123958 3300009094 Bacteria 3028
179 Ga0111539_10135036 3300009094 Bacteria 2889
180 Ga0111539_10158865 3300009094 Bacteria 2644
181 Ga0111539_10192426 3300009094 Unclassified 2380
182 Ga0111539_10197521 3300009094 Bacteria 2346
183 Ga0111539_10209070 3300009094 Bacteria 2274
184 Ga0111539_10493323 3300009094 Bacteria 1426
185 Ga0111539_11191044 3300009094 Bacteria 885
186 Ga0105245_10013815 3300009098 Bacteria 7033
187 Ga0105245_12905016 3300009098 Unclassified 531
188 Ga0114129_10000426 3300009147 Bacteria 50026
189 Ga0114129_10013149 3300009147 Bacteria 11792
190 Ga0114129_10014774 3300009147 Bacteria 11123
191 Ga0114129_10231163 3300009147 Bacteria 2490
192 Ga0114129_10235325 3300009147 Bacteria 2465
193 Ga0114129_10377678 3300009147 Bacteria 1872
194 Ga0114129_11721348 3300009147 Bacteria 764
195 Ga0105243_10449972 3300009148 Bacteria 1208
196 Ga0105243_10960054 3300009148 Unclassified 854
197 Ga0105243_10998721 3300009148 Bacteria 839
198 Ga0105241_10375433 3300009174 Bacteria 1241
199 Ga0105241_10463331 3300009174 Unclassified 1123
200 Ga0105241_10757271 3300009174 Bacteria 891
201 Ga0105242_10086482 3300009176 Bacteria 2631
202 Ga0105242_10116616 3300009176 Bacteria 2285
203 Ga0105242_10187783 3300009176 Bacteria 1828
204 Ga0105242_10298350 3300009176 Bacteria 1470
205 Ga0105248_10080482 3300009177 Unclassified 3661
206 Ga0105248_10920304 3300009177 Bacteria 987
207 Ga0105249_10009745 3300009553 Bacteria 8416
208 Ga0105249_10166850 3300009553 Bacteria 2132
209 Ga0105249_10267327 3300009553 Bacteria 1702
210 Ga0105249_11114590 3300009553 Unclassified 859
211 Ga0105249_11231712 3300009553 Unclassified 819
212 Ga0105239_12408314 3300010375 Bacteria 613
213 Ga0105246_10143870 3300011119 Bacteria 1797
214 Ga0105246_10378878 3300011119 Unclassified 1168
215 Ga0157370_10711774 3300013104 Archaea 916
216 Ga0157369_10386158 3300013105 Unclassified 1453
217 Ga0157374_10017943 3300013296 Bacteria 6237
218 Ga0157374_10155197 3300013296 Unclassified 2227
219 Ga0157374_10258659 3300013296 Bacteria 1714
220 Ga0157378_10009109 3300013297 Bacteria 8639
221 Ga0157378_10083682 3300013297 Bacteria 2888
222 Ga0163162_10501363 3300013306 Bacteria 1344
223 Ga0163162_10575760 3300013306 Bacteria 1253
224 Ga0163162_11310218 3300013306 Bacteria 823
225 Ga0157372_10460337 3300013307 Unclassified 1482
226 Ga0157375_10021964 3300013308 Bacteria 5866
227 Ga0157375_10755186 3300013308 Unclassified 1124
228 Ga0157375_12210283 3300013308 Unclassified 655
229 Ga0157375_12826462 3300013308 Unclassified 580
230 Ga0163163_10210923 3300014325 Bacteria 1991
231 Ga0163163_10227833 3300014325 Bacteria 1913
232 Ga0163163_10504106 3300014325 Bacteria 1272
233 Ga0157380_10046121 3300014326 Bacteria 3422
234 Ga0157380_10057944 3300014326 Bacteria 3087
235 Ga0157380_10091606 3300014326 Bacteria 2510
236 Ga0157380_10099365 3300014326 Bacteria 2420
237 Ga0157380_10121340 3300014326 Bacteria 2214
238 Ga0157380_10287534 3300014326 Bacteria 1508
239 Ga0157380_10830505 3300014326 Unclassified 944
240 Ga0157380_10902687 3300014326 Bacteria 910
241 Ga0157380_10953974 3300014326 Unclassified 888
242 Ga0157377_10055265 3300014745 Unclassified 2251
243 Ga0157377_10063934 3300014745 Bacteria 2109
244 Ga0157379_10068624 3300014968 Bacteria 3169
245 Ga0157379_10198779 3300014968 Bacteria 1812
246 Ga0157379_10274633 3300014968 Bacteria 1533
247 Ga0157376_10029506 3300014969 Bacteria 4369
248 Ga0157376_10049362 3300014969 Bacteria 3485
249 Ga0157376_10200404 3300014969 Bacteria 1836
250 Ga0163161_10249687 3300017792 Bacteria 1383
251 Ga0207666_1026369 3300025271 Unclassified 875
252 Ga0207697_10082692 3300025315 Bacteria 1354
253 Ga0207642_10061529 3300025899 Bacteria 1746
254 Ga0207642_10304844 3300025899 Bacteria 925
255 Ga0207688_10108977 3300025901 Bacteria 1606
256 Ga0207688_10446579 3300025901 Unclassified 806
257 Ga0207680_10090828 3300025903 Bacteria 1942
258 Ga0207699_10298849 3300025906 Bacteria 1124
259 Ga0207645_10001406 3300025907 Bacteria 19717
260 Ga0207645_10188096 3300025907 Bacteria 1356
261 Ga0207705_10099807 3300025909 Bacteria 2135
262 Ga0207684_10681004 3300025910 Bacteria 875
263 Ga0207707_10139577 3300025912 Bacteria 2119
264 Ga0207707_10360121 3300025912 Unclassified 1252
265 Ga0207660_10410706 3300025917 Bacteria 1091
266 Ga0207662_10116396 3300025918 Bacteria 1672
267 Ga0207662_10436638 3300025918 Bacteria 893
268 Ga0207657_10573303 3300025919 Bacteria 881
269 Ga0207649_10139007 3300025920 Bacteria 1659
270 Ga0207681_10004564 3300025923 Bacteria 8517
271 Ga0207681_10022128 3300025923 Bacteria 4050
272 Ga0207650_10359794 3300025925 Unclassified 1199
273 Ga0207659_10000079 3300025926 Bacteria 60790
274 Ga0207659_10209420 3300025926 Bacteria 1562
275 Ga0207659_10302044 3300025926 Bacteria 1315
276 Ga0207659_10861235 3300025926 Unclassified 779
277 Ga0207687_10215455 3300025927 Bacteria 1509
278 Ga0207690_10413689 3300025932 Archaea 1077
279 Ga0207690_10520639 3300025932 Unclassified 964
280 Ga0207706_10045569 3300025933 Bacteria 3885
281 Ga0207706_10108716 3300025933 Bacteria 2440
282 Ga0207706_10179083 3300025933 Bacteria 1862
283 Ga0207686_10183767 3300025934 Bacteria 1484
284 Ga0207686_10994945 3300025934 Bacteria 680
285 Ga0207686_11044443 3300025934 Unclassified 664
286 Ga0207709_10063505 3300025935 Bacteria 2315
287 Ga0207709_10386372 3300025935 Bacteria 1066
288 Ga0207709_10649709 3300025935 Bacteria 840
289 Ga0207669_10358794 3300025937 Unclassified 1129
290 Ga0207669_10461390 3300025937 Bacteria 1009
291 Ga0207669_11066887 3300025937 Unclassified 681
292 Ga0207704_10273315 3300025938 Bacteria 1281
293 Ga0207704_10351195 3300025938 Bacteria 1148
294 Ga0207691_10122470 3300025940 Bacteria 2303
295 Ga0207711_10389796 3300025941 Bacteria 1293
296 Ga0207689_10414750 3300025942 Unclassified 1123
297 Ga0207689_10416128 3300025942 Bacteria 1121
298 Ga0207661_10224860 3300025944 Bacteria 1660
299 Ga0207661_10295160 3300025944 Unclassified 1452
300 Ga0207712_10055161 3300025961 Bacteria 2794
301 Ga0207668_10294731 3300025972 Bacteria 1336
302 Ga0207640_10007460 3300025981 Bacteria 6040
303 Ga0207640_10028125 3300025981 Bacteria 3433
304 Ga0207658_10564805 3300025986 Bacteria 1019
305 Ga0207703_10028554 3300026035 Bacteria 4398
306 Ga0207703_10078831 3300026035 Bacteria 2738
307 Ga0207639_10539826 3300026041 Archaea 1070
308 Ga0207708_10004337 3300026075 Bacteria 10446
309 Ga0207708_10027833 3300026075 Bacteria 4281
310 Ga0207708_10046797 3300026075 Bacteria 3294
311 Ga0207708_10094753 3300026075 Bacteria 2305
312 Ga0207708_10161966 3300026075 Bacteria 1767
313 Ga0207708_10405455 3300026075 Bacteria 1128
314 Ga0207702_10008196 3300026078 Bacteria 8832
315 Ga0207648_10002536 3300026089 Bacteria 19594
316 Ga0207676_10446165 3300026095 Unclassified 1219
317 Ga0207676_10536952 3300026095 Unclassified 1115
318 Ga0207674_10102878 3300026116 Bacteria 2836
319 Ga0207674_10359673 3300026116 Unclassified 1407
320 Ga0207675_100019034 3300026118 Bacteria 6409
321 Ga0207675_100203574 3300026118 Bacteria 1902
322 Ga0207675_100235685 3300026118 Bacteria 1767
323 Ga0207675_100346802 3300026118 Bacteria 1454
324 Ga0207675_100412931 3300026118 Bacteria 1332
325 Ga0207675_100427669 3300026118 Bacteria 1309
326 Ga0207675_100579393 3300026118 Bacteria 1123
327 Ga0207675_102079836 3300026118 Bacteria 584
328 Ga0207683_10364934 3300026121 Bacteria 1326
329 Ga0207698_10036810 3300026142 Bacteria 3597
330 Ga0207698_10218136 3300026142 Bacteria 1722
331 Ga0207698_10396867 3300026142 Bacteria 1317
332 Ga0209983_1040463 3300027665 Bacteria 1007
333 Ga0207428_10000531 3300027907 Bacteria 45546
334 Ga0207428_10003214 3300027907 Bacteria 15966
335 Ga0207428_10046855 3300027907 Bacteria 3474
336 Ga0207428_10052174 3300027907 Bacteria 3267
337 Ga0207428_10071655 3300027907 Bacteria 2721
338 Ga0207428_10104551 3300027907 Bacteria 2185
339 Ga0207428_10460104 3300027907 Archaea 927
340 Ga0268266_10019822 3300028379 Bacteria 5731
341 Ga0268266_10271821 3300028379 Bacteria 1573
342 Ga0268265_10029432 3300028380 Bacteria 3941
343 Ga0268265_10298797 3300028380 Bacteria 1449
344 Ga0268265_10438076 3300028380 Bacteria 1217
345 Ga0268265_10525196 3300028380 Bacteria 1119
346 Ga0268265_10718947 3300028380 Bacteria 967
347 Ga0268265_11478861 3300028380 Archaea 683
348 Ga0268264_10226506 3300028381 Bacteria 1724
349 Ga0268264_10292267 3300028381 Bacteria 1531
350 Ga0268264_10453545 3300028381 Bacteria 1243
351 Ga0268264_12342838 3300028381 Bacteria 540
352 Ga0307511_10289271 3300030521 Bacteria 750
353 Ga0307408_100013807 3300031548 Bacteria 5362
354 Ga0307408_100028512 3300031548 Bacteria 3858
355 Ga0307405_11418614 3300031731 Bacteria 608
356 Ga0307413_10174622 3300031824 Bacteria 1525
357 Ga0307413_10506903 3300031824 Unclassified 970
358 Ga0307406_10268399 3300031901 Unclassified 1295
359 Ga0307407_10240046 3300031903 Unclassified 1236
360 Ga0307407_10265782 3300031903 Bacteria 1182
361 Ga0307412_10136776 3300031911 Bacteria 1789
362 Ga0307409_100392431 3300031995 Unclassified 1323
363 Ga0307416_100016217 3300032002 Bacteria 5170
364 Ga0307416_100438454 3300032002 Unclassified 1355
365 Ga0307416_100547707 3300032002 Archaea 1230
366 Ga0307416_100632165 3300032002 Bacteria 1153
367 Ga0307416_100974381 3300032002 Bacteria 950
368 Ga0307416_101169275 3300032002 Bacteria 875
369 Ga0307411_10144227 3300032005 Bacteria 1760
370 Ga0307411_10446158 3300032005 Bacteria 1081
371 Ga0307415_100236844 3300032126 Bacteria 1474
372 Ga0373929_0226116 3300035085 Unclassified 534
373 Ga0373951_0056175 3300035091 Unclassified 978
374 Ga0373952_0248037 3300035092 Unclassified 538
375 Ga0373932_0015319 3300035112 Bacteria 1942
376 Ga0373936_0464862 3300035113 Bacteria 586
377 Ga0373939_0408306 3300035114 Bacteria 564
378 Ga0373941_0033694 3300035115 Bacteria 1541
379 Ga0373954_0409777 3300035118 Bacteria 670
380 Ga0373955_0168279 3300035172 Archaea 1296
381 Ga0373955_0305726 3300035172 Bacteria 959
382 Ga0373924_0292947 3300035410 Unclassified 722
383 Ga0373937_0012405 3300036401 Bacteria 7495
384 Ga0373937_0370300 3300036401 Unclassified 1358
385 Ga0373937_0382300 3300036401 Bacteria 1335
386 Ga0373937_1000478 3300036401 Bacteria 785
387 Ga0373925_0398317 3300037068 Bacteria 1123
388 Ga0439450_003896 3300042008 Unclassified 2507
389 Ga0439464_0002262 3300042439 Bacteria 4709
390 Ga0439464_0089396 3300042439 Bacteria 927
391 Ga0439464_0205519 3300042439 Bacteria 629
392 Ga0439460_0130755 3300042461 Unclassified 827
393 Ga0450916_002278 3300042530 Bacteria 2022
394 Ga0466963_1026187 3300044694 Bacteria 581
395 Ga0466957_0658034 3300044842 Bacteria 737
396 Ga0466957_1070575 3300044842 Bacteria 581
397 Ga0451576_0129908 3300045051 Bacteria 2626
398 Ga0451576_0173529 3300045051 Unclassified 2250
399 Ga0451576_0450726 3300045051 Bacteria 1351
400 Ga0451576_0461969 3300045051 Bacteria 1333
401 Ga0451576_0986814 3300045051 Bacteria 883
402 Ga0451576_1942141 3300045051 Unclassified 607
403 Ga0466967_0833321 3300045976 Unclassified 916
404 Ga0495603_0088042 3300046455 Bacteria 1817
405 Ga0495629_0269491 3300046459 Bacteria 1170
406 Ga0495651_0205239 3300046462 Archaea 1376
407 Ga0495580_0042467 3300046472 Bacteria 3240
408 Ga0495639_0048556 3300046475 Bacteria 1925
409 Ga0495594_0339188 3300046499 Bacteria 856
410 Ga0495628_0427805 3300046516 Bacteria 964
411 Ga0495628_0503820 3300046516 Unclassified 874
412 Ga0495643_0002984 3300046522 Bacteria 12782
413 Ga0495665_0422780 3300046531 Unclassified 675
414 Ga0495621_0442798 3300046539 Unclassified 555
415 Ga0495645_0002325 3300046543 Bacteria 12895
416 Ga0495659_0011168 3300046664 Bacteria 2893
417 Ga0495588_0512114 3300046674 Bacteria 629
418 Ga0495599_0043797 3300046678 Bacteria 2809
419 Ga0495599_0124401 3300046678 Archaea 1603
420 Ga0495658_0083279 3300046683 Bacteria 1881
421 Ga0495669_0318296 3300046684 Unclassified 751
422 Ga0495613_0699965 3300046689 Unclassified 667
423 Ga0495671_0245366 3300046692 Bacteria 865
424 Ga0495680_0338784 3300047322 Archaea 1049
425 Ga0495677_0090315 3300047445 Bacteria 1154
426 Ga0495684_0030629 3300047471 Bacteria 4131
427 Ga0496101_0129213 3300048904 Unclassified 1917
428 Ga0496101_0202761 3300048904 Bacteria 1534
429 Ga0496102_0010247 3300048905 Bacteria 8059
430 Ga0496102_0203453 3300048905 Bacteria 1866
431 Ga0496102_0282283 3300048905 Bacteria 1565
432 Ga0496102_0379283 3300048905 Bacteria 1331
433 Ga0496104_0429069 3300048907 Unclassified 1234
434 Ga0496105_0615060 3300048908 Bacteria 842
435 Ga0496105_0666239 3300048908 Unclassified 802
436 Ga0496105_1063580 3300048908 Bacteria 602
437 Ga0496106_0054612 3300048909 Bacteria 3018
438 Ga0496106_0204995 3300048909 Bacteria 1570
439 Ga0496106_0597668 3300048909 Bacteria 884
440 Ga0496109_0042829 3300048912 Bacteria 4103
441 Ga0496110_0120594 3300048913 Bacteria 2362
442 Ga0496114_0078312 3300048917 Bacteria 2789
443 Ga0496115_0214081 3300048918 Bacteria 1591
444 Ga0501291_009568 3300049514 Bacteria 1361
445 Ga0501299_005008 3300049522 Bacteria 2014
446 Ga0501299_094995 3300049522 Archaea 683
447 Ga0501300_054067 3300049523 Unclassified 625
448 Ga0501031_0146433 3300049568 Bacteria 1543
449 Ga0501032_0003850 3300049569 Bacteria 11396
450 Ga0501032_0004854 3300049569 Bacteria 10078
451 Ga0501033_0003710 3300049570 Bacteria 12424
452 Ga0501033_0023579 3300049570 Bacteria 4641
453 Ga0501033_0227118 3300049570 Bacteria 1327
454 Ga0501033_0588083 3300049570 Bacteria 764
455 Ga0501034_0036744 3300049571 Bacteria 4960
456 Ga0501034_0143034 3300049571 Bacteria 2370
457 Ga0501036_0003430 3300049572 Bacteria 12663
458 Ga0501036_0015810 3300049572 Bacteria 6302
459 Ga0501036_0047881 3300049572 Bacteria 3620
460 Ga0501036_1367980 3300049572 Bacteria 574
461 Ga0501037_0020405 3300049573 Bacteria 4892
462 Ga0501037_0022219 3300049573 Bacteria 4693
463 Ga0501037_0512601 3300049573 Bacteria 813
464 Ga0501038_0025440 3300049574 Bacteria 5276
465 Ga0501038_0078591 3300049574 Bacteria 2784
466 Ga0501039_0054148 3300049575 Bacteria 3105
467 Ga0501039_0223794 3300049575 Bacteria 1479
468 Ga0501040_0014862 3300049576 Bacteria 5139
469 Ga0501040_0095476 3300049576 Bacteria 2069
470 Ga0501040_0304172 3300049576 Bacteria 1140
471 Ga0501040_0484813 3300049576 Bacteria 891
472 Ga0501041_0061439 3300049577 Bacteria 2300
473 Ga0501041_0066506 3300049577 Bacteria 2209
474 Ga0501042_0065524 3300049578 Bacteria 2596
475 Ga0501042_0076064 3300049578 Bacteria 2403
476 Ga0501042_0313517 3300049578 Unclassified 1133
477 Ga0501042_0499453 3300049578 Bacteria 883
478 Ga0501042_0594062 3300049578 Bacteria 805
479 Ga0501043_0016613 3300049579 Bacteria 5768
480 Ga0501043_0703662 3300049579 Bacteria 738
481 Ga0501046_0048701 3300049580 Bacteria 3354
482 Ga0501046_0105391 3300049580 Bacteria 2159
483 Ga0501046_0356649 3300049580 Bacteria 1061
484 Ga0501047_0025544 3300049581 Bacteria 5678
485 Ga0501047_0045386 3300049581 Bacteria 4249
486 Ga0501047_0046619 3300049581 Bacteria 4188
487 Ga0501047_1236761 3300049581 Bacteria 560
488 Ga0501048_0003526 3300049582 Bacteria 11895
489 Ga0501048_0025034 3300049582 Bacteria 4352
490 Ga0501048_0051788 3300049582 Bacteria 2921
491 Ga0501048_0065494 3300049582 Bacteria 2569
492 Ga0501048_0077759 3300049582 Bacteria 2341
493 Ga0501067_0009296 3300049583 Bacteria 5445
494 Ga0501067_0259441 3300049583 Bacteria 967
495 Ga0501068_0001251 3300049584 Bacteria 13491
496 Ga0501068_0007676 3300049584 Bacteria 5969
497 Ga0501068_0046814 3300049584 Bacteria 2608
498 Ga0501068_0191371 3300049584 Bacteria 1296
499 Ga0501068_0573808 3300049584 Bacteria 734
500 Ga0501069_0009755 3300049585 Bacteria 5073
501 Ga0501069_0104145 3300049585 Bacteria 1612
502 Ga0501070_0018320 3300049586 Bacteria 5873
503 Ga0501071_0000369 3300049587 Bacteria 22026
504 Ga0501071_0008739 3300049587 Bacteria 6705
505 Ga0501071_0030947 3300049587 Bacteria 3789
506 Ga0501071_0058867 3300049587 Bacteria 2778
507 Ga0501071_0296193 3300049587 Bacteria 1226
508 Ga0501071_0580256 3300049587 Bacteria 862
509 Ga0501072_0089570 3300049588 Bacteria 2442
510 Ga0501072_0162545 3300049588 Bacteria 1781
511 Ga0501072_0182961 3300049588 Bacteria 1672
512 Ga0501072_0446882 3300049588 Bacteria 1024
513 Ga0501072_0470160 3300049588 Bacteria 995
514 Ga0501072_0520489 3300049588 Bacteria 940
515 Ga0501072_0655680 3300049588 Bacteria 826
516 Ga0501072_0690087 3300049588 Bacteria 803
517 Ga0501073_0003611 3300049589 Bacteria 11631
518 Ga0501073_0007039 3300049589 Bacteria 8379
519 Ga0501073_0069301 3300049589 Bacteria 2457
520 Ga0501073_0109131 3300049589 Bacteria 1920
521 Ga0501073_0464242 3300049589 Bacteria 875
522 Ga0501074_0000449 3300049590 Bacteria 24661
523 Ga0501074_0022878 3300049590 Bacteria 4545
524 Ga0501074_0032931 3300049590 Bacteria 3755
525 Ga0501074_0089065 3300049590 Bacteria 2210
526 Ga0501074_0132167 3300049590 Bacteria 1785
527 Ga0501074_0230972 3300049590 Bacteria 1317
528 Ga0501074_0249386 3300049590 Unclassified 1262
529 Ga0501075_0031363 3300049591 Bacteria 3944
530 Ga0501075_0166972 3300049591 Bacteria 1679
531 Ga0501075_0174013 3300049591 Bacteria 1643
532 Ga0501075_0322649 3300049591 Bacteria 1177
533 Ga0501076_0027186 3300049592 Bacteria 4438
534 Ga0501076_0093817 3300049592 Bacteria 2416
535 Ga0501076_0151923 3300049592 Bacteria 1884
536 Ga0501076_0169124 3300049592 Bacteria 1781
537 Ga0501077_0075754 3300049593 Bacteria 2131
538 Ga0501217_005251 3300049661 Bacteria 2702
539 Ga0501217_017168 3300049661 Bacteria 1667
540 Ga0501249_014431 3300049679 Bacteria 1684
541 Ga0501079_0004204 3300049741 Bacteria 10674
542 Ga0501079_0005948 3300049741 Bacteria 9128
543 Ga0501079_0007653 3300049741 Bacteria 8182
544 Ga0501079_0018154 3300049741 Bacteria 5373
545 Ga0501079_0401809 3300049741 Unclassified 1075
546 Ga0501080_0051593 3300049742 Bacteria 3827
547 Ga0501080_0143848 3300049742 Unclassified 2204
548 Ga0501080_0250133 3300049742 Bacteria 1616
549 Ga0501080_0791464 3300049742 Bacteria 832
550 Ga0501081_0031836 3300049743 Bacteria 3575
551 Ga0501081_0105438 3300049743 Unclassified 1997
552 Ga0501081_0275222 3300049743 Bacteria 1232
553 Ga0501081_0804824 3300049743 Bacteria 707
554 Ga0501083_0013241 3300049744 Bacteria 5765
555 Ga0501263_015189 3300049760 Bacteria 993
556 Ga0501269_014350 3300049766 Bacteria 972
557 Ga0501035_0003099 3300049822 Bacteria 15972
558 Ga0501035_0007716 3300049822 Bacteria 10049
559 Ga0501035_0060857 3300049822 Bacteria 3361
560 Ga0501035_0235598 3300049822 Bacteria 1559
561 Ga0501044_0013275 3300049823 Bacteria 8917
562 Ga0501044_0133102 3300049823 Bacteria 2479
563 Ga0501045_0002867 3300049824 Bacteria 11780
564 Ga0501045_0010485 3300049824 Bacteria 6492
565 Ga0501045_0018905 3300049824 Bacteria 4906
566 Ga0501045_0049979 3300049824 Bacteria 3050
567 Ga0501045_0316168 3300049824 Bacteria 1162
568 nmdc:mga0k408_18241_c1 3300050493 Bacteria 3915
569 nmdc:mga06z11_4077_c1 3300050494 Bacteria 5713
570 nmdc:mga05p37_2516_c1 3300050507 Bacteria 21303
571 nmdc:mga05p37_539440_c1 3300050507 Unclassified 1330
572 nmdc:mga05p37_58752_c1 3300050507 Bacteria 4737
573 nmdc:mga05p37_614492_c1 3300050507 Unclassified 1224
574 nmdc:mga05p37_645546_c1 3300050507 Bacteria 1186
575 nmdc:mga05p37_7882_c1 3300050507 Bacteria 12569
576 nmdc:mga05p37_88013_c1 3300050507 Bacteria 3828
577 nmdc:mga05p37_989_c1 3300050507 Bacteria 32388
578 nmdc:mga09592_114159_c1 3300050508 Bacteria 2318
579 nmdc:mga09592_4993_c1 3300050508 Bacteria 10754
580 nmdc:mga09592_58882_c1 3300050508 Bacteria 3248
581 nmdc:mga0qj67_1253555_c1 3300050509 Bacteria 575
582 nmdc:mga0qj67_330482_c1 3300050509 Bacteria 1234
583 nmdc:mga0qj67_398088_c1 3300050509 Bacteria 1111
584 nmdc:mga0qj67_4908_c1 3300050509 Bacteria 9728
585 nmdc:mga0qj67_760675_c1 3300050509 Bacteria 768
586 nmdc:mga0qj67_7629_c1 3300050509 Bacteria 7992
587 nmdc:mga06r32_150798_c1 3300050510 Bacteria 2303
588 nmdc:mga06r32_614683_c1 3300050510 Bacteria 1057
589 nmdc:mga06r32_7703_c1 3300050510 Bacteria 9686
590 nmdc:mga08y16_11940_c1 3300050511 Bacteria 9123
591 nmdc:mga08y16_122872_c1 3300050511 Bacteria 2701
592 nmdc:mga08y16_176486_c1 3300050511 Bacteria 2219
593 nmdc:mga08y16_217979_c1 3300050511 Bacteria 1976
594 nmdc:mga08y16_26996_c1 3300050511 Bacteria 6051
595 nmdc:mga08y16_28335_c1 3300050511 Bacteria 5904
596 nmdc:mga08y16_3154_c1 3300050511 Bacteria 17076
597 nmdc:mga08y16_4998_c1 3300050511 Bacteria 13866
598 nmdc:mga08y16_506340_c1 3300050511 Unclassified 1226
599 nmdc:mga08y16_530460_c1 3300050511 Bacteria 1193
600 nmdc:mga0n895_149987_c1 3300050512 Bacteria 2361
601 nmdc:mga0n895_1515_c1 3300050512 Bacteria 17423
602 nmdc:mga0n895_178404_c1 3300050512 Bacteria 2155
603 nmdc:mga0n895_48993_c1 3300050512 Bacteria 4137
604 nmdc:mga0n895_512256_c1 3300050512 Bacteria 1208
605 nmdc:mga0n895_630731_c1 3300050512 Unclassified 1072
606 nmdc:mga0n895_699526_c1 3300050512 Bacteria 1010
607 nmdc:mga0n895_822456_c1 3300050512 Archaea 918
608 nmdc:mga0rr50_211637_c1 3300050513 Bacteria 1597
609 nmdc:mga0rr50_89061_c1 3300050513 Bacteria 2399
610 nmdc:mga08x19_104697_c1 3300050514 Bacteria 1881
611 nmdc:mga08x19_12387_c1 3300050514 Bacteria 5137
612 nmdc:mga08x19_553990_c1 3300050514 Bacteria 814
613 nmdc:mga0a205_121753_c1 3300050515 Bacteria 2508
614 nmdc:mga0a205_158688_c1 3300050515 Bacteria 2159
615 nmdc:mga0a205_28813_c2 3300050515 Bacteria 2332
616 nmdc:mga0a205_31626_c1 3300050515 Bacteria 5072
617 nmdc:mga0a205_475330_c1 3300050515 Unclassified 1108
618 nmdc:mga0a205_613_c1 3300050515 Bacteria 28395
619 nmdc:mga0a205_948026_c1 3300050515 Unclassified 707
620 Ga0495595_0022357 3300053084 Bacteria 2776
621 Ga0495619_0071960 3300053085 Bacteria 2315
622 Ga0501084_0013745 3300054114 Bacteria 6700
623 Ga0501084_0020526 3300054114 Bacteria 5511
624 Ga0501084_0134859 3300054114 Bacteria 2079
625 Ga0501084_0203634 3300054114 Unclassified 1670
626 Ga0501084_0265469 3300054114 Bacteria 1449
627 Ga0501082_0002846 3300060353 Bacteria 15076
628 Ga0501082_0017551 3300060353 Bacteria 6164
629 Ga0501082_0036362 3300060353 Bacteria 4242
630 Ga0501082_0089451 3300060353 Bacteria 2658
631 Ga0501082_0114820 3300060353 Bacteria 2332
632 Ga0501082_0304075 3300060353 Bacteria 1389
633 Ga0530510_0016973 3300061734 Bacteria 5155
634 Ga0530510_0486684 3300061734 Bacteria 935

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005549 Ga0070704_100008665 Ga0070704_1000086656 150
2 3300005343 Ga0070687_100262228 Ga0070687_1002622282 151
3 3300009094 Ga0111539_11191044 Ga0111539_111910442 151
4 3300044842 Ga0466957_0658034 Ga0466957_0658034_173_643 151
5 3300049568 Ga0501031_0146433 Ga0501031_0146433_817_1299 151
6 3300049570 Ga0501033_0227118 Ga0501033_0227118_737_1219 151
7 3300049573 Ga0501037_0512601 Ga0501037_0512601_264_746 151
8 3300049576 Ga0501040_0095476 Ga0501040_0095476_259_741 151
9 3300049578 Ga0501042_0065524 Ga0501042_0065524_481_963 151
10 3300049582 Ga0501048_0065494 Ga0501048_0065494_1818_2300 151
11 3300049584 Ga0501068_0573808 Ga0501068_0573808_188_670 151
12 3300049587 Ga0501071_0008739 Ga0501071_0008739_3700_4182 151
13 3300049588 Ga0501072_0520489 Ga0501072_0520489_125_607 151
14 3300049590 Ga0501074_0230972 Ga0501074_0230972_390_872 151
15 3300049592 Ga0501076_0169124 Ga0501076_0169124_52_534 151
16 3300049743 Ga0501081_0804824 Ga0501081_0804824_108_572 151
17 3300049822 Ga0501035_0235598 Ga0501035_0235598_240_722 151
18 3300049824 Ga0501045_0018905 Ga0501045_0018905_3271_3753 151
19 3300060353 Ga0501082_0114820 Ga0501082_0114820_526_1008 151
20 3300005293 Ga0065715_10683227 Ga0065715_106832271 152
21 3300005295 Ga0065707_10002739 Ga0065707_100027392 152
22 3300005295 Ga0065707_10084894 Ga0065707_100848945 152
23 3300005327 Ga0070658_10028504 Ga0070658_100285047 152
24 3300005328 Ga0070676_10009864 Ga0070676_100098642 152
25 3300005328 Ga0070676_10173496 Ga0070676_101734962 152
26 3300005335 Ga0070666_10071493 Ga0070666_100714932 152
27 3300005336 Ga0070680_100631255 Ga0070680_1006312552 152
28 3300005341 Ga0070691_10000425 Ga0070691_1000042512 152
29 3300005343 Ga0070687_100020732 Ga0070687_1000207321 152
30 3300005343 Ga0070687_100136273 Ga0070687_1001362732 152
31 3300005343 Ga0070687_100977973 Ga0070687_1009779732 152
32 3300005345 Ga0070692_10298977 Ga0070692_102989772 152
33 3300005347 Ga0070668_100020029 Ga0070668_1000200292 152
34 3300005347 Ga0070668_100066448 Ga0070668_1000664482 152
35 3300005353 Ga0070669_100027876 Ga0070669_1000278762 152
36 3300005353 Ga0070669_100035365 Ga0070669_1000353655 152
37 3300005353 Ga0070669_100160487 Ga0070669_1001604872 152
38 3300005353 Ga0070669_100570023 Ga0070669_1005700232 152
39 3300005354 Ga0070675_100000433 Ga0070675_1000004335 152
40 3300005354 Ga0070675_100042879 Ga0070675_1000428793 152
41 3300005356 Ga0070674_100639219 Ga0070674_1006392192 152
42 3300005364 Ga0070673_100088738 Ga0070673_1000887382 152
43 3300005438 Ga0070701_10188594 Ga0070701_101885942 152
44 3300005440 Ga0070705_100001128 Ga0070705_1000011285 152
45 3300005440 Ga0070705_100001404 Ga0070705_1000014047 152
46 3300005441 Ga0070700_100000788 Ga0070700_1000007885 152
47 3300005441 Ga0070700_100005290 Ga0070700_1000052906 152
48 3300005441 Ga0070700_100106845 Ga0070700_1001068452 152
49 3300005441 Ga0070700_101188627 Ga0070700_1011886271 152
50 3300005444 Ga0070694_100001406 Ga0070694_1000014062 152
51 3300005444 Ga0070694_100122675 Ga0070694_1001226752 152
52 3300005444 Ga0070694_100528354 Ga0070694_1005283541 152
53 3300005457 Ga0070662_100035211 Ga0070662_1000352112 152
54 3300005457 Ga0070662_100142896 Ga0070662_1001428962 152
55 3300005459 Ga0068867_100011464 Ga0068867_1000114644 152
56 3300005467 Ga0070706_100835108 Ga0070706_1008351082 152
57 3300005535 Ga0070684_100133443 Ga0070684_1001334432 152
58 3300005544 Ga0070686_100000153 Ga0070686_1000001539 152
59 3300005545 Ga0070695_100000013 Ga0070695_10000001314 152
60 3300005545 Ga0070695_100032985 Ga0070695_1000329854 152
61 3300005545 Ga0070695_100586122 Ga0070695_1005861222 152
62 3300005545 Ga0070695_100611236 Ga0070695_1006112361 152
63 3300005545 Ga0070695_100925443 Ga0070695_1009254431 152
64 3300005545 Ga0070695_100981121 Ga0070695_1009811211 152
65 3300005546 Ga0070696_100007129 Ga0070696_1000071293 152
66 3300005546 Ga0070696_100008086 Ga0070696_1000080862 152
67 3300005546 Ga0070696_100533208 Ga0070696_1005332082 152
68 3300005546 Ga0070696_100550875 Ga0070696_1005508752 152
69 3300005547 Ga0070693_100248446 Ga0070693_1002484462 152
70 3300005547 Ga0070693_100716098 Ga0070693_1007160982 152
71 3300005549 Ga0070704_101322865 Ga0070704_1013228651 152
72 3300005563 Ga0068855_100317114 Ga0068855_1003171142 152
73 3300005578 Ga0068854_100008015 Ga0068854_1000080152 152
74 3300005578 Ga0068854_100011351 Ga0068854_1000113513 152
75 3300005614 Ga0068856_100031335 Ga0068856_1000313352 152
76 3300005615 Ga0070702_100243735 Ga0070702_1002437352 152
77 3300005616 Ga0068852_100238120 Ga0068852_1002381202 152
78 3300005616 Ga0068852_100361852 Ga0068852_1003618522 152
79 3300005618 Ga0068864_101444255 Ga0068864_1014442552 152
80 3300005718 Ga0068866_10242582 Ga0068866_102425822 152
81 3300005719 Ga0068861_100012709 Ga0068861_1000127093 152
82 3300005719 Ga0068861_100051092 Ga0068861_1000510922 152
83 3300005719 Ga0068861_100405433 Ga0068861_1004054332 152
84 3300005842 Ga0068858_100862391 Ga0068858_1008623911 152
85 3300005843 Ga0068860_100274970 Ga0068860_1002749702 152
86 3300005843 Ga0068860_100861601 Ga0068860_1008616012 152
87 3300005844 Ga0068862_100043918 Ga0068862_1000439185 152
88 3300005844 Ga0068862_100178909 Ga0068862_1001789092 152
89 3300005844 Ga0068862_100704313 Ga0068862_1007043132 152
90 3300006178 Ga0075367_10018891 Ga0075367_100188912 152
91 3300006195 Ga0075366_10026956 Ga0075366_100269562 152
92 3300006852 Ga0075433_10050842 Ga0075433_100508422 152
93 3300006881 Ga0068865_100351331 Ga0068865_1003513312 152
94 3300006881 Ga0068865_100524618 Ga0068865_1005246182 152
95 3300006914 Ga0075436_100052587 Ga0075436_1000525872 152
96 3300006914 Ga0075436_100485414 Ga0075436_1004854141 152
97 3300006931 Ga0097620_100314818 Ga0097620_1003148182 152
98 3300009093 Ga0105240_10342108 Ga0105240_103421082 152
99 3300009094 Ga0111539_10028028 Ga0111539_100280285 152
100 3300009147 Ga0114129_10235325 Ga0114129_102353252 152
101 3300009148 Ga0105243_10449972 Ga0105243_104499722 152
102 3300009174 Ga0105241_10375433 Ga0105241_103754332 152
103 3300009174 Ga0105241_10757271 Ga0105241_107572712 152
104 3300009176 Ga0105242_10116616 Ga0105242_101166162 152
105 3300009176 Ga0105242_10187783 Ga0105242_101877832 152
106 3300009177 Ga0105248_10080482 Ga0105248_100804823 152
107 3300009553 Ga0105249_11114590 Ga0105249_111145902 152
108 3300009553 Ga0105249_11231712 Ga0105249_112317121 152
109 3300010375 Ga0105239_12408314 Ga0105239_124083141 152
110 3300011119 Ga0105246_10378878 Ga0105246_103788782 152
111 3300013104 Ga0157370_10711774 Ga0157370_107117742 152
112 3300013105 Ga0157369_10386158 Ga0157369_103861582 152
113 3300013296 Ga0157374_10155197 Ga0157374_101551972 152
114 3300013307 Ga0157372_10460337 Ga0157372_104603372 152
115 3300013308 Ga0157375_10755186 Ga0157375_107551862 152
116 3300014325 Ga0163163_10227833 Ga0163163_102278332 152
117 3300014326 Ga0157380_10057944 Ga0157380_100579442 152
118 3300014326 Ga0157380_10121340 Ga0157380_101213402 152
119 3300014745 Ga0157377_10055265 Ga0157377_100552652 152
120 3300017792 Ga0163161_10249687 Ga0163161_102496872 152
121 3300025315 Ga0207697_10082692 Ga0207697_100826922 152
122 3300025899 Ga0207642_10304844 Ga0207642_103048442 152
123 3300025901 Ga0207688_10108977 Ga0207688_101089772 152
124 3300025903 Ga0207680_10090828 Ga0207680_100908282 152
125 3300025907 Ga0207645_10001406 Ga0207645_100014066 152
126 3300025907 Ga0207645_10188096 Ga0207645_101880962 152
127 3300025909 Ga0207705_10099807 Ga0207705_100998075 152
128 3300025910 Ga0207684_10681004 Ga0207684_106810042 152
129 3300025917 Ga0207660_10410706 Ga0207660_104107062 152
130 3300025918 Ga0207662_10116396 Ga0207662_101163963 152
131 3300025918 Ga0207662_10436638 Ga0207662_104366382 152
132 3300025920 Ga0207649_10139007 Ga0207649_101390072 152
133 3300025923 Ga0207681_10022128 Ga0207681_100221282 152
134 3300025926 Ga0207659_10000079 Ga0207659_1000007926 152
135 3300025926 Ga0207659_10209420 Ga0207659_102094202 152
136 3300025933 Ga0207706_10045569 Ga0207706_100455692 152
137 3300025933 Ga0207706_10179083 Ga0207706_101790832 152
138 3300025934 Ga0207686_10994945 Ga0207686_109949451 152
139 3300025935 Ga0207709_10063505 Ga0207709_100635052 152
140 3300025937 Ga0207669_10358794 Ga0207669_103587942 152
141 3300025937 Ga0207669_10461390 Ga0207669_104613902 152
142 3300025937 Ga0207669_11066887 Ga0207669_110668871 152
143 3300025938 Ga0207704_10273315 Ga0207704_102733152 152
144 3300025942 Ga0207689_10414750 Ga0207689_104147502 152
145 3300025944 Ga0207661_10224860 Ga0207661_102248602 152
146 3300025944 Ga0207661_10295160 Ga0207661_102951602 152
147 3300025972 Ga0207668_10294731 Ga0207668_102947312 152
148 3300025981 Ga0207640_10007460 Ga0207640_100074602 152
149 3300025981 Ga0207640_10028125 Ga0207640_100281252 152
150 3300026041 Ga0207639_10539826 Ga0207639_105398261 152
151 3300026075 Ga0207708_10004337 Ga0207708_100043375 152
152 3300026075 Ga0207708_10027833 Ga0207708_100278332 152
153 3300026075 Ga0207708_10046797 Ga0207708_100467972 152
154 3300026078 Ga0207702_10008196 Ga0207702_100081967 152
155 3300026089 Ga0207648_10002536 Ga0207648_100025365 152
156 3300026095 Ga0207676_10536952 Ga0207676_105369522 152
157 3300026118 Ga0207675_100019034 Ga0207675_1000190344 152
158 3300026118 Ga0207675_100203574 Ga0207675_1002035742 152
159 3300026118 Ga0207675_100235685 Ga0207675_1002356852 152
160 3300026118 Ga0207675_100346802 Ga0207675_1003468022 152
161 3300026118 Ga0207675_100412931 Ga0207675_1004129312 152
162 3300026118 Ga0207675_100579393 Ga0207675_1005793933 152
163 3300026118 Ga0207675_102079836 Ga0207675_1020798361 152
164 3300026142 Ga0207698_10036810 Ga0207698_100368103 152
165 3300027907 Ga0207428_10003214 Ga0207428_100032149 152
166 3300027907 Ga0207428_10071655 Ga0207428_100716552 152
167 3300028380 Ga0268265_10029432 Ga0268265_100294322 152
168 3300028380 Ga0268265_10438076 Ga0268265_104380762 152
169 3300028380 Ga0268265_10525196 Ga0268265_105251961 152
170 3300028381 Ga0268264_12342838 Ga0268264_123428381 152
171 3300032002 Ga0307416_100547707 Ga0307416_1005477072 152
172 3300032002 Ga0307416_101169275 Ga0307416_1011692752 152
173 3300035115 Ga0373941_0033694 Ga0373941_0033694_626_1090 152
174 3300044694 Ga0466963_1026187 Ga0466963_1026187_69_527 152
175 3300044842 Ga0466957_1070575 Ga0466957_1070575_100_558 152
176 3300045051 Ga0451576_0129908 Ga0451576_0129908_1034_1492 152
177 3300045051 Ga0451576_0450726 Ga0451576_0450726_154_615 152
178 3300045976 Ga0466967_0833321 Ga0466967_0833321_12_482 152
179 3300046664 Ga0495659_0011168 Ga0495659_0011168_2147_2608 152
180 3300046684 Ga0495669_0318296 Ga0495669_0318296_72_530 152
181 3300047445 Ga0495677_0090315 Ga0495677_0090315_20_481 152
182 3300048905 Ga0496102_0203453 Ga0496102_0203453_1374_1835 152
183 3300048909 Ga0496106_0204995 Ga0496106_0204995_235_696 152
184 3300049580 Ga0501046_0356649 Ga0501046_0356649_584_1051 152
185 3300049588 Ga0501072_0470160 Ga0501072_0470160_471_938 152
186 3300049592 Ga0501076_0151923 Ga0501076_0151923_764_1231 152
187 3300049824 Ga0501045_0316168 Ga0501045_0316168_189_656 152
188 3300050493 nmdc:mga0k408_18241_c1 nmdc:mga0k408_18241_c1_841_1308 152
189 3300050494 nmdc:mga06z11_4077_c1 nmdc:mga06z11_4077_c1_2362_2829 152
190 3300050507 nmdc:mga05p37_989_c1 nmdc:mga05p37_989_c1_263_724 152
191 3300050511 nmdc:mga08y16_11940_c1 nmdc:mga08y16_11940_c1_6927_7385 152
192 3300050511 nmdc:mga08y16_4998_c1 nmdc:mga08y16_4998_c1_7300_7761 152
193 3300050513 nmdc:mga0rr50_211637_c1 nmdc:mga0rr50_211637_c1_107_577 152
194 3300050514 nmdc:mga08x19_104697_c1 nmdc:mga08x19_104697_c1_232_693 152
195 3300050515 nmdc:mga0a205_121753_c1 nmdc:mga0a205_121753_c1_337_795 152
196 3300050515 nmdc:mga0a205_948026_c1 nmdc:mga0a205_948026_c1_204_665 152
197 3300054114 Ga0501084_0265469 Ga0501084_0265469_606_1073 152
198 3300061734 Ga0530510_0486684 Ga0530510_0486684_208_669 152
199 3300005334 Ga0068869_100425728 Ga0068869_1004257281 153
200 3300005353 Ga0070669_100180720 Ga0070669_1001807202 153
201 3300005354 Ga0070675_100578898 Ga0070675_1005788982 153
202 3300005367 Ga0070667_100709687 Ga0070667_1007096872 153
203 3300005518 Ga0070699_100013629 Ga0070699_1000136292 153
204 3300005518 Ga0070699_100819083 Ga0070699_1008190832 153
205 3300005536 Ga0070697_100566761 Ga0070697_1005667612 153
206 3300005544 Ga0070686_100070428 Ga0070686_1000704282 153
207 3300005545 Ga0070695_100439617 Ga0070695_1004396172 153
208 3300005548 Ga0070665_100008640 Ga0070665_1000086408 153
209 3300005548 Ga0070665_100117069 Ga0070665_1001170692 153
210 3300005616 Ga0068852_100472096 Ga0068852_1004720962 153
211 3300005617 Ga0068859_101902663 Ga0068859_1019026631 153
212 3300005618 Ga0068864_100234757 Ga0068864_1002347572 153
213 3300005718 Ga0068866_10069929 Ga0068866_100699292 153
214 3300005719 Ga0068861_100378213 Ga0068861_1003782132 153
215 3300005834 Ga0068851_10189003 Ga0068851_101890031 153
216 3300005842 Ga0068858_100017044 Ga0068858_1000170442 153
217 3300005842 Ga0068858_100173908 Ga0068858_1001739081 153
218 3300005843 Ga0068860_100061409 Ga0068860_1000614092 153
219 3300006237 Ga0097621_100413069 Ga0097621_1004130692 153
220 3300006844 Ga0075428_100633123 Ga0075428_1006331233 153
221 3300006847 Ga0075431_100425216 Ga0075431_1004252162 153
222 3300006852 Ga0075433_10019086 Ga0075433_100190862 153
223 3300006914 Ga0075436_100026454 Ga0075436_1000264542 153
224 3300006914 Ga0075436_100035274 Ga0075436_1000352744 153
225 3300006931 Ga0097620_101902409 Ga0097620_1019024091 153
226 3300009094 Ga0111539_10086580 Ga0111539_100865802 153
227 3300009094 Ga0111539_10102668 Ga0111539_101026682 153
228 3300009094 Ga0111539_10209070 Ga0111539_102090703 153
229 3300009094 Ga0111539_10493323 Ga0111539_104933232 153
230 3300009098 Ga0105245_10013815 Ga0105245_100138152 153
231 3300009147 Ga0114129_10231163 Ga0114129_102311633 153
232 3300009147 Ga0114129_10377678 Ga0114129_103776782 153
233 3300009176 Ga0105242_10086482 Ga0105242_100864822 153
234 3300009176 Ga0105242_10298350 Ga0105242_102983502 153
235 3300009553 Ga0105249_10166850 Ga0105249_101668502 153
236 3300013296 Ga0157374_10258659 Ga0157374_102586592 153
237 3300013297 Ga0157378_10083682 Ga0157378_100836823 153
238 3300014326 Ga0157380_10046121 Ga0157380_100461214 153
239 3300014326 Ga0157380_10091606 Ga0157380_100916063 153
240 3300014326 Ga0157380_10099365 Ga0157380_100993653 153
241 3300014968 Ga0157379_10068624 Ga0157379_100686242 153
242 3300014969 Ga0157376_10029506 Ga0157376_100295062 153
243 3300025899 Ga0207642_10061529 Ga0207642_100615292 153
244 3300025926 Ga0207659_10302044 Ga0207659_103020442 153
245 3300025926 Ga0207659_10861235 Ga0207659_108612351 153
246 3300025927 Ga0207687_10215455 Ga0207687_102154552 153
247 3300025934 Ga0207686_10183767 Ga0207686_101837672 153
248 3300025942 Ga0207689_10416128 Ga0207689_104161281 153
249 3300025986 Ga0207658_10564805 Ga0207658_105648052 153
250 3300026035 Ga0207703_10028554 Ga0207703_100285545 153
251 3300026095 Ga0207676_10446165 Ga0207676_104461652 153
252 3300026118 Ga0207675_100427669 Ga0207675_1004276692 153
253 3300026142 Ga0207698_10396867 Ga0207698_103968672 153
254 3300027907 Ga0207428_10052174 Ga0207428_100521743 153
255 3300027907 Ga0207428_10104551 Ga0207428_101045512 153
256 3300028379 Ga0268266_10019822 Ga0268266_100198222 153
257 3300028379 Ga0268266_10271821 Ga0268266_102718212 153
258 3300028380 Ga0268265_10298797 Ga0268265_102987971 153
259 3300028380 Ga0268265_10718947 Ga0268265_107189472 153
260 3300028381 Ga0268264_10226506 Ga0268264_102265062 153
261 3300028381 Ga0268264_10292267 Ga0268264_102922672 153
262 3300030521 Ga0307511_10289271 Ga0307511_102892712 153
263 3300031824 Ga0307413_10506903 Ga0307413_105069032 153
264 3300035113 Ga0373936_0464862 Ga0373936_0464862_92_559 153
265 3300035172 Ga0373955_0168279 Ga0373955_0168279_804_1271 153
266 3300035172 Ga0373955_0305726 Ga0373955_0305726_290_757 153
267 3300035410 Ga0373924_0292947 Ga0373924_0292947_224_691 153
268 3300036401 Ga0373937_0012405 Ga0373937_0012405_1658_2125 153
269 3300036401 Ga0373937_0370300 Ga0373937_0370300_121_588 153
270 3300036401 Ga0373937_1000478 Ga0373937_1000478_211_678 153
271 3300037068 Ga0373925_0398317 Ga0373925_0398317_479_952 153
272 3300042439 Ga0439464_0089396 Ga0439464_0089396_132_704 153
273 3300045051 Ga0451576_0986814 Ga0451576_0986814_266_736 153
274 3300045051 Ga0451576_1942141 Ga0451576_1942141_36_515 153
275 3300046462 Ga0495651_0205239 Ga0495651_0205239_240_707 153
276 3300046516 Ga0495628_0427805 Ga0495628_0427805_203_670 153
277 3300046516 Ga0495628_0503820 Ga0495628_0503820_98_565 153
278 3300046539 Ga0495621_0442798 Ga0495621_0442798_18_488 153
279 3300046543 Ga0495645_0002325 Ga0495645_0002325_639_1106 153
280 3300046678 Ga0495599_0043797 Ga0495599_0043797_652_1122 153
281 3300046678 Ga0495599_0124401 Ga0495599_0124401_446_913 153
282 3300046683 Ga0495658_0083279 Ga0495658_0083279_120_587 153
283 3300046689 Ga0495613_0699965 Ga0495613_0699965_141_608 153
284 3300046692 Ga0495671_0245366 Ga0495671_0245366_349_816 153
285 3300047322 Ga0495680_0338784 Ga0495680_0338784_57_524 153
286 3300047471 Ga0495684_0030629 Ga0495684_0030629_1128_1595 153
287 3300048904 Ga0496101_0202761 Ga0496101_0202761_185_655 153
288 3300048907 Ga0496104_0429069 Ga0496104_0429069_270_731 153
289 3300048908 Ga0496105_0666239 Ga0496105_0666239_294_761 153
290 3300048908 Ga0496105_1063580 Ga0496105_1063580_72_542 153
291 3300048918 Ga0496115_0214081 Ga0496115_0214081_985_1455 153
292 3300049588 Ga0501072_0690087 Ga0501072_0690087_110_574 153
293 3300049591 Ga0501075_0322649 Ga0501075_0322649_59_523 153
294 3300050507 nmdc:mga05p37_539440_c1 nmdc:mga05p37_539440_c1_610_1086 153
295 3300050507 nmdc:mga05p37_645546_c1 nmdc:mga05p37_645546_c1_302_778 153
296 3300050509 nmdc:mga0qj67_1253555_c1 nmdc:mga0qj67_1253555_c1_55_516 153
297 3300050509 nmdc:mga0qj67_398088_c1 nmdc:mga0qj67_398088_c1_86_562 153
298 3300050510 nmdc:mga06r32_614683_c1 nmdc:mga06r32_614683_c1_556_1017 153
299 3300050511 nmdc:mga08y16_122872_c1 nmdc:mga08y16_122872_c1_829_1308 153
300 3300050511 nmdc:mga08y16_217979_c1 nmdc:mga08y16_217979_c1_1200_1670 153
301 3300050511 nmdc:mga08y16_26996_c1 nmdc:mga08y16_26996_c1_2406_2882 153
302 3300050514 nmdc:mga08x19_12387_c1 nmdc:mga08x19_12387_c1_974_1438 153
303 3300053084 Ga0495595_0022357 Ga0495595_0022357_1408_1875 153
304 3300005338 Ga0068868_100299800 Ga0068868_1002998002 154
305 3300005356 Ga0070674_100412060 Ga0070674_1004120602 154
306 3300005356 Ga0070674_100501274 Ga0070674_1005012742 154
307 3300005518 Ga0070699_100042236 Ga0070699_1000422362 154
308 3300006871 Ga0075434_100347945 Ga0075434_1003479452 154
309 3300009147 Ga0114129_10000426 Ga0114129_1000042617 154
310 3300009177 Ga0105248_10920304 Ga0105248_109203041 154
311 3300013306 Ga0163162_10501363 Ga0163162_105013632 154
312 3300013306 Ga0163162_10575760 Ga0163162_105757602 154
313 3300013308 Ga0157375_12210283 Ga0157375_122102831 154
314 3300014325 Ga0163163_10504106 Ga0163163_105041062 154
315 3300014969 Ga0157376_10200404 Ga0157376_102004042 154
316 3300025919 Ga0207657_10573303 Ga0207657_105733031 154
317 3300025934 Ga0207686_11044443 Ga0207686_110444432 154
318 3300025938 Ga0207704_10351195 Ga0207704_103511952 154
319 3300025940 Ga0207691_10122470 Ga0207691_101224702 154
320 3300025941 Ga0207711_10389796 Ga0207711_103897962 154
321 3300036401 Ga0373937_0382300 Ga0373937_0382300_799_1290 154
322 3300046674 Ga0495588_0512114 Ga0495588_0512114_15_482 154
323 3300048917 Ga0496114_0078312 Ga0496114_0078312_551_1021 154
324 3300049569 Ga0501032_0003850 Ga0501032_0003850_7474_7953 154
325 3300049569 Ga0501032_0004854 Ga0501032_0004854_7583_8062 154
326 3300049570 Ga0501033_0003710 Ga0501033_0003710_2173_2652 154
327 3300049570 Ga0501033_0023579 Ga0501033_0023579_2038_2517 154
328 3300049570 Ga0501033_0588083 Ga0501033_0588083_85_594 154
329 3300049571 Ga0501034_0036744 Ga0501034_0036744_1289_1768 154
330 3300049571 Ga0501034_0143034 Ga0501034_0143034_201_680 154
331 3300049572 Ga0501036_0003430 Ga0501036_0003430_8799_9278 154
332 3300049572 Ga0501036_0015810 Ga0501036_0015810_4451_4930 154
333 3300049572 Ga0501036_0047881 Ga0501036_0047881_2373_2882 154
334 3300049572 Ga0501036_1367980 Ga0501036_1367980_19_498 154
335 3300049573 Ga0501037_0020405 Ga0501037_0020405_1729_2208 154
336 3300049573 Ga0501037_0022219 Ga0501037_0022219_2239_2718 154
337 3300049574 Ga0501038_0025440 Ga0501038_0025440_3380_3859 154
338 3300049574 Ga0501038_0078591 Ga0501038_0078591_359_838 154
339 3300049575 Ga0501039_0054148 Ga0501039_0054148_1468_1947 154
340 3300049575 Ga0501039_0223794 Ga0501039_0223794_461_970 154
341 3300049576 Ga0501040_0014862 Ga0501040_0014862_2496_3005 154
342 3300049576 Ga0501040_0304172 Ga0501040_0304172_478_957 154
343 3300049576 Ga0501040_0484813 Ga0501040_0484813_197_676 154
344 3300049577 Ga0501041_0061439 Ga0501041_0061439_1450_1959 154
345 3300049578 Ga0501042_0076064 Ga0501042_0076064_188_667 154
346 3300049578 Ga0501042_0499453 Ga0501042_0499453_184_663 154
347 3300049579 Ga0501043_0016613 Ga0501043_0016613_3151_3630 154
348 3300049580 Ga0501046_0048701 Ga0501046_0048701_2406_2885 154
349 3300049580 Ga0501046_0105391 Ga0501046_0105391_411_890 154
350 3300049581 Ga0501047_0025544 Ga0501047_0025544_3850_4329 154
351 3300049581 Ga0501047_0045386 Ga0501047_0045386_2080_2559 154
352 3300049581 Ga0501047_0046619 Ga0501047_0046619_3017_3496 154
353 3300049581 Ga0501047_1236761 Ga0501047_1236761_38_514 154
354 3300049582 Ga0501048_0003526 Ga0501048_0003526_478_957 154
355 3300049582 Ga0501048_0025034 Ga0501048_0025034_3027_3506 154
356 3300049582 Ga0501048_0051788 Ga0501048_0051788_2126_2635 154
357 3300049582 Ga0501048_0077759 Ga0501048_0077759_1563_2042 154
358 3300049583 Ga0501067_0009296 Ga0501067_0009296_3892_4371 154
359 3300049583 Ga0501067_0259441 Ga0501067_0259441_199_678 154
360 3300049584 Ga0501068_0001251 Ga0501068_0001251_1925_2404 154
361 3300049584 Ga0501068_0007676 Ga0501068_0007676_2834_3313 154
362 3300049584 Ga0501068_0046814 Ga0501068_0046814_1890_2369 154
363 3300049585 Ga0501069_0009755 Ga0501069_0009755_4566_5045 154
364 3300049585 Ga0501069_0104145 Ga0501069_0104145_140_619 154
365 3300049586 Ga0501070_0018320 Ga0501070_0018320_3773_4252 154
366 3300049587 Ga0501071_0000369 Ga0501071_0000369_9958_10437 154
367 3300049587 Ga0501071_0030947 Ga0501071_0030947_108_587 154
368 3300049587 Ga0501071_0058867 Ga0501071_0058867_2085_2594 154
369 3300049588 Ga0501072_0089570 Ga0501072_0089570_360_869 154
370 3300049588 Ga0501072_0446882 Ga0501072_0446882_288_767 154
371 3300049589 Ga0501073_0003611 Ga0501073_0003611_6238_6717 154
372 3300049589 Ga0501073_0007039 Ga0501073_0007039_2993_3472 154
373 3300049589 Ga0501073_0069301 Ga0501073_0069301_1563_2042 154
374 3300049590 Ga0501074_0000449 Ga0501074_0000449_16957_17436 154
375 3300049590 Ga0501074_0022878 Ga0501074_0022878_795_1274 154
376 3300049590 Ga0501074_0032931 Ga0501074_0032931_1507_1986 154
377 3300049590 Ga0501074_0132167 Ga0501074_0132167_58_567 154
378 3300049591 Ga0501075_0031363 Ga0501075_0031363_1642_2151 154
379 3300049592 Ga0501076_0027186 Ga0501076_0027186_2874_3383 154
380 3300049593 Ga0501077_0075754 Ga0501077_0075754_1410_1919 154
381 3300049741 Ga0501079_0004204 Ga0501079_0004204_9119_9598 154
382 3300049741 Ga0501079_0005948 Ga0501079_0005948_3855_4334 154
383 3300049741 Ga0501079_0007653 Ga0501079_0007653_1097_1576 154
384 3300049742 Ga0501080_0051593 Ga0501080_0051593_1931_2410 154
385 3300049742 Ga0501080_0250133 Ga0501080_0250133_1052_1561 154
386 3300049743 Ga0501081_0031836 Ga0501081_0031836_1977_2486 154
387 3300049744 Ga0501083_0013241 Ga0501083_0013241_3810_4289 154
388 3300049822 Ga0501035_0003099 Ga0501035_0003099_2534_3013 154
389 3300049822 Ga0501035_0007716 Ga0501035_0007716_3038_3517 154
390 3300049822 Ga0501035_0060857 Ga0501035_0060857_57_536 154
391 3300049823 Ga0501044_0013275 Ga0501044_0013275_4250_4729 154
392 3300049823 Ga0501044_0133102 Ga0501044_0133102_900_1379 154
393 3300049824 Ga0501045_0002867 Ga0501045_0002867_7084_7593 154
394 3300049824 Ga0501045_0010485 Ga0501045_0010485_10_489 154
395 3300050507 nmdc:mga05p37_58752_c1 nmdc:mga05p37_58752_c1_905_1378 154
396 3300050509 nmdc:mga0qj67_7629_c1 nmdc:mga0qj67_7629_c1_7157_7636 154
397 3300050512 nmdc:mga0n895_48993_c1 nmdc:mga0n895_48993_c1_636_1109 154
398 3300050512 nmdc:mga0n895_630731_c1 nmdc:mga0n895_630731_c1_168_632 154
399 3300054114 Ga0501084_0013745 Ga0501084_0013745_842_1351 154
400 3300060353 Ga0501082_0002846 Ga0501082_0002846_11889_12368 154
401 3300060353 Ga0501082_0017551 Ga0501082_0017551_1265_1744 154
402 3300060353 Ga0501082_0036362 Ga0501082_0036362_1328_1807 154
403 3300060353 Ga0501082_0089451 Ga0501082_0089451_1796_2305 154
404 3300061734 Ga0530510_0016973 Ga0530510_0016973_905_1414 154
405 3300005293 Ga0065715_10154999 Ga0065715_101549992 155
406 3300005293 Ga0065715_10236571 Ga0065715_102365712 155
407 3300005295 Ga0065707_10004595 Ga0065707_100045952 155
408 3300005295 Ga0065707_10163550 Ga0065707_101635502 155
409 3300005329 Ga0070683_100098876 Ga0070683_1000988761 155
410 3300005331 Ga0070670_100423309 Ga0070670_1004233092 155
411 3300005333 Ga0070677_10059521 Ga0070677_100595212 155
412 3300005345 Ga0070692_10481672 Ga0070692_104816721 155
413 3300005353 Ga0070669_100012308 Ga0070669_1000123087 155
414 3300005354 Ga0070675_100219255 Ga0070675_1002192552 155
415 3300005354 Ga0070675_100876522 Ga0070675_1008765221 155
416 3300005354 Ga0070675_101308552 Ga0070675_1013085521 155
417 3300005365 Ga0070688_100041978 Ga0070688_1000419782 155
418 3300005366 Ga0070659_100311161 Ga0070659_1003111611 155
419 3300005366 Ga0070659_101352784 Ga0070659_1013527841 155
420 3300005436 Ga0070713_100755611 Ga0070713_1007556112 155
421 3300005441 Ga0070700_100253744 Ga0070700_1002537442 155
422 3300005455 Ga0070663_100578049 Ga0070663_1005780491 155
423 3300005456 Ga0070678_100354657 Ga0070678_1003546572 155
424 3300005456 Ga0070678_100529990 Ga0070678_1005299902 155
425 3300005457 Ga0070662_100371558 Ga0070662_1003715582 155
426 3300005458 Ga0070681_10387246 Ga0070681_103872462 155
427 3300005545 Ga0070695_100571070 Ga0070695_1005710702 155
428 3300005547 Ga0070693_100041130 Ga0070693_1000411302 155
429 3300005549 Ga0070704_100080788 Ga0070704_1000807882 155
430 3300005549 Ga0070704_100280490 Ga0070704_1002804902 155
431 3300005549 Ga0070704_101008460 Ga0070704_1010084602 155
432 3300005577 Ga0068857_100087396 Ga0068857_1000873963 155
433 3300005617 Ga0068859_100857192 Ga0068859_1008571922 155
434 3300005844 Ga0068862_100010510 Ga0068862_1000105102 155
435 3300006237 Ga0097621_100000125 Ga0097621_10000012523 155
436 3300006237 Ga0097621_100157874 Ga0097621_1001578742 155
437 3300006358 Ga0068871_100000134 Ga0068871_10000013434 155
438 3300006844 Ga0075428_100006263 Ga0075428_10000626310 155
439 3300006846 Ga0075430_100000722 Ga0075430_10000072215 155
440 3300006846 Ga0075430_100784597 Ga0075430_1007845971 155
441 3300006847 Ga0075431_100019089 Ga0075431_1000190893 155
442 3300006847 Ga0075431_100019172 Ga0075431_1000191725 155
443 3300006847 Ga0075431_101080915 Ga0075431_1010809152 155
444 3300006852 Ga0075433_10017226 Ga0075433_100172264 155
445 3300006852 Ga0075433_10219449 Ga0075433_102194492 155
446 3300006871 Ga0075434_100005743 Ga0075434_1000057437 155
447 3300006871 Ga0075434_100192132 Ga0075434_1001921322 155
448 3300006871 Ga0075434_100447361 Ga0075434_1004473612 155
449 3300006871 Ga0075434_100459628 Ga0075434_1004596282 155
450 3300006871 Ga0075434_100944548 Ga0075434_1009445482 155
451 3300006880 Ga0075429_100002690 Ga0075429_10000269011 155
452 3300006880 Ga0075429_100284206 Ga0075429_1002842061 155
453 3300006880 Ga0075429_101187194 Ga0075429_1011871941 155
454 3300006881 Ga0068865_100520064 Ga0068865_1005200642 155
455 3300006931 Ga0097620_100770166 Ga0097620_1007701662 155
456 3300006931 Ga0097620_100857188 Ga0097620_1008571882 155
457 3300007076 Ga0075435_100006762 Ga0075435_1000067626 155
458 3300007076 Ga0075435_100065440 Ga0075435_1000654402 155
459 3300009093 Ga0105240_11365940 Ga0105240_113659402 155
460 3300009094 Ga0111539_10000230 Ga0111539_1000023030 155
461 3300009094 Ga0111539_10003342 Ga0111539_100033426 155
462 3300009094 Ga0111539_10123958 Ga0111539_101239583 155
463 3300009094 Ga0111539_10135036 Ga0111539_101350362 155
464 3300009094 Ga0111539_10158865 Ga0111539_101588652 155
465 3300009094 Ga0111539_10192426 Ga0111539_101924262 155
466 3300009094 Ga0111539_10197521 Ga0111539_101975212 155
467 3300009098 Ga0105245_12905016 Ga0105245_129050161 155
468 3300009147 Ga0114129_10013149 Ga0114129_100131496 155
469 3300009147 Ga0114129_10014774 Ga0114129_100147742 155
470 3300009147 Ga0114129_11721348 Ga0114129_117213482 155
471 3300009148 Ga0105243_10960054 Ga0105243_109600542 155
472 3300009148 Ga0105243_10998721 Ga0105243_109987211 155
473 3300009174 Ga0105241_10463331 Ga0105241_104633311 155
474 3300009553 Ga0105249_10009745 Ga0105249_100097455 155
475 3300009553 Ga0105249_10267327 Ga0105249_102673272 155
476 3300013296 Ga0157374_10017943 Ga0157374_100179432 155
477 3300013297 Ga0157378_10009109 Ga0157378_100091095 155
478 3300013306 Ga0163162_11310218 Ga0163162_113102182 155
479 3300013308 Ga0157375_12826462 Ga0157375_128264621 155
480 3300014325 Ga0163163_10210923 Ga0163163_102109232 155
481 3300014326 Ga0157380_10287534 Ga0157380_102875342 155
482 3300014326 Ga0157380_10830505 Ga0157380_108305052 155
483 3300014326 Ga0157380_10902687 Ga0157380_109026871 155
484 3300014326 Ga0157380_10953974 Ga0157380_109539742 155
485 3300014745 Ga0157377_10063934 Ga0157377_100639342 155
486 3300014968 Ga0157379_10198779 Ga0157379_101987792 155
487 3300014968 Ga0157379_10274633 Ga0157379_102746332 155
488 3300014969 Ga0157376_10049362 Ga0157376_100493622 155
489 3300025271 Ga0207666_1026369 Ga0207666_10263692 155
490 3300025901 Ga0207688_10446579 Ga0207688_104465791 155
491 3300025906 Ga0207699_10298849 Ga0207699_102988491 155
492 3300025912 Ga0207707_10139577 Ga0207707_101395772 155
493 3300025912 Ga0207707_10360121 Ga0207707_103601212 155
494 3300025923 Ga0207681_10004564 Ga0207681_100045642 155
495 3300025925 Ga0207650_10359794 Ga0207650_103597942 155
496 3300025932 Ga0207690_10413689 Ga0207690_104136891 155
497 3300025932 Ga0207690_10520639 Ga0207690_105206391 155
498 3300025933 Ga0207706_10108716 Ga0207706_101087162 155
499 3300025935 Ga0207709_10649709 Ga0207709_106497092 155
500 3300025961 Ga0207712_10055161 Ga0207712_100551611 155
501 3300026035 Ga0207703_10078831 Ga0207703_100788311 155
502 3300026075 Ga0207708_10094753 Ga0207708_100947532 155
503 3300026075 Ga0207708_10161966 Ga0207708_101619661 155
504 3300026075 Ga0207708_10405455 Ga0207708_104054552 155
505 3300026116 Ga0207674_10102878 Ga0207674_101028782 155
506 3300026121 Ga0207683_10364934 Ga0207683_103649342 155
507 3300026142 Ga0207698_10218136 Ga0207698_102181362 155
508 3300027907 Ga0207428_10000531 Ga0207428_1000053126 155
509 3300027907 Ga0207428_10046855 Ga0207428_100468552 155
510 3300027907 Ga0207428_10460104 Ga0207428_104601042 155
511 3300028380 Ga0268265_11478861 Ga0268265_114788611 155
512 3300028381 Ga0268264_10453545 Ga0268264_104535451 155
513 3300031548 Ga0307408_100013807 Ga0307408_1000138076 155
514 3300031548 Ga0307408_100028512 Ga0307408_1000285123 155
515 3300031731 Ga0307405_11418614 Ga0307405_114186141 155
516 3300031824 Ga0307413_10174622 Ga0307413_101746222 155
517 3300031901 Ga0307406_10268399 Ga0307406_102683992 155
518 3300031903 Ga0307407_10240046 Ga0307407_102400463 155
519 3300031903 Ga0307407_10265782 Ga0307407_102657822 155
520 3300031911 Ga0307412_10136776 Ga0307412_101367762 155
521 3300031995 Ga0307409_100392431 Ga0307409_1003924312 155
522 3300032002 Ga0307416_100016217 Ga0307416_1000162176 155
523 3300032002 Ga0307416_100438454 Ga0307416_1004384541 155
524 3300032002 Ga0307416_100632165 Ga0307416_1006321652 155
525 3300032002 Ga0307416_100974381 Ga0307416_1009743812 155
526 3300032005 Ga0307411_10144227 Ga0307411_101442272 155
527 3300032005 Ga0307411_10446158 Ga0307411_104461582 155
528 3300032126 Ga0307415_100236844 Ga0307415_1002368442 155
529 3300035114 Ga0373939_0408306 Ga0373939_0408306_17_493 155
530 3300035118 Ga0373954_0409777 Ga0373954_0409777_51_542 155
531 3300042008 Ga0439450_003896 Ga0439450_003896_291_788 155
532 3300042439 Ga0439464_0002262 Ga0439464_0002262_20_517 155
533 3300042439 Ga0439464_0205519 Ga0439464_0205519_48_515 155
534 3300042461 Ga0439460_0130755 Ga0439460_0130755_60_557 155
535 3300042530 Ga0450916_002278 Ga0450916_002278_1093_1563 155
536 3300045051 Ga0451576_0461969 Ga0451576_0461969_815_1306 155
537 3300046455 Ga0495603_0088042 Ga0495603_0088042_906_1397 155
538 3300046459 Ga0495629_0269491 Ga0495629_0269491_275_766 155
539 3300046472 Ga0495580_0042467 Ga0495580_0042467_71_547 155
540 3300046475 Ga0495639_0048556 Ga0495639_0048556_1168_1644 155
541 3300046499 Ga0495594_0339188 Ga0495594_0339188_177_653 155
542 3300046522 Ga0495643_0002984 Ga0495643_0002984_8992_9492 155
543 3300046531 Ga0495665_0422780 Ga0495665_0422780_153_629 155
544 3300048904 Ga0496101_0129213 Ga0496101_0129213_616_1107 155
545 3300048905 Ga0496102_0010247 Ga0496102_0010247_1522_2013 155
546 3300048905 Ga0496102_0282283 Ga0496102_0282283_101_595 155
547 3300048905 Ga0496102_0379283 Ga0496102_0379283_719_1186 155
548 3300048908 Ga0496105_0615060 Ga0496105_0615060_152_625 155
549 3300048909 Ga0496106_0054612 Ga0496106_0054612_339_830 155
550 3300048909 Ga0496106_0597668 Ga0496106_0597668_155_646 155
551 3300048912 Ga0496109_0042829 Ga0496109_0042829_2595_3086 155
552 3300048913 Ga0496110_0120594 Ga0496110_0120594_1853_2344 155
553 3300049514 Ga0501291_009568 Ga0501291_009568_743_1240 155
554 3300049522 Ga0501299_005008 Ga0501299_005008_134_619 155
555 3300049522 Ga0501299_094995 Ga0501299_094995_93_563 155
556 3300049523 Ga0501300_054067 Ga0501300_054067_112_609 155
557 3300049577 Ga0501041_0066506 Ga0501041_0066506_902_1393 155
558 3300049578 Ga0501042_0313517 Ga0501042_0313517_574_1080 155
559 3300049578 Ga0501042_0594062 Ga0501042_0594062_218_709 155
560 3300049579 Ga0501043_0703662 Ga0501043_0703662_213_704 155
561 3300049584 Ga0501068_0191371 Ga0501068_0191371_320_793 155
562 3300049587 Ga0501071_0296193 Ga0501071_0296193_605_1096 155
563 3300049587 Ga0501071_0580256 Ga0501071_0580256_87_557 155
564 3300049588 Ga0501072_0162545 Ga0501072_0162545_387_893 155
565 3300049588 Ga0501072_0182961 Ga0501072_0182961_764_1255 155
566 3300049588 Ga0501072_0655680 Ga0501072_0655680_209_679 155
567 3300049589 Ga0501073_0109131 Ga0501073_0109131_1366_1863 155
568 3300049589 Ga0501073_0464242 Ga0501073_0464242_15_506 155
569 3300049590 Ga0501074_0089065 Ga0501074_0089065_190_681 155
570 3300049590 Ga0501074_0249386 Ga0501074_0249386_527_1033 155
571 3300049591 Ga0501075_0166972 Ga0501075_0166972_994_1500 155
572 3300049591 Ga0501075_0174013 Ga0501075_0174013_1052_1543 155
573 3300049592 Ga0501076_0093817 Ga0501076_0093817_523_1014 155
574 3300049661 Ga0501217_005251 Ga0501217_005251_2134_2619 155
575 3300049661 Ga0501217_017168 Ga0501217_017168_994_1491 155
576 3300049679 Ga0501249_014431 Ga0501249_014431_637_1122 155
577 3300049741 Ga0501079_0018154 Ga0501079_0018154_3099_3590 155
578 3300049741 Ga0501079_0401809 Ga0501079_0401809_231_737 155
579 3300049742 Ga0501080_0143848 Ga0501080_0143848_271_762 155
580 3300049742 Ga0501080_0791464 Ga0501080_0791464_299_796 155
581 3300049743 Ga0501081_0105438 Ga0501081_0105438_541_1032 155
582 3300049743 Ga0501081_0275222 Ga0501081_0275222_589_1059 155
583 3300049760 Ga0501263_015189 Ga0501263_015189_449_934 155
584 3300049766 Ga0501269_014350 Ga0501269_014350_273_770 155
585 3300049824 Ga0501045_0049979 Ga0501045_0049979_1733_2239 155
586 3300050507 nmdc:mga05p37_2516_c1 nmdc:mga05p37_2516_c1_10464_10961 155
587 3300050507 nmdc:mga05p37_7882_c1 nmdc:mga05p37_7882_c1_11849_12349 155
588 3300050507 nmdc:mga05p37_88013_c1 nmdc:mga05p37_88013_c1_621_1112 155
589 3300050508 nmdc:mga09592_114159_c1 nmdc:mga09592_114159_c1_705_1205 155
590 3300050508 nmdc:mga09592_4993_c1 nmdc:mga09592_4993_c1_10122_10619 155
591 3300050509 nmdc:mga0qj67_330482_c1 nmdc:mga0qj67_330482_c1_722_1216 155
592 3300050509 nmdc:mga0qj67_4908_c1 nmdc:mga0qj67_4908_c1_5563_6060 155
593 3300050509 nmdc:mga0qj67_760675_c1 nmdc:mga0qj67_760675_c1_156_656 155
594 3300050510 nmdc:mga06r32_150798_c1 nmdc:mga06r32_150798_c1_1211_1714 155
595 3300050510 nmdc:mga06r32_7703_c1 nmdc:mga06r32_7703_c1_7108_7605 155
596 3300050511 nmdc:mga08y16_28335_c1 nmdc:mga08y16_28335_c1_2754_3254 155
597 3300050511 nmdc:mga08y16_3154_c1 nmdc:mga08y16_3154_c1_4332_4832 155
598 3300050511 nmdc:mga08y16_506340_c1 nmdc:mga08y16_506340_c1_191_694 155
599 3300050511 nmdc:mga08y16_530460_c1 nmdc:mga08y16_530460_c1_84_584 155
600 3300050512 nmdc:mga0n895_149987_c1 nmdc:mga0n895_149987_c1_788_1282 155
601 3300050512 nmdc:mga0n895_178404_c1 nmdc:mga0n895_178404_c1_1021_1497 155
602 3300050512 nmdc:mga0n895_512256_c1 nmdc:mga0n895_512256_c1_151_651 155
603 3300050512 nmdc:mga0n895_699526_c1 nmdc:mga0n895_699526_c1_60_551 155
604 3300050512 nmdc:mga0n895_822456_c1 nmdc:mga0n895_822456_c1_263_778 155
605 3300050513 nmdc:mga0rr50_89061_c1 nmdc:mga0rr50_89061_c1_187_687 155
606 3300050514 nmdc:mga08x19_553990_c1 nmdc:mga08x19_553990_c1_232_723 155
607 3300050515 nmdc:mga0a205_158688_c1 nmdc:mga0a205_158688_c1_243_764 155
608 3300050515 nmdc:mga0a205_28813_c2 nmdc:mga0a205_28813_c2_1282_1773 155
609 3300050515 nmdc:mga0a205_31626_c1 nmdc:mga0a205_31626_c1_1575_2120 155
610 3300050515 nmdc:mga0a205_475330_c1 nmdc:mga0a205_475330_c1_110_625 155
611 3300053085 Ga0495619_0071960 Ga0495619_0071960_714_1190 155
612 3300054114 Ga0501084_0020526 Ga0501084_0020526_2028_2519 155
613 3300054114 Ga0501084_0134859 Ga0501084_0134859_711_1208 155
614 3300054114 Ga0501084_0203634 Ga0501084_0203634_1013_1519 155
615 3300060353 Ga0501082_0304075 Ga0501082_0304075_241_732 155
616 3300005468 Ga0070707_100900779 Ga0070707_1009007791 156
617 3300006846 Ga0075430_100000247 Ga0075430_10000024718 156
618 3300011119 Ga0105246_10143870 Ga0105246_101438701 156
619 3300013308 Ga0157375_10021964 Ga0157375_100219642 156
620 3300025935 Ga0207709_10386372 Ga0207709_103863722 156
621 3300026116 Ga0207674_10359673 Ga0207674_103596733 156
622 3300027665 Ga0209983_1040463 Ga0209983_10404632 156
623 3300035085 Ga0373929_0226116 Ga0373929_0226116_30_521 156
624 3300035091 Ga0373951_0056175 Ga0373951_0056175_151_642 156
625 3300035092 Ga0373952_0248037 Ga0373952_0248037_26_517 156
626 3300035112 Ga0373932_0015319 Ga0373932_0015319_1287_1778 156
627 3300045051 Ga0451576_0173529 Ga0451576_0173529_171_662 156
628 3300050507 nmdc:mga05p37_614492_c1 nmdc:mga05p37_614492_c1_630_1121 156
629 3300050508 nmdc:mga09592_58882_c1 nmdc:mga09592_58882_c1_1858_2349 156
630 3300050511 nmdc:mga08y16_176486_c1 nmdc:mga08y16_176486_c1_1067_1558 156
631 3300050512 nmdc:mga0n895_1515_c1 nmdc:mga0n895_1515_c1_9989_10480 156
632 3300050515 nmdc:mga0a205_613_c1 nmdc:mga0a205_613_c1_9472_9963 156
633 3300003203 JGI25406J46586_10085755 JGI25406J46586_100857552 157
634 3300005985 Ga0081539_10002012 Ga0081539_1000201220 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01467

CTP_transf_like

Cytidylyltransferase-like

57

183

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xf2-assembly1.cif.gz_A crystal structure of semet-hldc from burkholderia pseudomallei 0.9203 3 139
1n1d-assembly1.cif.gz_A glycerol-3-phosphate cytidylyltransferase complexed with cdp-glycerol 0.8848 23 152
5x9q-assembly1.cif.gz_B crystal structure of hldc from burkholderia pseudomallei 0.8771 3 157
2b7l-assembly2.cif.gz_D crystal structure of ctp:glycerol-3-phosphate cytidylyltransferase from staphylococcus aureus 0.8684 23 139
1n1d-assembly1.cif.gz_A glycerol-3-phosphate cytidylyltransferase complexed with cdp-glycerol 0.865 23 152
ID Description Score Start End Superfamily
af_P76658_320_476_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.976 1 154 3.40.50.620
1cozA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9105 23 152 3.40.50.620
1cozA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8901 23 152 3.40.50.620
af_Q58579_1_142_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8712 22 157 3.40.50.620
2b7lD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8684 23 139 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A2V8IR58-F1-model_v4 D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase (EC 2.7.7.70) 0.9998 2 154 GO:0005524
GO:0005975
GO:0009058
GO:0016773
GO:0016779
AF-A0A7V2YBR4-F1-model_v4 D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase (EC 2.7.7.70) 0.9952 14 156 GO:0005524
GO:0005975
GO:0009058
GO:0016773
GO:0016779
AF-A0A2V8FV91-F1-model_v4 D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase (EC 2.7.7.70) 0.9948 3 155 GO:0005524
GO:0005975
GO:0009058
GO:0016773
GO:0016779
AF-A0A496TSE6-F1-model_v4 D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase (EC 2.7.7.70) 0.9942 22 154 GO:0005524
GO:0005975
GO:0009058
GO:0016773
GO:0016779
AF-A0A1F9DQZ5-F1-model_v4 D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase (EC 2.7.7.70) 0.9936 22 154 GO:0005524
GO:0005975
GO:0009058
GO:0016773
GO:0016779

Feature Viewer

pLDDT pTM Quality
92.77 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map