F471188
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 634 | 261 | 634 | 159 |
Family's Representative Sequence
| Representative Sequence | 3300042439|Ga0439464_0089396|Ga0439464_0089396_132_704 |
| Length | 190 |
| Sequence | MVLQRRRQIRIAKAGAARLNADNRPALDYTRQMSLRTAAETRQWIEGLQRQNRRVVFTNGVFDLLHPGHVRYLRAARERGDALVVGINSDRSVSANKGPGRPIVPEGERAELLEALAFVDAVVIFDEETPHELIATLQPDVLVKGADWAADAIVGRDLVESWGGQVERMPVEAGHSTSAIIRKIRGMNPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 61 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 65 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 66 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 67 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 68 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 69 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 142 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 146 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 147 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 148 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 149 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 150 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 151 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 152 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 153 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 154 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 155 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 156 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 157 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 158 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 159 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 160 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 161 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 162 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 163 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 164 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 165 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 166 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 167 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 168 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 169 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 170 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 171 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 172 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 173 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 174 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 175 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 176 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 199 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 200 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 201 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 202 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 204 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 205 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 206 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 207 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 208 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 209 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 236 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 237 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 242 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 243 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 247 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 248 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.63 |
| Nodule | 0 |
| Rhizoplane | 2.68 |
| Rhizosphere | 96.53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10085755 | 3300003203 | Bacteria | 957 |
| 2 | Ga0065715_10154999 | 3300005293 | Bacteria | 1655 |
| 3 | Ga0065715_10236571 | 3300005293 | Unclassified | 1214 |
| 4 | Ga0065715_10683227 | 3300005293 | Unclassified | 662 |
| 5 | Ga0065707_10002739 | 3300005295 | Bacteria | 5107 |
| 6 | Ga0065707_10004595 | 3300005295 | Bacteria | 6379 |
| 7 | Ga0065707_10084894 | 3300005295 | Bacteria | 6667 |
| 8 | Ga0065707_10163550 | 3300005295 | Bacteria | 1542 |
| 9 | Ga0070658_10028504 | 3300005327 | Bacteria | 4483 |
| 10 | Ga0070676_10009864 | 3300005328 | Bacteria | 5167 |
| 11 | Ga0070676_10173496 | 3300005328 | Bacteria | 1397 |
| 12 | Ga0070683_100098876 | 3300005329 | Bacteria | 2746 |
| 13 | Ga0070670_100423309 | 3300005331 | Unclassified | 1177 |
| 14 | Ga0070677_10059521 | 3300005333 | Bacteria | 1571 |
| 15 | Ga0068869_100425728 | 3300005334 | Bacteria | 1096 |
| 16 | Ga0070666_10071493 | 3300005335 | Bacteria | 2361 |
| 17 | Ga0070680_100631255 | 3300005336 | Bacteria | 920 |
| 18 | Ga0068868_100299800 | 3300005338 | Bacteria | 1365 |
| 19 | Ga0070691_10000425 | 3300005341 | Bacteria | 15505 |
| 20 | Ga0070687_100020732 | 3300005343 | Bacteria | 3079 |
| 21 | Ga0070687_100136273 | 3300005343 | Bacteria | 1424 |
| 22 | Ga0070687_100262228 | 3300005343 | Bacteria | 1079 |
| 23 | Ga0070687_100977973 | 3300005343 | Bacteria | 612 |
| 24 | Ga0070692_10298977 | 3300005345 | Bacteria | 982 |
| 25 | Ga0070692_10481672 | 3300005345 | Unclassified | 800 |
| 26 | Ga0070668_100020029 | 3300005347 | Bacteria | 5045 |
| 27 | Ga0070668_100066448 | 3300005347 | Bacteria | 2798 |
| 28 | Ga0070669_100012308 | 3300005353 | Bacteria | 6070 |
| 29 | Ga0070669_100027876 | 3300005353 | Bacteria | 4066 |
| 30 | Ga0070669_100035365 | 3300005353 | Bacteria | 3618 |
| 31 | Ga0070669_100160487 | 3300005353 | Bacteria | 1747 |
| 32 | Ga0070669_100180720 | 3300005353 | Bacteria | 1650 |
| 33 | Ga0070669_100570023 | 3300005353 | Bacteria | 946 |
| 34 | Ga0070675_100000433 | 3300005354 | Bacteria | 28442 |
| 35 | Ga0070675_100042879 | 3300005354 | Bacteria | 3697 |
| 36 | Ga0070675_100219255 | 3300005354 | Unclassified | 1656 |
| 37 | Ga0070675_100578898 | 3300005354 | Bacteria | 1017 |
| 38 | Ga0070675_100876522 | 3300005354 | Unclassified | 822 |
| 39 | Ga0070675_101308552 | 3300005354 | Bacteria | 668 |
| 40 | Ga0070674_100412060 | 3300005356 | Bacteria | 1107 |
| 41 | Ga0070674_100501274 | 3300005356 | Bacteria | 1011 |
| 42 | Ga0070674_100639219 | 3300005356 | Bacteria | 903 |
| 43 | Ga0070673_100088738 | 3300005364 | Bacteria | 2523 |
| 44 | Ga0070688_100041978 | 3300005365 | Bacteria | 2811 |
| 45 | Ga0070659_100311161 | 3300005366 | Bacteria | 1315 |
| 46 | Ga0070659_101352784 | 3300005366 | Archaea | 632 |
| 47 | Ga0070667_100709687 | 3300005367 | Bacteria | 931 |
| 48 | Ga0070713_100755611 | 3300005436 | Bacteria | 930 |
| 49 | Ga0070701_10188594 | 3300005438 | Unclassified | 1212 |
| 50 | Ga0070705_100001128 | 3300005440 | Bacteria | 14772 |
| 51 | Ga0070705_100001404 | 3300005440 | Bacteria | 12773 |
| 52 | Ga0070700_100000788 | 3300005441 | Bacteria | 15603 |
| 53 | Ga0070700_100005290 | 3300005441 | Bacteria | 6824 |
| 54 | Ga0070700_100106845 | 3300005441 | Bacteria | 1854 |
| 55 | Ga0070700_100253744 | 3300005441 | Bacteria | 1263 |
| 56 | Ga0070700_101188627 | 3300005441 | Unclassified | 636 |
| 57 | Ga0070694_100001406 | 3300005444 | Bacteria | 14087 |
| 58 | Ga0070694_100122675 | 3300005444 | Bacteria | 1866 |
| 59 | Ga0070694_100528354 | 3300005444 | Bacteria | 942 |
| 60 | Ga0070663_100578049 | 3300005455 | Unclassified | 942 |
| 61 | Ga0070678_100354657 | 3300005456 | Bacteria | 1262 |
| 62 | Ga0070678_100529990 | 3300005456 | Bacteria | 1043 |
| 63 | Ga0070662_100035211 | 3300005457 | Bacteria | 3535 |
| 64 | Ga0070662_100142896 | 3300005457 | Bacteria | 1856 |
| 65 | Ga0070662_100371558 | 3300005457 | Unclassified | 1175 |
| 66 | Ga0070681_10387246 | 3300005458 | Bacteria | 1309 |
| 67 | Ga0068867_100011464 | 3300005459 | Bacteria | 6255 |
| 68 | Ga0070706_100835108 | 3300005467 | Bacteria | 852 |
| 69 | Ga0070707_100900779 | 3300005468 | Bacteria | 849 |
| 70 | Ga0070699_100013629 | 3300005518 | Bacteria | 6998 |
| 71 | Ga0070699_100042236 | 3300005518 | Bacteria | 3945 |
| 72 | Ga0070699_100819083 | 3300005518 | Unclassified | 852 |
| 73 | Ga0070684_100133443 | 3300005535 | Bacteria | 2241 |
| 74 | Ga0070697_100566761 | 3300005536 | Bacteria | 996 |
| 75 | Ga0070686_100000153 | 3300005544 | Bacteria | 47434 |
| 76 | Ga0070686_100070428 | 3300005544 | Bacteria | 2287 |
| 77 | Ga0070695_100000013 | 3300005545 | Bacteria | 69322 |
| 78 | Ga0070695_100032985 | 3300005545 | Bacteria | 3238 |
| 79 | Ga0070695_100439617 | 3300005545 | Bacteria | 997 |
| 80 | Ga0070695_100571070 | 3300005545 | Unclassified | 884 |
| 81 | Ga0070695_100586122 | 3300005545 | Unclassified | 874 |
| 82 | Ga0070695_100611236 | 3300005545 | Bacteria | 857 |
| 83 | Ga0070695_100925443 | 3300005545 | Unclassified | 705 |
| 84 | Ga0070695_100981121 | 3300005545 | Bacteria | 686 |
| 85 | Ga0070696_100007129 | 3300005546 | Bacteria | 7466 |
| 86 | Ga0070696_100008086 | 3300005546 | Bacteria | 7029 |
| 87 | Ga0070696_100533208 | 3300005546 | Bacteria | 938 |
| 88 | Ga0070696_100550875 | 3300005546 | Bacteria | 924 |
| 89 | Ga0070693_100041130 | 3300005547 | Bacteria | 2599 |
| 90 | Ga0070693_100248446 | 3300005547 | Bacteria | 1178 |
| 91 | Ga0070693_100716098 | 3300005547 | Unclassified | 734 |
| 92 | Ga0070665_100008640 | 3300005548 | Bacteria | 10308 |
| 93 | Ga0070665_100117069 | 3300005548 | Bacteria | 2667 |
| 94 | Ga0070704_100008665 | 3300005549 | Bacteria | 6115 |
| 95 | Ga0070704_100080788 | 3300005549 | Bacteria | 2392 |
| 96 | Ga0070704_100280490 | 3300005549 | Bacteria | 1380 |
| 97 | Ga0070704_101008460 | 3300005549 | Bacteria | 753 |
| 98 | Ga0070704_101322865 | 3300005549 | Unclassified | 660 |
| 99 | Ga0068855_100317114 | 3300005563 | Bacteria | 1724 |
| 100 | Ga0068857_100087396 | 3300005577 | Bacteria | 2788 |
| 101 | Ga0068854_100008015 | 3300005578 | Bacteria | 6767 |
| 102 | Ga0068854_100011351 | 3300005578 | Bacteria | 5795 |
| 103 | Ga0068856_100031335 | 3300005614 | Bacteria | 5202 |
| 104 | Ga0070702_100243735 | 3300005615 | Bacteria | 1214 |
| 105 | Ga0068852_100238120 | 3300005616 | Bacteria | 1738 |
| 106 | Ga0068852_100361852 | 3300005616 | Bacteria | 1419 |
| 107 | Ga0068852_100472096 | 3300005616 | Bacteria | 1245 |
| 108 | Ga0068859_100857192 | 3300005617 | Unclassified | 994 |
| 109 | Ga0068859_101902663 | 3300005617 | Bacteria | 657 |
| 110 | Ga0068864_100234757 | 3300005618 | Bacteria | 1697 |
| 111 | Ga0068864_101444255 | 3300005618 | Archaea | 690 |
| 112 | Ga0068866_10069929 | 3300005718 | Bacteria | 1851 |
| 113 | Ga0068866_10242582 | 3300005718 | Bacteria | 1098 |
| 114 | Ga0068861_100012709 | 3300005719 | Bacteria | 5875 |
| 115 | Ga0068861_100051092 | 3300005719 | Bacteria | 3137 |
| 116 | Ga0068861_100378213 | 3300005719 | Bacteria | 1250 |
| 117 | Ga0068861_100405433 | 3300005719 | Bacteria | 1211 |
| 118 | Ga0068851_10189003 | 3300005834 | Bacteria | 1144 |
| 119 | Ga0068858_100017044 | 3300005842 | Bacteria | 6819 |
| 120 | Ga0068858_100173908 | 3300005842 | Bacteria | 2032 |
| 121 | Ga0068858_100862391 | 3300005842 | Bacteria | 885 |
| 122 | Ga0068860_100061409 | 3300005843 | Bacteria | 3571 |
| 123 | Ga0068860_100274970 | 3300005843 | Bacteria | 1645 |
| 124 | Ga0068860_100861601 | 3300005843 | Bacteria | 921 |
| 125 | Ga0068862_100010510 | 3300005844 | Bacteria | 7646 |
| 126 | Ga0068862_100043918 | 3300005844 | Bacteria | 3811 |
| 127 | Ga0068862_100178909 | 3300005844 | Bacteria | 1902 |
| 128 | Ga0068862_100704313 | 3300005844 | Bacteria | 979 |
| 129 | Ga0081539_10002012 | 3300005985 | Bacteria | 30795 |
| 130 | Ga0075367_10018891 | 3300006178 | Bacteria | 3811 |
| 131 | Ga0075366_10026956 | 3300006195 | Bacteria | 3369 |
| 132 | Ga0097621_100000125 | 3300006237 | Bacteria | 44370 |
| 133 | Ga0097621_100157874 | 3300006237 | Bacteria | 1948 |
| 134 | Ga0097621_100413069 | 3300006237 | Bacteria | 1210 |
| 135 | Ga0068871_100000134 | 3300006358 | Bacteria | 47412 |
| 136 | Ga0075428_100006263 | 3300006844 | Bacteria | 13228 |
| 137 | Ga0075428_100633123 | 3300006844 | Bacteria | 1141 |
| 138 | Ga0075430_100000247 | 3300006846 | Bacteria | 37440 |
| 139 | Ga0075430_100000722 | 3300006846 | Bacteria | 25248 |
| 140 | Ga0075430_100784597 | 3300006846 | Unclassified | 785 |
| 141 | Ga0075431_100019089 | 3300006847 | Bacteria | 6984 |
| 142 | Ga0075431_100019172 | 3300006847 | Bacteria | 6972 |
| 143 | Ga0075431_100425216 | 3300006847 | Bacteria | 1327 |
| 144 | Ga0075431_101080915 | 3300006847 | Unclassified | 767 |
| 145 | Ga0075433_10017226 | 3300006852 | Bacteria | 5979 |
| 146 | Ga0075433_10019086 | 3300006852 | Bacteria | 5704 |
| 147 | Ga0075433_10050842 | 3300006852 | Bacteria | 3608 |
| 148 | Ga0075433_10219449 | 3300006852 | Unclassified | 1689 |
| 149 | Ga0075434_100005743 | 3300006871 | Bacteria | 11328 |
| 150 | Ga0075434_100192132 | 3300006871 | Bacteria | 2062 |
| 151 | Ga0075434_100347945 | 3300006871 | Bacteria | 1503 |
| 152 | Ga0075434_100447361 | 3300006871 | Unclassified | 1313 |
| 153 | Ga0075434_100459628 | 3300006871 | Bacteria | 1294 |
| 154 | Ga0075434_100944548 | 3300006871 | Unclassified | 877 |
| 155 | Ga0075429_100002690 | 3300006880 | Bacteria | 14968 |
| 156 | Ga0075429_100284206 | 3300006880 | Bacteria | 1449 |
| 157 | Ga0075429_101187194 | 3300006880 | Bacteria | 666 |
| 158 | Ga0068865_100351331 | 3300006881 | Bacteria | 1194 |
| 159 | Ga0068865_100520064 | 3300006881 | Bacteria | 995 |
| 160 | Ga0068865_100524618 | 3300006881 | Bacteria | 991 |
| 161 | Ga0075436_100026454 | 3300006914 | Bacteria | 3994 |
| 162 | Ga0075436_100035274 | 3300006914 | Bacteria | 3451 |
| 163 | Ga0075436_100052587 | 3300006914 | Bacteria | 2812 |
| 164 | Ga0075436_100485414 | 3300006914 | Bacteria | 902 |
| 165 | Ga0097620_100314818 | 3300006931 | Bacteria | 1659 |
| 166 | Ga0097620_100770166 | 3300006931 | Unclassified | 1051 |
| 167 | Ga0097620_100857188 | 3300006931 | Unclassified | 994 |
| 168 | Ga0097620_101902409 | 3300006931 | Bacteria | 657 |
| 169 | Ga0075435_100006762 | 3300007076 | Bacteria | 8135 |
| 170 | Ga0075435_100065440 | 3300007076 | Bacteria | 2955 |
| 171 | Ga0105240_10342108 | 3300009093 | Bacteria | 1699 |
| 172 | Ga0105240_11365940 | 3300009093 | Bacteria | 746 |
| 173 | Ga0111539_10000230 | 3300009094 | Bacteria | 67127 |
| 174 | Ga0111539_10003342 | 3300009094 | Bacteria | 21190 |
| 175 | Ga0111539_10028028 | 3300009094 | Bacteria | 6877 |
| 176 | Ga0111539_10086580 | 3300009094 | Bacteria | 3681 |
| 177 | Ga0111539_10102668 | 3300009094 | Bacteria | 3356 |
| 178 | Ga0111539_10123958 | 3300009094 | Bacteria | 3028 |
| 179 | Ga0111539_10135036 | 3300009094 | Bacteria | 2889 |
| 180 | Ga0111539_10158865 | 3300009094 | Bacteria | 2644 |
| 181 | Ga0111539_10192426 | 3300009094 | Unclassified | 2380 |
| 182 | Ga0111539_10197521 | 3300009094 | Bacteria | 2346 |
| 183 | Ga0111539_10209070 | 3300009094 | Bacteria | 2274 |
| 184 | Ga0111539_10493323 | 3300009094 | Bacteria | 1426 |
| 185 | Ga0111539_11191044 | 3300009094 | Bacteria | 885 |
| 186 | Ga0105245_10013815 | 3300009098 | Bacteria | 7033 |
| 187 | Ga0105245_12905016 | 3300009098 | Unclassified | 531 |
| 188 | Ga0114129_10000426 | 3300009147 | Bacteria | 50026 |
| 189 | Ga0114129_10013149 | 3300009147 | Bacteria | 11792 |
| 190 | Ga0114129_10014774 | 3300009147 | Bacteria | 11123 |
| 191 | Ga0114129_10231163 | 3300009147 | Bacteria | 2490 |
| 192 | Ga0114129_10235325 | 3300009147 | Bacteria | 2465 |
| 193 | Ga0114129_10377678 | 3300009147 | Bacteria | 1872 |
| 194 | Ga0114129_11721348 | 3300009147 | Bacteria | 764 |
| 195 | Ga0105243_10449972 | 3300009148 | Bacteria | 1208 |
| 196 | Ga0105243_10960054 | 3300009148 | Unclassified | 854 |
| 197 | Ga0105243_10998721 | 3300009148 | Bacteria | 839 |
| 198 | Ga0105241_10375433 | 3300009174 | Bacteria | 1241 |
| 199 | Ga0105241_10463331 | 3300009174 | Unclassified | 1123 |
| 200 | Ga0105241_10757271 | 3300009174 | Bacteria | 891 |
| 201 | Ga0105242_10086482 | 3300009176 | Bacteria | 2631 |
| 202 | Ga0105242_10116616 | 3300009176 | Bacteria | 2285 |
| 203 | Ga0105242_10187783 | 3300009176 | Bacteria | 1828 |
| 204 | Ga0105242_10298350 | 3300009176 | Bacteria | 1470 |
| 205 | Ga0105248_10080482 | 3300009177 | Unclassified | 3661 |
| 206 | Ga0105248_10920304 | 3300009177 | Bacteria | 987 |
| 207 | Ga0105249_10009745 | 3300009553 | Bacteria | 8416 |
| 208 | Ga0105249_10166850 | 3300009553 | Bacteria | 2132 |
| 209 | Ga0105249_10267327 | 3300009553 | Bacteria | 1702 |
| 210 | Ga0105249_11114590 | 3300009553 | Unclassified | 859 |
| 211 | Ga0105249_11231712 | 3300009553 | Unclassified | 819 |
| 212 | Ga0105239_12408314 | 3300010375 | Bacteria | 613 |
| 213 | Ga0105246_10143870 | 3300011119 | Bacteria | 1797 |
| 214 | Ga0105246_10378878 | 3300011119 | Unclassified | 1168 |
| 215 | Ga0157370_10711774 | 3300013104 | Archaea | 916 |
| 216 | Ga0157369_10386158 | 3300013105 | Unclassified | 1453 |
| 217 | Ga0157374_10017943 | 3300013296 | Bacteria | 6237 |
| 218 | Ga0157374_10155197 | 3300013296 | Unclassified | 2227 |
| 219 | Ga0157374_10258659 | 3300013296 | Bacteria | 1714 |
| 220 | Ga0157378_10009109 | 3300013297 | Bacteria | 8639 |
| 221 | Ga0157378_10083682 | 3300013297 | Bacteria | 2888 |
| 222 | Ga0163162_10501363 | 3300013306 | Bacteria | 1344 |
| 223 | Ga0163162_10575760 | 3300013306 | Bacteria | 1253 |
| 224 | Ga0163162_11310218 | 3300013306 | Bacteria | 823 |
| 225 | Ga0157372_10460337 | 3300013307 | Unclassified | 1482 |
| 226 | Ga0157375_10021964 | 3300013308 | Bacteria | 5866 |
| 227 | Ga0157375_10755186 | 3300013308 | Unclassified | 1124 |
| 228 | Ga0157375_12210283 | 3300013308 | Unclassified | 655 |
| 229 | Ga0157375_12826462 | 3300013308 | Unclassified | 580 |
| 230 | Ga0163163_10210923 | 3300014325 | Bacteria | 1991 |
| 231 | Ga0163163_10227833 | 3300014325 | Bacteria | 1913 |
| 232 | Ga0163163_10504106 | 3300014325 | Bacteria | 1272 |
| 233 | Ga0157380_10046121 | 3300014326 | Bacteria | 3422 |
| 234 | Ga0157380_10057944 | 3300014326 | Bacteria | 3087 |
| 235 | Ga0157380_10091606 | 3300014326 | Bacteria | 2510 |
| 236 | Ga0157380_10099365 | 3300014326 | Bacteria | 2420 |
| 237 | Ga0157380_10121340 | 3300014326 | Bacteria | 2214 |
| 238 | Ga0157380_10287534 | 3300014326 | Bacteria | 1508 |
| 239 | Ga0157380_10830505 | 3300014326 | Unclassified | 944 |
| 240 | Ga0157380_10902687 | 3300014326 | Bacteria | 910 |
| 241 | Ga0157380_10953974 | 3300014326 | Unclassified | 888 |
| 242 | Ga0157377_10055265 | 3300014745 | Unclassified | 2251 |
| 243 | Ga0157377_10063934 | 3300014745 | Bacteria | 2109 |
| 244 | Ga0157379_10068624 | 3300014968 | Bacteria | 3169 |
| 245 | Ga0157379_10198779 | 3300014968 | Bacteria | 1812 |
| 246 | Ga0157379_10274633 | 3300014968 | Bacteria | 1533 |
| 247 | Ga0157376_10029506 | 3300014969 | Bacteria | 4369 |
| 248 | Ga0157376_10049362 | 3300014969 | Bacteria | 3485 |
| 249 | Ga0157376_10200404 | 3300014969 | Bacteria | 1836 |
| 250 | Ga0163161_10249687 | 3300017792 | Bacteria | 1383 |
| 251 | Ga0207666_1026369 | 3300025271 | Unclassified | 875 |
| 252 | Ga0207697_10082692 | 3300025315 | Bacteria | 1354 |
| 253 | Ga0207642_10061529 | 3300025899 | Bacteria | 1746 |
| 254 | Ga0207642_10304844 | 3300025899 | Bacteria | 925 |
| 255 | Ga0207688_10108977 | 3300025901 | Bacteria | 1606 |
| 256 | Ga0207688_10446579 | 3300025901 | Unclassified | 806 |
| 257 | Ga0207680_10090828 | 3300025903 | Bacteria | 1942 |
| 258 | Ga0207699_10298849 | 3300025906 | Bacteria | 1124 |
| 259 | Ga0207645_10001406 | 3300025907 | Bacteria | 19717 |
| 260 | Ga0207645_10188096 | 3300025907 | Bacteria | 1356 |
| 261 | Ga0207705_10099807 | 3300025909 | Bacteria | 2135 |
| 262 | Ga0207684_10681004 | 3300025910 | Bacteria | 875 |
| 263 | Ga0207707_10139577 | 3300025912 | Bacteria | 2119 |
| 264 | Ga0207707_10360121 | 3300025912 | Unclassified | 1252 |
| 265 | Ga0207660_10410706 | 3300025917 | Bacteria | 1091 |
| 266 | Ga0207662_10116396 | 3300025918 | Bacteria | 1672 |
| 267 | Ga0207662_10436638 | 3300025918 | Bacteria | 893 |
| 268 | Ga0207657_10573303 | 3300025919 | Bacteria | 881 |
| 269 | Ga0207649_10139007 | 3300025920 | Bacteria | 1659 |
| 270 | Ga0207681_10004564 | 3300025923 | Bacteria | 8517 |
| 271 | Ga0207681_10022128 | 3300025923 | Bacteria | 4050 |
| 272 | Ga0207650_10359794 | 3300025925 | Unclassified | 1199 |
| 273 | Ga0207659_10000079 | 3300025926 | Bacteria | 60790 |
| 274 | Ga0207659_10209420 | 3300025926 | Bacteria | 1562 |
| 275 | Ga0207659_10302044 | 3300025926 | Bacteria | 1315 |
| 276 | Ga0207659_10861235 | 3300025926 | Unclassified | 779 |
| 277 | Ga0207687_10215455 | 3300025927 | Bacteria | 1509 |
| 278 | Ga0207690_10413689 | 3300025932 | Archaea | 1077 |
| 279 | Ga0207690_10520639 | 3300025932 | Unclassified | 964 |
| 280 | Ga0207706_10045569 | 3300025933 | Bacteria | 3885 |
| 281 | Ga0207706_10108716 | 3300025933 | Bacteria | 2440 |
| 282 | Ga0207706_10179083 | 3300025933 | Bacteria | 1862 |
| 283 | Ga0207686_10183767 | 3300025934 | Bacteria | 1484 |
| 284 | Ga0207686_10994945 | 3300025934 | Bacteria | 680 |
| 285 | Ga0207686_11044443 | 3300025934 | Unclassified | 664 |
| 286 | Ga0207709_10063505 | 3300025935 | Bacteria | 2315 |
| 287 | Ga0207709_10386372 | 3300025935 | Bacteria | 1066 |
| 288 | Ga0207709_10649709 | 3300025935 | Bacteria | 840 |
| 289 | Ga0207669_10358794 | 3300025937 | Unclassified | 1129 |
| 290 | Ga0207669_10461390 | 3300025937 | Bacteria | 1009 |
| 291 | Ga0207669_11066887 | 3300025937 | Unclassified | 681 |
| 292 | Ga0207704_10273315 | 3300025938 | Bacteria | 1281 |
| 293 | Ga0207704_10351195 | 3300025938 | Bacteria | 1148 |
| 294 | Ga0207691_10122470 | 3300025940 | Bacteria | 2303 |
| 295 | Ga0207711_10389796 | 3300025941 | Bacteria | 1293 |
| 296 | Ga0207689_10414750 | 3300025942 | Unclassified | 1123 |
| 297 | Ga0207689_10416128 | 3300025942 | Bacteria | 1121 |
| 298 | Ga0207661_10224860 | 3300025944 | Bacteria | 1660 |
| 299 | Ga0207661_10295160 | 3300025944 | Unclassified | 1452 |
| 300 | Ga0207712_10055161 | 3300025961 | Bacteria | 2794 |
| 301 | Ga0207668_10294731 | 3300025972 | Bacteria | 1336 |
| 302 | Ga0207640_10007460 | 3300025981 | Bacteria | 6040 |
| 303 | Ga0207640_10028125 | 3300025981 | Bacteria | 3433 |
| 304 | Ga0207658_10564805 | 3300025986 | Bacteria | 1019 |
| 305 | Ga0207703_10028554 | 3300026035 | Bacteria | 4398 |
| 306 | Ga0207703_10078831 | 3300026035 | Bacteria | 2738 |
| 307 | Ga0207639_10539826 | 3300026041 | Archaea | 1070 |
| 308 | Ga0207708_10004337 | 3300026075 | Bacteria | 10446 |
| 309 | Ga0207708_10027833 | 3300026075 | Bacteria | 4281 |
| 310 | Ga0207708_10046797 | 3300026075 | Bacteria | 3294 |
| 311 | Ga0207708_10094753 | 3300026075 | Bacteria | 2305 |
| 312 | Ga0207708_10161966 | 3300026075 | Bacteria | 1767 |
| 313 | Ga0207708_10405455 | 3300026075 | Bacteria | 1128 |
| 314 | Ga0207702_10008196 | 3300026078 | Bacteria | 8832 |
| 315 | Ga0207648_10002536 | 3300026089 | Bacteria | 19594 |
| 316 | Ga0207676_10446165 | 3300026095 | Unclassified | 1219 |
| 317 | Ga0207676_10536952 | 3300026095 | Unclassified | 1115 |
| 318 | Ga0207674_10102878 | 3300026116 | Bacteria | 2836 |
| 319 | Ga0207674_10359673 | 3300026116 | Unclassified | 1407 |
| 320 | Ga0207675_100019034 | 3300026118 | Bacteria | 6409 |
| 321 | Ga0207675_100203574 | 3300026118 | Bacteria | 1902 |
| 322 | Ga0207675_100235685 | 3300026118 | Bacteria | 1767 |
| 323 | Ga0207675_100346802 | 3300026118 | Bacteria | 1454 |
| 324 | Ga0207675_100412931 | 3300026118 | Bacteria | 1332 |
| 325 | Ga0207675_100427669 | 3300026118 | Bacteria | 1309 |
| 326 | Ga0207675_100579393 | 3300026118 | Bacteria | 1123 |
| 327 | Ga0207675_102079836 | 3300026118 | Bacteria | 584 |
| 328 | Ga0207683_10364934 | 3300026121 | Bacteria | 1326 |
| 329 | Ga0207698_10036810 | 3300026142 | Bacteria | 3597 |
| 330 | Ga0207698_10218136 | 3300026142 | Bacteria | 1722 |
| 331 | Ga0207698_10396867 | 3300026142 | Bacteria | 1317 |
| 332 | Ga0209983_1040463 | 3300027665 | Bacteria | 1007 |
| 333 | Ga0207428_10000531 | 3300027907 | Bacteria | 45546 |
| 334 | Ga0207428_10003214 | 3300027907 | Bacteria | 15966 |
| 335 | Ga0207428_10046855 | 3300027907 | Bacteria | 3474 |
| 336 | Ga0207428_10052174 | 3300027907 | Bacteria | 3267 |
| 337 | Ga0207428_10071655 | 3300027907 | Bacteria | 2721 |
| 338 | Ga0207428_10104551 | 3300027907 | Bacteria | 2185 |
| 339 | Ga0207428_10460104 | 3300027907 | Archaea | 927 |
| 340 | Ga0268266_10019822 | 3300028379 | Bacteria | 5731 |
| 341 | Ga0268266_10271821 | 3300028379 | Bacteria | 1573 |
| 342 | Ga0268265_10029432 | 3300028380 | Bacteria | 3941 |
| 343 | Ga0268265_10298797 | 3300028380 | Bacteria | 1449 |
| 344 | Ga0268265_10438076 | 3300028380 | Bacteria | 1217 |
| 345 | Ga0268265_10525196 | 3300028380 | Bacteria | 1119 |
| 346 | Ga0268265_10718947 | 3300028380 | Bacteria | 967 |
| 347 | Ga0268265_11478861 | 3300028380 | Archaea | 683 |
| 348 | Ga0268264_10226506 | 3300028381 | Bacteria | 1724 |
| 349 | Ga0268264_10292267 | 3300028381 | Bacteria | 1531 |
| 350 | Ga0268264_10453545 | 3300028381 | Bacteria | 1243 |
| 351 | Ga0268264_12342838 | 3300028381 | Bacteria | 540 |
| 352 | Ga0307511_10289271 | 3300030521 | Bacteria | 750 |
| 353 | Ga0307408_100013807 | 3300031548 | Bacteria | 5362 |
| 354 | Ga0307408_100028512 | 3300031548 | Bacteria | 3858 |
| 355 | Ga0307405_11418614 | 3300031731 | Bacteria | 608 |
| 356 | Ga0307413_10174622 | 3300031824 | Bacteria | 1525 |
| 357 | Ga0307413_10506903 | 3300031824 | Unclassified | 970 |
| 358 | Ga0307406_10268399 | 3300031901 | Unclassified | 1295 |
| 359 | Ga0307407_10240046 | 3300031903 | Unclassified | 1236 |
| 360 | Ga0307407_10265782 | 3300031903 | Bacteria | 1182 |
| 361 | Ga0307412_10136776 | 3300031911 | Bacteria | 1789 |
| 362 | Ga0307409_100392431 | 3300031995 | Unclassified | 1323 |
| 363 | Ga0307416_100016217 | 3300032002 | Bacteria | 5170 |
| 364 | Ga0307416_100438454 | 3300032002 | Unclassified | 1355 |
| 365 | Ga0307416_100547707 | 3300032002 | Archaea | 1230 |
| 366 | Ga0307416_100632165 | 3300032002 | Bacteria | 1153 |
| 367 | Ga0307416_100974381 | 3300032002 | Bacteria | 950 |
| 368 | Ga0307416_101169275 | 3300032002 | Bacteria | 875 |
| 369 | Ga0307411_10144227 | 3300032005 | Bacteria | 1760 |
| 370 | Ga0307411_10446158 | 3300032005 | Bacteria | 1081 |
| 371 | Ga0307415_100236844 | 3300032126 | Bacteria | 1474 |
| 372 | Ga0373929_0226116 | 3300035085 | Unclassified | 534 |
| 373 | Ga0373951_0056175 | 3300035091 | Unclassified | 978 |
| 374 | Ga0373952_0248037 | 3300035092 | Unclassified | 538 |
| 375 | Ga0373932_0015319 | 3300035112 | Bacteria | 1942 |
| 376 | Ga0373936_0464862 | 3300035113 | Bacteria | 586 |
| 377 | Ga0373939_0408306 | 3300035114 | Bacteria | 564 |
| 378 | Ga0373941_0033694 | 3300035115 | Bacteria | 1541 |
| 379 | Ga0373954_0409777 | 3300035118 | Bacteria | 670 |
| 380 | Ga0373955_0168279 | 3300035172 | Archaea | 1296 |
| 381 | Ga0373955_0305726 | 3300035172 | Bacteria | 959 |
| 382 | Ga0373924_0292947 | 3300035410 | Unclassified | 722 |
| 383 | Ga0373937_0012405 | 3300036401 | Bacteria | 7495 |
| 384 | Ga0373937_0370300 | 3300036401 | Unclassified | 1358 |
| 385 | Ga0373937_0382300 | 3300036401 | Bacteria | 1335 |
| 386 | Ga0373937_1000478 | 3300036401 | Bacteria | 785 |
| 387 | Ga0373925_0398317 | 3300037068 | Bacteria | 1123 |
| 388 | Ga0439450_003896 | 3300042008 | Unclassified | 2507 |
| 389 | Ga0439464_0002262 | 3300042439 | Bacteria | 4709 |
| 390 | Ga0439464_0089396 | 3300042439 | Bacteria | 927 |
| 391 | Ga0439464_0205519 | 3300042439 | Bacteria | 629 |
| 392 | Ga0439460_0130755 | 3300042461 | Unclassified | 827 |
| 393 | Ga0450916_002278 | 3300042530 | Bacteria | 2022 |
| 394 | Ga0466963_1026187 | 3300044694 | Bacteria | 581 |
| 395 | Ga0466957_0658034 | 3300044842 | Bacteria | 737 |
| 396 | Ga0466957_1070575 | 3300044842 | Bacteria | 581 |
| 397 | Ga0451576_0129908 | 3300045051 | Bacteria | 2626 |
| 398 | Ga0451576_0173529 | 3300045051 | Unclassified | 2250 |
| 399 | Ga0451576_0450726 | 3300045051 | Bacteria | 1351 |
| 400 | Ga0451576_0461969 | 3300045051 | Bacteria | 1333 |
| 401 | Ga0451576_0986814 | 3300045051 | Bacteria | 883 |
| 402 | Ga0451576_1942141 | 3300045051 | Unclassified | 607 |
| 403 | Ga0466967_0833321 | 3300045976 | Unclassified | 916 |
| 404 | Ga0495603_0088042 | 3300046455 | Bacteria | 1817 |
| 405 | Ga0495629_0269491 | 3300046459 | Bacteria | 1170 |
| 406 | Ga0495651_0205239 | 3300046462 | Archaea | 1376 |
| 407 | Ga0495580_0042467 | 3300046472 | Bacteria | 3240 |
| 408 | Ga0495639_0048556 | 3300046475 | Bacteria | 1925 |
| 409 | Ga0495594_0339188 | 3300046499 | Bacteria | 856 |
| 410 | Ga0495628_0427805 | 3300046516 | Bacteria | 964 |
| 411 | Ga0495628_0503820 | 3300046516 | Unclassified | 874 |
| 412 | Ga0495643_0002984 | 3300046522 | Bacteria | 12782 |
| 413 | Ga0495665_0422780 | 3300046531 | Unclassified | 675 |
| 414 | Ga0495621_0442798 | 3300046539 | Unclassified | 555 |
| 415 | Ga0495645_0002325 | 3300046543 | Bacteria | 12895 |
| 416 | Ga0495659_0011168 | 3300046664 | Bacteria | 2893 |
| 417 | Ga0495588_0512114 | 3300046674 | Bacteria | 629 |
| 418 | Ga0495599_0043797 | 3300046678 | Bacteria | 2809 |
| 419 | Ga0495599_0124401 | 3300046678 | Archaea | 1603 |
| 420 | Ga0495658_0083279 | 3300046683 | Bacteria | 1881 |
| 421 | Ga0495669_0318296 | 3300046684 | Unclassified | 751 |
| 422 | Ga0495613_0699965 | 3300046689 | Unclassified | 667 |
| 423 | Ga0495671_0245366 | 3300046692 | Bacteria | 865 |
| 424 | Ga0495680_0338784 | 3300047322 | Archaea | 1049 |
| 425 | Ga0495677_0090315 | 3300047445 | Bacteria | 1154 |
| 426 | Ga0495684_0030629 | 3300047471 | Bacteria | 4131 |
| 427 | Ga0496101_0129213 | 3300048904 | Unclassified | 1917 |
| 428 | Ga0496101_0202761 | 3300048904 | Bacteria | 1534 |
| 429 | Ga0496102_0010247 | 3300048905 | Bacteria | 8059 |
| 430 | Ga0496102_0203453 | 3300048905 | Bacteria | 1866 |
| 431 | Ga0496102_0282283 | 3300048905 | Bacteria | 1565 |
| 432 | Ga0496102_0379283 | 3300048905 | Bacteria | 1331 |
| 433 | Ga0496104_0429069 | 3300048907 | Unclassified | 1234 |
| 434 | Ga0496105_0615060 | 3300048908 | Bacteria | 842 |
| 435 | Ga0496105_0666239 | 3300048908 | Unclassified | 802 |
| 436 | Ga0496105_1063580 | 3300048908 | Bacteria | 602 |
| 437 | Ga0496106_0054612 | 3300048909 | Bacteria | 3018 |
| 438 | Ga0496106_0204995 | 3300048909 | Bacteria | 1570 |
| 439 | Ga0496106_0597668 | 3300048909 | Bacteria | 884 |
| 440 | Ga0496109_0042829 | 3300048912 | Bacteria | 4103 |
| 441 | Ga0496110_0120594 | 3300048913 | Bacteria | 2362 |
| 442 | Ga0496114_0078312 | 3300048917 | Bacteria | 2789 |
| 443 | Ga0496115_0214081 | 3300048918 | Bacteria | 1591 |
| 444 | Ga0501291_009568 | 3300049514 | Bacteria | 1361 |
| 445 | Ga0501299_005008 | 3300049522 | Bacteria | 2014 |
| 446 | Ga0501299_094995 | 3300049522 | Archaea | 683 |
| 447 | Ga0501300_054067 | 3300049523 | Unclassified | 625 |
| 448 | Ga0501031_0146433 | 3300049568 | Bacteria | 1543 |
| 449 | Ga0501032_0003850 | 3300049569 | Bacteria | 11396 |
| 450 | Ga0501032_0004854 | 3300049569 | Bacteria | 10078 |
| 451 | Ga0501033_0003710 | 3300049570 | Bacteria | 12424 |
| 452 | Ga0501033_0023579 | 3300049570 | Bacteria | 4641 |
| 453 | Ga0501033_0227118 | 3300049570 | Bacteria | 1327 |
| 454 | Ga0501033_0588083 | 3300049570 | Bacteria | 764 |
| 455 | Ga0501034_0036744 | 3300049571 | Bacteria | 4960 |
| 456 | Ga0501034_0143034 | 3300049571 | Bacteria | 2370 |
| 457 | Ga0501036_0003430 | 3300049572 | Bacteria | 12663 |
| 458 | Ga0501036_0015810 | 3300049572 | Bacteria | 6302 |
| 459 | Ga0501036_0047881 | 3300049572 | Bacteria | 3620 |
| 460 | Ga0501036_1367980 | 3300049572 | Bacteria | 574 |
| 461 | Ga0501037_0020405 | 3300049573 | Bacteria | 4892 |
| 462 | Ga0501037_0022219 | 3300049573 | Bacteria | 4693 |
| 463 | Ga0501037_0512601 | 3300049573 | Bacteria | 813 |
| 464 | Ga0501038_0025440 | 3300049574 | Bacteria | 5276 |
| 465 | Ga0501038_0078591 | 3300049574 | Bacteria | 2784 |
| 466 | Ga0501039_0054148 | 3300049575 | Bacteria | 3105 |
| 467 | Ga0501039_0223794 | 3300049575 | Bacteria | 1479 |
| 468 | Ga0501040_0014862 | 3300049576 | Bacteria | 5139 |
| 469 | Ga0501040_0095476 | 3300049576 | Bacteria | 2069 |
| 470 | Ga0501040_0304172 | 3300049576 | Bacteria | 1140 |
| 471 | Ga0501040_0484813 | 3300049576 | Bacteria | 891 |
| 472 | Ga0501041_0061439 | 3300049577 | Bacteria | 2300 |
| 473 | Ga0501041_0066506 | 3300049577 | Bacteria | 2209 |
| 474 | Ga0501042_0065524 | 3300049578 | Bacteria | 2596 |
| 475 | Ga0501042_0076064 | 3300049578 | Bacteria | 2403 |
| 476 | Ga0501042_0313517 | 3300049578 | Unclassified | 1133 |
| 477 | Ga0501042_0499453 | 3300049578 | Bacteria | 883 |
| 478 | Ga0501042_0594062 | 3300049578 | Bacteria | 805 |
| 479 | Ga0501043_0016613 | 3300049579 | Bacteria | 5768 |
| 480 | Ga0501043_0703662 | 3300049579 | Bacteria | 738 |
| 481 | Ga0501046_0048701 | 3300049580 | Bacteria | 3354 |
| 482 | Ga0501046_0105391 | 3300049580 | Bacteria | 2159 |
| 483 | Ga0501046_0356649 | 3300049580 | Bacteria | 1061 |
| 484 | Ga0501047_0025544 | 3300049581 | Bacteria | 5678 |
| 485 | Ga0501047_0045386 | 3300049581 | Bacteria | 4249 |
| 486 | Ga0501047_0046619 | 3300049581 | Bacteria | 4188 |
| 487 | Ga0501047_1236761 | 3300049581 | Bacteria | 560 |
| 488 | Ga0501048_0003526 | 3300049582 | Bacteria | 11895 |
| 489 | Ga0501048_0025034 | 3300049582 | Bacteria | 4352 |
| 490 | Ga0501048_0051788 | 3300049582 | Bacteria | 2921 |
| 491 | Ga0501048_0065494 | 3300049582 | Bacteria | 2569 |
| 492 | Ga0501048_0077759 | 3300049582 | Bacteria | 2341 |
| 493 | Ga0501067_0009296 | 3300049583 | Bacteria | 5445 |
| 494 | Ga0501067_0259441 | 3300049583 | Bacteria | 967 |
| 495 | Ga0501068_0001251 | 3300049584 | Bacteria | 13491 |
| 496 | Ga0501068_0007676 | 3300049584 | Bacteria | 5969 |
| 497 | Ga0501068_0046814 | 3300049584 | Bacteria | 2608 |
| 498 | Ga0501068_0191371 | 3300049584 | Bacteria | 1296 |
| 499 | Ga0501068_0573808 | 3300049584 | Bacteria | 734 |
| 500 | Ga0501069_0009755 | 3300049585 | Bacteria | 5073 |
| 501 | Ga0501069_0104145 | 3300049585 | Bacteria | 1612 |
| 502 | Ga0501070_0018320 | 3300049586 | Bacteria | 5873 |
| 503 | Ga0501071_0000369 | 3300049587 | Bacteria | 22026 |
| 504 | Ga0501071_0008739 | 3300049587 | Bacteria | 6705 |
| 505 | Ga0501071_0030947 | 3300049587 | Bacteria | 3789 |
| 506 | Ga0501071_0058867 | 3300049587 | Bacteria | 2778 |
| 507 | Ga0501071_0296193 | 3300049587 | Bacteria | 1226 |
| 508 | Ga0501071_0580256 | 3300049587 | Bacteria | 862 |
| 509 | Ga0501072_0089570 | 3300049588 | Bacteria | 2442 |
| 510 | Ga0501072_0162545 | 3300049588 | Bacteria | 1781 |
| 511 | Ga0501072_0182961 | 3300049588 | Bacteria | 1672 |
| 512 | Ga0501072_0446882 | 3300049588 | Bacteria | 1024 |
| 513 | Ga0501072_0470160 | 3300049588 | Bacteria | 995 |
| 514 | Ga0501072_0520489 | 3300049588 | Bacteria | 940 |
| 515 | Ga0501072_0655680 | 3300049588 | Bacteria | 826 |
| 516 | Ga0501072_0690087 | 3300049588 | Bacteria | 803 |
| 517 | Ga0501073_0003611 | 3300049589 | Bacteria | 11631 |
| 518 | Ga0501073_0007039 | 3300049589 | Bacteria | 8379 |
| 519 | Ga0501073_0069301 | 3300049589 | Bacteria | 2457 |
| 520 | Ga0501073_0109131 | 3300049589 | Bacteria | 1920 |
| 521 | Ga0501073_0464242 | 3300049589 | Bacteria | 875 |
| 522 | Ga0501074_0000449 | 3300049590 | Bacteria | 24661 |
| 523 | Ga0501074_0022878 | 3300049590 | Bacteria | 4545 |
| 524 | Ga0501074_0032931 | 3300049590 | Bacteria | 3755 |
| 525 | Ga0501074_0089065 | 3300049590 | Bacteria | 2210 |
| 526 | Ga0501074_0132167 | 3300049590 | Bacteria | 1785 |
| 527 | Ga0501074_0230972 | 3300049590 | Bacteria | 1317 |
| 528 | Ga0501074_0249386 | 3300049590 | Unclassified | 1262 |
| 529 | Ga0501075_0031363 | 3300049591 | Bacteria | 3944 |
| 530 | Ga0501075_0166972 | 3300049591 | Bacteria | 1679 |
| 531 | Ga0501075_0174013 | 3300049591 | Bacteria | 1643 |
| 532 | Ga0501075_0322649 | 3300049591 | Bacteria | 1177 |
| 533 | Ga0501076_0027186 | 3300049592 | Bacteria | 4438 |
| 534 | Ga0501076_0093817 | 3300049592 | Bacteria | 2416 |
| 535 | Ga0501076_0151923 | 3300049592 | Bacteria | 1884 |
| 536 | Ga0501076_0169124 | 3300049592 | Bacteria | 1781 |
| 537 | Ga0501077_0075754 | 3300049593 | Bacteria | 2131 |
| 538 | Ga0501217_005251 | 3300049661 | Bacteria | 2702 |
| 539 | Ga0501217_017168 | 3300049661 | Bacteria | 1667 |
| 540 | Ga0501249_014431 | 3300049679 | Bacteria | 1684 |
| 541 | Ga0501079_0004204 | 3300049741 | Bacteria | 10674 |
| 542 | Ga0501079_0005948 | 3300049741 | Bacteria | 9128 |
| 543 | Ga0501079_0007653 | 3300049741 | Bacteria | 8182 |
| 544 | Ga0501079_0018154 | 3300049741 | Bacteria | 5373 |
| 545 | Ga0501079_0401809 | 3300049741 | Unclassified | 1075 |
| 546 | Ga0501080_0051593 | 3300049742 | Bacteria | 3827 |
| 547 | Ga0501080_0143848 | 3300049742 | Unclassified | 2204 |
| 548 | Ga0501080_0250133 | 3300049742 | Bacteria | 1616 |
| 549 | Ga0501080_0791464 | 3300049742 | Bacteria | 832 |
| 550 | Ga0501081_0031836 | 3300049743 | Bacteria | 3575 |
| 551 | Ga0501081_0105438 | 3300049743 | Unclassified | 1997 |
| 552 | Ga0501081_0275222 | 3300049743 | Bacteria | 1232 |
| 553 | Ga0501081_0804824 | 3300049743 | Bacteria | 707 |
| 554 | Ga0501083_0013241 | 3300049744 | Bacteria | 5765 |
| 555 | Ga0501263_015189 | 3300049760 | Bacteria | 993 |
| 556 | Ga0501269_014350 | 3300049766 | Bacteria | 972 |
| 557 | Ga0501035_0003099 | 3300049822 | Bacteria | 15972 |
| 558 | Ga0501035_0007716 | 3300049822 | Bacteria | 10049 |
| 559 | Ga0501035_0060857 | 3300049822 | Bacteria | 3361 |
| 560 | Ga0501035_0235598 | 3300049822 | Bacteria | 1559 |
| 561 | Ga0501044_0013275 | 3300049823 | Bacteria | 8917 |
| 562 | Ga0501044_0133102 | 3300049823 | Bacteria | 2479 |
| 563 | Ga0501045_0002867 | 3300049824 | Bacteria | 11780 |
| 564 | Ga0501045_0010485 | 3300049824 | Bacteria | 6492 |
| 565 | Ga0501045_0018905 | 3300049824 | Bacteria | 4906 |
| 566 | Ga0501045_0049979 | 3300049824 | Bacteria | 3050 |
| 567 | Ga0501045_0316168 | 3300049824 | Bacteria | 1162 |
| 568 | nmdc:mga0k408_18241_c1 | 3300050493 | Bacteria | 3915 |
| 569 | nmdc:mga06z11_4077_c1 | 3300050494 | Bacteria | 5713 |
| 570 | nmdc:mga05p37_2516_c1 | 3300050507 | Bacteria | 21303 |
| 571 | nmdc:mga05p37_539440_c1 | 3300050507 | Unclassified | 1330 |
| 572 | nmdc:mga05p37_58752_c1 | 3300050507 | Bacteria | 4737 |
| 573 | nmdc:mga05p37_614492_c1 | 3300050507 | Unclassified | 1224 |
| 574 | nmdc:mga05p37_645546_c1 | 3300050507 | Bacteria | 1186 |
| 575 | nmdc:mga05p37_7882_c1 | 3300050507 | Bacteria | 12569 |
| 576 | nmdc:mga05p37_88013_c1 | 3300050507 | Bacteria | 3828 |
| 577 | nmdc:mga05p37_989_c1 | 3300050507 | Bacteria | 32388 |
| 578 | nmdc:mga09592_114159_c1 | 3300050508 | Bacteria | 2318 |
| 579 | nmdc:mga09592_4993_c1 | 3300050508 | Bacteria | 10754 |
| 580 | nmdc:mga09592_58882_c1 | 3300050508 | Bacteria | 3248 |
| 581 | nmdc:mga0qj67_1253555_c1 | 3300050509 | Bacteria | 575 |
| 582 | nmdc:mga0qj67_330482_c1 | 3300050509 | Bacteria | 1234 |
| 583 | nmdc:mga0qj67_398088_c1 | 3300050509 | Bacteria | 1111 |
| 584 | nmdc:mga0qj67_4908_c1 | 3300050509 | Bacteria | 9728 |
| 585 | nmdc:mga0qj67_760675_c1 | 3300050509 | Bacteria | 768 |
| 586 | nmdc:mga0qj67_7629_c1 | 3300050509 | Bacteria | 7992 |
| 587 | nmdc:mga06r32_150798_c1 | 3300050510 | Bacteria | 2303 |
| 588 | nmdc:mga06r32_614683_c1 | 3300050510 | Bacteria | 1057 |
| 589 | nmdc:mga06r32_7703_c1 | 3300050510 | Bacteria | 9686 |
| 590 | nmdc:mga08y16_11940_c1 | 3300050511 | Bacteria | 9123 |
| 591 | nmdc:mga08y16_122872_c1 | 3300050511 | Bacteria | 2701 |
| 592 | nmdc:mga08y16_176486_c1 | 3300050511 | Bacteria | 2219 |
| 593 | nmdc:mga08y16_217979_c1 | 3300050511 | Bacteria | 1976 |
| 594 | nmdc:mga08y16_26996_c1 | 3300050511 | Bacteria | 6051 |
| 595 | nmdc:mga08y16_28335_c1 | 3300050511 | Bacteria | 5904 |
| 596 | nmdc:mga08y16_3154_c1 | 3300050511 | Bacteria | 17076 |
| 597 | nmdc:mga08y16_4998_c1 | 3300050511 | Bacteria | 13866 |
| 598 | nmdc:mga08y16_506340_c1 | 3300050511 | Unclassified | 1226 |
| 599 | nmdc:mga08y16_530460_c1 | 3300050511 | Bacteria | 1193 |
| 600 | nmdc:mga0n895_149987_c1 | 3300050512 | Bacteria | 2361 |
| 601 | nmdc:mga0n895_1515_c1 | 3300050512 | Bacteria | 17423 |
| 602 | nmdc:mga0n895_178404_c1 | 3300050512 | Bacteria | 2155 |
| 603 | nmdc:mga0n895_48993_c1 | 3300050512 | Bacteria | 4137 |
| 604 | nmdc:mga0n895_512256_c1 | 3300050512 | Bacteria | 1208 |
| 605 | nmdc:mga0n895_630731_c1 | 3300050512 | Unclassified | 1072 |
| 606 | nmdc:mga0n895_699526_c1 | 3300050512 | Bacteria | 1010 |
| 607 | nmdc:mga0n895_822456_c1 | 3300050512 | Archaea | 918 |
| 608 | nmdc:mga0rr50_211637_c1 | 3300050513 | Bacteria | 1597 |
| 609 | nmdc:mga0rr50_89061_c1 | 3300050513 | Bacteria | 2399 |
| 610 | nmdc:mga08x19_104697_c1 | 3300050514 | Bacteria | 1881 |
| 611 | nmdc:mga08x19_12387_c1 | 3300050514 | Bacteria | 5137 |
| 612 | nmdc:mga08x19_553990_c1 | 3300050514 | Bacteria | 814 |
| 613 | nmdc:mga0a205_121753_c1 | 3300050515 | Bacteria | 2508 |
| 614 | nmdc:mga0a205_158688_c1 | 3300050515 | Bacteria | 2159 |
| 615 | nmdc:mga0a205_28813_c2 | 3300050515 | Bacteria | 2332 |
| 616 | nmdc:mga0a205_31626_c1 | 3300050515 | Bacteria | 5072 |
| 617 | nmdc:mga0a205_475330_c1 | 3300050515 | Unclassified | 1108 |
| 618 | nmdc:mga0a205_613_c1 | 3300050515 | Bacteria | 28395 |
| 619 | nmdc:mga0a205_948026_c1 | 3300050515 | Unclassified | 707 |
| 620 | Ga0495595_0022357 | 3300053084 | Bacteria | 2776 |
| 621 | Ga0495619_0071960 | 3300053085 | Bacteria | 2315 |
| 622 | Ga0501084_0013745 | 3300054114 | Bacteria | 6700 |
| 623 | Ga0501084_0020526 | 3300054114 | Bacteria | 5511 |
| 624 | Ga0501084_0134859 | 3300054114 | Bacteria | 2079 |
| 625 | Ga0501084_0203634 | 3300054114 | Unclassified | 1670 |
| 626 | Ga0501084_0265469 | 3300054114 | Bacteria | 1449 |
| 627 | Ga0501082_0002846 | 3300060353 | Bacteria | 15076 |
| 628 | Ga0501082_0017551 | 3300060353 | Bacteria | 6164 |
| 629 | Ga0501082_0036362 | 3300060353 | Bacteria | 4242 |
| 630 | Ga0501082_0089451 | 3300060353 | Bacteria | 2658 |
| 631 | Ga0501082_0114820 | 3300060353 | Bacteria | 2332 |
| 632 | Ga0501082_0304075 | 3300060353 | Bacteria | 1389 |
| 633 | Ga0530510_0016973 | 3300061734 | Bacteria | 5155 |
| 634 | Ga0530510_0486684 | 3300061734 | Bacteria | 935 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005549 | Ga0070704_100008665 | Ga0070704_1000086656 | 150 |
| 2 | 3300005343 | Ga0070687_100262228 | Ga0070687_1002622282 | 151 |
| 3 | 3300009094 | Ga0111539_11191044 | Ga0111539_111910442 | 151 |
| 4 | 3300044842 | Ga0466957_0658034 | Ga0466957_0658034_173_643 | 151 |
| 5 | 3300049568 | Ga0501031_0146433 | Ga0501031_0146433_817_1299 | 151 |
| 6 | 3300049570 | Ga0501033_0227118 | Ga0501033_0227118_737_1219 | 151 |
| 7 | 3300049573 | Ga0501037_0512601 | Ga0501037_0512601_264_746 | 151 |
| 8 | 3300049576 | Ga0501040_0095476 | Ga0501040_0095476_259_741 | 151 |
| 9 | 3300049578 | Ga0501042_0065524 | Ga0501042_0065524_481_963 | 151 |
| 10 | 3300049582 | Ga0501048_0065494 | Ga0501048_0065494_1818_2300 | 151 |
| 11 | 3300049584 | Ga0501068_0573808 | Ga0501068_0573808_188_670 | 151 |
| 12 | 3300049587 | Ga0501071_0008739 | Ga0501071_0008739_3700_4182 | 151 |
| 13 | 3300049588 | Ga0501072_0520489 | Ga0501072_0520489_125_607 | 151 |
| 14 | 3300049590 | Ga0501074_0230972 | Ga0501074_0230972_390_872 | 151 |
| 15 | 3300049592 | Ga0501076_0169124 | Ga0501076_0169124_52_534 | 151 |
| 16 | 3300049743 | Ga0501081_0804824 | Ga0501081_0804824_108_572 | 151 |
| 17 | 3300049822 | Ga0501035_0235598 | Ga0501035_0235598_240_722 | 151 |
| 18 | 3300049824 | Ga0501045_0018905 | Ga0501045_0018905_3271_3753 | 151 |
| 19 | 3300060353 | Ga0501082_0114820 | Ga0501082_0114820_526_1008 | 151 |
| 20 | 3300005293 | Ga0065715_10683227 | Ga0065715_106832271 | 152 |
| 21 | 3300005295 | Ga0065707_10002739 | Ga0065707_100027392 | 152 |
| 22 | 3300005295 | Ga0065707_10084894 | Ga0065707_100848945 | 152 |
| 23 | 3300005327 | Ga0070658_10028504 | Ga0070658_100285047 | 152 |
| 24 | 3300005328 | Ga0070676_10009864 | Ga0070676_100098642 | 152 |
| 25 | 3300005328 | Ga0070676_10173496 | Ga0070676_101734962 | 152 |
| 26 | 3300005335 | Ga0070666_10071493 | Ga0070666_100714932 | 152 |
| 27 | 3300005336 | Ga0070680_100631255 | Ga0070680_1006312552 | 152 |
| 28 | 3300005341 | Ga0070691_10000425 | Ga0070691_1000042512 | 152 |
| 29 | 3300005343 | Ga0070687_100020732 | Ga0070687_1000207321 | 152 |
| 30 | 3300005343 | Ga0070687_100136273 | Ga0070687_1001362732 | 152 |
| 31 | 3300005343 | Ga0070687_100977973 | Ga0070687_1009779732 | 152 |
| 32 | 3300005345 | Ga0070692_10298977 | Ga0070692_102989772 | 152 |
| 33 | 3300005347 | Ga0070668_100020029 | Ga0070668_1000200292 | 152 |
| 34 | 3300005347 | Ga0070668_100066448 | Ga0070668_1000664482 | 152 |
| 35 | 3300005353 | Ga0070669_100027876 | Ga0070669_1000278762 | 152 |
| 36 | 3300005353 | Ga0070669_100035365 | Ga0070669_1000353655 | 152 |
| 37 | 3300005353 | Ga0070669_100160487 | Ga0070669_1001604872 | 152 |
| 38 | 3300005353 | Ga0070669_100570023 | Ga0070669_1005700232 | 152 |
| 39 | 3300005354 | Ga0070675_100000433 | Ga0070675_1000004335 | 152 |
| 40 | 3300005354 | Ga0070675_100042879 | Ga0070675_1000428793 | 152 |
| 41 | 3300005356 | Ga0070674_100639219 | Ga0070674_1006392192 | 152 |
| 42 | 3300005364 | Ga0070673_100088738 | Ga0070673_1000887382 | 152 |
| 43 | 3300005438 | Ga0070701_10188594 | Ga0070701_101885942 | 152 |
| 44 | 3300005440 | Ga0070705_100001128 | Ga0070705_1000011285 | 152 |
| 45 | 3300005440 | Ga0070705_100001404 | Ga0070705_1000014047 | 152 |
| 46 | 3300005441 | Ga0070700_100000788 | Ga0070700_1000007885 | 152 |
| 47 | 3300005441 | Ga0070700_100005290 | Ga0070700_1000052906 | 152 |
| 48 | 3300005441 | Ga0070700_100106845 | Ga0070700_1001068452 | 152 |
| 49 | 3300005441 | Ga0070700_101188627 | Ga0070700_1011886271 | 152 |
| 50 | 3300005444 | Ga0070694_100001406 | Ga0070694_1000014062 | 152 |
| 51 | 3300005444 | Ga0070694_100122675 | Ga0070694_1001226752 | 152 |
| 52 | 3300005444 | Ga0070694_100528354 | Ga0070694_1005283541 | 152 |
| 53 | 3300005457 | Ga0070662_100035211 | Ga0070662_1000352112 | 152 |
| 54 | 3300005457 | Ga0070662_100142896 | Ga0070662_1001428962 | 152 |
| 55 | 3300005459 | Ga0068867_100011464 | Ga0068867_1000114644 | 152 |
| 56 | 3300005467 | Ga0070706_100835108 | Ga0070706_1008351082 | 152 |
| 57 | 3300005535 | Ga0070684_100133443 | Ga0070684_1001334432 | 152 |
| 58 | 3300005544 | Ga0070686_100000153 | Ga0070686_1000001539 | 152 |
| 59 | 3300005545 | Ga0070695_100000013 | Ga0070695_10000001314 | 152 |
| 60 | 3300005545 | Ga0070695_100032985 | Ga0070695_1000329854 | 152 |
| 61 | 3300005545 | Ga0070695_100586122 | Ga0070695_1005861222 | 152 |
| 62 | 3300005545 | Ga0070695_100611236 | Ga0070695_1006112361 | 152 |
| 63 | 3300005545 | Ga0070695_100925443 | Ga0070695_1009254431 | 152 |
| 64 | 3300005545 | Ga0070695_100981121 | Ga0070695_1009811211 | 152 |
| 65 | 3300005546 | Ga0070696_100007129 | Ga0070696_1000071293 | 152 |
| 66 | 3300005546 | Ga0070696_100008086 | Ga0070696_1000080862 | 152 |
| 67 | 3300005546 | Ga0070696_100533208 | Ga0070696_1005332082 | 152 |
| 68 | 3300005546 | Ga0070696_100550875 | Ga0070696_1005508752 | 152 |
| 69 | 3300005547 | Ga0070693_100248446 | Ga0070693_1002484462 | 152 |
| 70 | 3300005547 | Ga0070693_100716098 | Ga0070693_1007160982 | 152 |
| 71 | 3300005549 | Ga0070704_101322865 | Ga0070704_1013228651 | 152 |
| 72 | 3300005563 | Ga0068855_100317114 | Ga0068855_1003171142 | 152 |
| 73 | 3300005578 | Ga0068854_100008015 | Ga0068854_1000080152 | 152 |
| 74 | 3300005578 | Ga0068854_100011351 | Ga0068854_1000113513 | 152 |
| 75 | 3300005614 | Ga0068856_100031335 | Ga0068856_1000313352 | 152 |
| 76 | 3300005615 | Ga0070702_100243735 | Ga0070702_1002437352 | 152 |
| 77 | 3300005616 | Ga0068852_100238120 | Ga0068852_1002381202 | 152 |
| 78 | 3300005616 | Ga0068852_100361852 | Ga0068852_1003618522 | 152 |
| 79 | 3300005618 | Ga0068864_101444255 | Ga0068864_1014442552 | 152 |
| 80 | 3300005718 | Ga0068866_10242582 | Ga0068866_102425822 | 152 |
| 81 | 3300005719 | Ga0068861_100012709 | Ga0068861_1000127093 | 152 |
| 82 | 3300005719 | Ga0068861_100051092 | Ga0068861_1000510922 | 152 |
| 83 | 3300005719 | Ga0068861_100405433 | Ga0068861_1004054332 | 152 |
| 84 | 3300005842 | Ga0068858_100862391 | Ga0068858_1008623911 | 152 |
| 85 | 3300005843 | Ga0068860_100274970 | Ga0068860_1002749702 | 152 |
| 86 | 3300005843 | Ga0068860_100861601 | Ga0068860_1008616012 | 152 |
| 87 | 3300005844 | Ga0068862_100043918 | Ga0068862_1000439185 | 152 |
| 88 | 3300005844 | Ga0068862_100178909 | Ga0068862_1001789092 | 152 |
| 89 | 3300005844 | Ga0068862_100704313 | Ga0068862_1007043132 | 152 |
| 90 | 3300006178 | Ga0075367_10018891 | Ga0075367_100188912 | 152 |
| 91 | 3300006195 | Ga0075366_10026956 | Ga0075366_100269562 | 152 |
| 92 | 3300006852 | Ga0075433_10050842 | Ga0075433_100508422 | 152 |
| 93 | 3300006881 | Ga0068865_100351331 | Ga0068865_1003513312 | 152 |
| 94 | 3300006881 | Ga0068865_100524618 | Ga0068865_1005246182 | 152 |
| 95 | 3300006914 | Ga0075436_100052587 | Ga0075436_1000525872 | 152 |
| 96 | 3300006914 | Ga0075436_100485414 | Ga0075436_1004854141 | 152 |
| 97 | 3300006931 | Ga0097620_100314818 | Ga0097620_1003148182 | 152 |
| 98 | 3300009093 | Ga0105240_10342108 | Ga0105240_103421082 | 152 |
| 99 | 3300009094 | Ga0111539_10028028 | Ga0111539_100280285 | 152 |
| 100 | 3300009147 | Ga0114129_10235325 | Ga0114129_102353252 | 152 |
| 101 | 3300009148 | Ga0105243_10449972 | Ga0105243_104499722 | 152 |
| 102 | 3300009174 | Ga0105241_10375433 | Ga0105241_103754332 | 152 |
| 103 | 3300009174 | Ga0105241_10757271 | Ga0105241_107572712 | 152 |
| 104 | 3300009176 | Ga0105242_10116616 | Ga0105242_101166162 | 152 |
| 105 | 3300009176 | Ga0105242_10187783 | Ga0105242_101877832 | 152 |
| 106 | 3300009177 | Ga0105248_10080482 | Ga0105248_100804823 | 152 |
| 107 | 3300009553 | Ga0105249_11114590 | Ga0105249_111145902 | 152 |
| 108 | 3300009553 | Ga0105249_11231712 | Ga0105249_112317121 | 152 |
| 109 | 3300010375 | Ga0105239_12408314 | Ga0105239_124083141 | 152 |
| 110 | 3300011119 | Ga0105246_10378878 | Ga0105246_103788782 | 152 |
| 111 | 3300013104 | Ga0157370_10711774 | Ga0157370_107117742 | 152 |
| 112 | 3300013105 | Ga0157369_10386158 | Ga0157369_103861582 | 152 |
| 113 | 3300013296 | Ga0157374_10155197 | Ga0157374_101551972 | 152 |
| 114 | 3300013307 | Ga0157372_10460337 | Ga0157372_104603372 | 152 |
| 115 | 3300013308 | Ga0157375_10755186 | Ga0157375_107551862 | 152 |
| 116 | 3300014325 | Ga0163163_10227833 | Ga0163163_102278332 | 152 |
| 117 | 3300014326 | Ga0157380_10057944 | Ga0157380_100579442 | 152 |
| 118 | 3300014326 | Ga0157380_10121340 | Ga0157380_101213402 | 152 |
| 119 | 3300014745 | Ga0157377_10055265 | Ga0157377_100552652 | 152 |
| 120 | 3300017792 | Ga0163161_10249687 | Ga0163161_102496872 | 152 |
| 121 | 3300025315 | Ga0207697_10082692 | Ga0207697_100826922 | 152 |
| 122 | 3300025899 | Ga0207642_10304844 | Ga0207642_103048442 | 152 |
| 123 | 3300025901 | Ga0207688_10108977 | Ga0207688_101089772 | 152 |
| 124 | 3300025903 | Ga0207680_10090828 | Ga0207680_100908282 | 152 |
| 125 | 3300025907 | Ga0207645_10001406 | Ga0207645_100014066 | 152 |
| 126 | 3300025907 | Ga0207645_10188096 | Ga0207645_101880962 | 152 |
| 127 | 3300025909 | Ga0207705_10099807 | Ga0207705_100998075 | 152 |
| 128 | 3300025910 | Ga0207684_10681004 | Ga0207684_106810042 | 152 |
| 129 | 3300025917 | Ga0207660_10410706 | Ga0207660_104107062 | 152 |
| 130 | 3300025918 | Ga0207662_10116396 | Ga0207662_101163963 | 152 |
| 131 | 3300025918 | Ga0207662_10436638 | Ga0207662_104366382 | 152 |
| 132 | 3300025920 | Ga0207649_10139007 | Ga0207649_101390072 | 152 |
| 133 | 3300025923 | Ga0207681_10022128 | Ga0207681_100221282 | 152 |
| 134 | 3300025926 | Ga0207659_10000079 | Ga0207659_1000007926 | 152 |
| 135 | 3300025926 | Ga0207659_10209420 | Ga0207659_102094202 | 152 |
| 136 | 3300025933 | Ga0207706_10045569 | Ga0207706_100455692 | 152 |
| 137 | 3300025933 | Ga0207706_10179083 | Ga0207706_101790832 | 152 |
| 138 | 3300025934 | Ga0207686_10994945 | Ga0207686_109949451 | 152 |
| 139 | 3300025935 | Ga0207709_10063505 | Ga0207709_100635052 | 152 |
| 140 | 3300025937 | Ga0207669_10358794 | Ga0207669_103587942 | 152 |
| 141 | 3300025937 | Ga0207669_10461390 | Ga0207669_104613902 | 152 |
| 142 | 3300025937 | Ga0207669_11066887 | Ga0207669_110668871 | 152 |
| 143 | 3300025938 | Ga0207704_10273315 | Ga0207704_102733152 | 152 |
| 144 | 3300025942 | Ga0207689_10414750 | Ga0207689_104147502 | 152 |
| 145 | 3300025944 | Ga0207661_10224860 | Ga0207661_102248602 | 152 |
| 146 | 3300025944 | Ga0207661_10295160 | Ga0207661_102951602 | 152 |
| 147 | 3300025972 | Ga0207668_10294731 | Ga0207668_102947312 | 152 |
| 148 | 3300025981 | Ga0207640_10007460 | Ga0207640_100074602 | 152 |
| 149 | 3300025981 | Ga0207640_10028125 | Ga0207640_100281252 | 152 |
| 150 | 3300026041 | Ga0207639_10539826 | Ga0207639_105398261 | 152 |
| 151 | 3300026075 | Ga0207708_10004337 | Ga0207708_100043375 | 152 |
| 152 | 3300026075 | Ga0207708_10027833 | Ga0207708_100278332 | 152 |
| 153 | 3300026075 | Ga0207708_10046797 | Ga0207708_100467972 | 152 |
| 154 | 3300026078 | Ga0207702_10008196 | Ga0207702_100081967 | 152 |
| 155 | 3300026089 | Ga0207648_10002536 | Ga0207648_100025365 | 152 |
| 156 | 3300026095 | Ga0207676_10536952 | Ga0207676_105369522 | 152 |
| 157 | 3300026118 | Ga0207675_100019034 | Ga0207675_1000190344 | 152 |
| 158 | 3300026118 | Ga0207675_100203574 | Ga0207675_1002035742 | 152 |
| 159 | 3300026118 | Ga0207675_100235685 | Ga0207675_1002356852 | 152 |
| 160 | 3300026118 | Ga0207675_100346802 | Ga0207675_1003468022 | 152 |
| 161 | 3300026118 | Ga0207675_100412931 | Ga0207675_1004129312 | 152 |
| 162 | 3300026118 | Ga0207675_100579393 | Ga0207675_1005793933 | 152 |
| 163 | 3300026118 | Ga0207675_102079836 | Ga0207675_1020798361 | 152 |
| 164 | 3300026142 | Ga0207698_10036810 | Ga0207698_100368103 | 152 |
| 165 | 3300027907 | Ga0207428_10003214 | Ga0207428_100032149 | 152 |
| 166 | 3300027907 | Ga0207428_10071655 | Ga0207428_100716552 | 152 |
| 167 | 3300028380 | Ga0268265_10029432 | Ga0268265_100294322 | 152 |
| 168 | 3300028380 | Ga0268265_10438076 | Ga0268265_104380762 | 152 |
| 169 | 3300028380 | Ga0268265_10525196 | Ga0268265_105251961 | 152 |
| 170 | 3300028381 | Ga0268264_12342838 | Ga0268264_123428381 | 152 |
| 171 | 3300032002 | Ga0307416_100547707 | Ga0307416_1005477072 | 152 |
| 172 | 3300032002 | Ga0307416_101169275 | Ga0307416_1011692752 | 152 |
| 173 | 3300035115 | Ga0373941_0033694 | Ga0373941_0033694_626_1090 | 152 |
| 174 | 3300044694 | Ga0466963_1026187 | Ga0466963_1026187_69_527 | 152 |
| 175 | 3300044842 | Ga0466957_1070575 | Ga0466957_1070575_100_558 | 152 |
| 176 | 3300045051 | Ga0451576_0129908 | Ga0451576_0129908_1034_1492 | 152 |
| 177 | 3300045051 | Ga0451576_0450726 | Ga0451576_0450726_154_615 | 152 |
| 178 | 3300045976 | Ga0466967_0833321 | Ga0466967_0833321_12_482 | 152 |
| 179 | 3300046664 | Ga0495659_0011168 | Ga0495659_0011168_2147_2608 | 152 |
| 180 | 3300046684 | Ga0495669_0318296 | Ga0495669_0318296_72_530 | 152 |
| 181 | 3300047445 | Ga0495677_0090315 | Ga0495677_0090315_20_481 | 152 |
| 182 | 3300048905 | Ga0496102_0203453 | Ga0496102_0203453_1374_1835 | 152 |
| 183 | 3300048909 | Ga0496106_0204995 | Ga0496106_0204995_235_696 | 152 |
| 184 | 3300049580 | Ga0501046_0356649 | Ga0501046_0356649_584_1051 | 152 |
| 185 | 3300049588 | Ga0501072_0470160 | Ga0501072_0470160_471_938 | 152 |
| 186 | 3300049592 | Ga0501076_0151923 | Ga0501076_0151923_764_1231 | 152 |
| 187 | 3300049824 | Ga0501045_0316168 | Ga0501045_0316168_189_656 | 152 |
| 188 | 3300050493 | nmdc:mga0k408_18241_c1 | nmdc:mga0k408_18241_c1_841_1308 | 152 |
| 189 | 3300050494 | nmdc:mga06z11_4077_c1 | nmdc:mga06z11_4077_c1_2362_2829 | 152 |
| 190 | 3300050507 | nmdc:mga05p37_989_c1 | nmdc:mga05p37_989_c1_263_724 | 152 |
| 191 | 3300050511 | nmdc:mga08y16_11940_c1 | nmdc:mga08y16_11940_c1_6927_7385 | 152 |
| 192 | 3300050511 | nmdc:mga08y16_4998_c1 | nmdc:mga08y16_4998_c1_7300_7761 | 152 |
| 193 | 3300050513 | nmdc:mga0rr50_211637_c1 | nmdc:mga0rr50_211637_c1_107_577 | 152 |
| 194 | 3300050514 | nmdc:mga08x19_104697_c1 | nmdc:mga08x19_104697_c1_232_693 | 152 |
| 195 | 3300050515 | nmdc:mga0a205_121753_c1 | nmdc:mga0a205_121753_c1_337_795 | 152 |
| 196 | 3300050515 | nmdc:mga0a205_948026_c1 | nmdc:mga0a205_948026_c1_204_665 | 152 |
| 197 | 3300054114 | Ga0501084_0265469 | Ga0501084_0265469_606_1073 | 152 |
| 198 | 3300061734 | Ga0530510_0486684 | Ga0530510_0486684_208_669 | 152 |
| 199 | 3300005334 | Ga0068869_100425728 | Ga0068869_1004257281 | 153 |
| 200 | 3300005353 | Ga0070669_100180720 | Ga0070669_1001807202 | 153 |
| 201 | 3300005354 | Ga0070675_100578898 | Ga0070675_1005788982 | 153 |
| 202 | 3300005367 | Ga0070667_100709687 | Ga0070667_1007096872 | 153 |
| 203 | 3300005518 | Ga0070699_100013629 | Ga0070699_1000136292 | 153 |
| 204 | 3300005518 | Ga0070699_100819083 | Ga0070699_1008190832 | 153 |
| 205 | 3300005536 | Ga0070697_100566761 | Ga0070697_1005667612 | 153 |
| 206 | 3300005544 | Ga0070686_100070428 | Ga0070686_1000704282 | 153 |
| 207 | 3300005545 | Ga0070695_100439617 | Ga0070695_1004396172 | 153 |
| 208 | 3300005548 | Ga0070665_100008640 | Ga0070665_1000086408 | 153 |
| 209 | 3300005548 | Ga0070665_100117069 | Ga0070665_1001170692 | 153 |
| 210 | 3300005616 | Ga0068852_100472096 | Ga0068852_1004720962 | 153 |
| 211 | 3300005617 | Ga0068859_101902663 | Ga0068859_1019026631 | 153 |
| 212 | 3300005618 | Ga0068864_100234757 | Ga0068864_1002347572 | 153 |
| 213 | 3300005718 | Ga0068866_10069929 | Ga0068866_100699292 | 153 |
| 214 | 3300005719 | Ga0068861_100378213 | Ga0068861_1003782132 | 153 |
| 215 | 3300005834 | Ga0068851_10189003 | Ga0068851_101890031 | 153 |
| 216 | 3300005842 | Ga0068858_100017044 | Ga0068858_1000170442 | 153 |
| 217 | 3300005842 | Ga0068858_100173908 | Ga0068858_1001739081 | 153 |
| 218 | 3300005843 | Ga0068860_100061409 | Ga0068860_1000614092 | 153 |
| 219 | 3300006237 | Ga0097621_100413069 | Ga0097621_1004130692 | 153 |
| 220 | 3300006844 | Ga0075428_100633123 | Ga0075428_1006331233 | 153 |
| 221 | 3300006847 | Ga0075431_100425216 | Ga0075431_1004252162 | 153 |
| 222 | 3300006852 | Ga0075433_10019086 | Ga0075433_100190862 | 153 |
| 223 | 3300006914 | Ga0075436_100026454 | Ga0075436_1000264542 | 153 |
| 224 | 3300006914 | Ga0075436_100035274 | Ga0075436_1000352744 | 153 |
| 225 | 3300006931 | Ga0097620_101902409 | Ga0097620_1019024091 | 153 |
| 226 | 3300009094 | Ga0111539_10086580 | Ga0111539_100865802 | 153 |
| 227 | 3300009094 | Ga0111539_10102668 | Ga0111539_101026682 | 153 |
| 228 | 3300009094 | Ga0111539_10209070 | Ga0111539_102090703 | 153 |
| 229 | 3300009094 | Ga0111539_10493323 | Ga0111539_104933232 | 153 |
| 230 | 3300009098 | Ga0105245_10013815 | Ga0105245_100138152 | 153 |
| 231 | 3300009147 | Ga0114129_10231163 | Ga0114129_102311633 | 153 |
| 232 | 3300009147 | Ga0114129_10377678 | Ga0114129_103776782 | 153 |
| 233 | 3300009176 | Ga0105242_10086482 | Ga0105242_100864822 | 153 |
| 234 | 3300009176 | Ga0105242_10298350 | Ga0105242_102983502 | 153 |
| 235 | 3300009553 | Ga0105249_10166850 | Ga0105249_101668502 | 153 |
| 236 | 3300013296 | Ga0157374_10258659 | Ga0157374_102586592 | 153 |
| 237 | 3300013297 | Ga0157378_10083682 | Ga0157378_100836823 | 153 |
| 238 | 3300014326 | Ga0157380_10046121 | Ga0157380_100461214 | 153 |
| 239 | 3300014326 | Ga0157380_10091606 | Ga0157380_100916063 | 153 |
| 240 | 3300014326 | Ga0157380_10099365 | Ga0157380_100993653 | 153 |
| 241 | 3300014968 | Ga0157379_10068624 | Ga0157379_100686242 | 153 |
| 242 | 3300014969 | Ga0157376_10029506 | Ga0157376_100295062 | 153 |
| 243 | 3300025899 | Ga0207642_10061529 | Ga0207642_100615292 | 153 |
| 244 | 3300025926 | Ga0207659_10302044 | Ga0207659_103020442 | 153 |
| 245 | 3300025926 | Ga0207659_10861235 | Ga0207659_108612351 | 153 |
| 246 | 3300025927 | Ga0207687_10215455 | Ga0207687_102154552 | 153 |
| 247 | 3300025934 | Ga0207686_10183767 | Ga0207686_101837672 | 153 |
| 248 | 3300025942 | Ga0207689_10416128 | Ga0207689_104161281 | 153 |
| 249 | 3300025986 | Ga0207658_10564805 | Ga0207658_105648052 | 153 |
| 250 | 3300026035 | Ga0207703_10028554 | Ga0207703_100285545 | 153 |
| 251 | 3300026095 | Ga0207676_10446165 | Ga0207676_104461652 | 153 |
| 252 | 3300026118 | Ga0207675_100427669 | Ga0207675_1004276692 | 153 |
| 253 | 3300026142 | Ga0207698_10396867 | Ga0207698_103968672 | 153 |
| 254 | 3300027907 | Ga0207428_10052174 | Ga0207428_100521743 | 153 |
| 255 | 3300027907 | Ga0207428_10104551 | Ga0207428_101045512 | 153 |
| 256 | 3300028379 | Ga0268266_10019822 | Ga0268266_100198222 | 153 |
| 257 | 3300028379 | Ga0268266_10271821 | Ga0268266_102718212 | 153 |
| 258 | 3300028380 | Ga0268265_10298797 | Ga0268265_102987971 | 153 |
| 259 | 3300028380 | Ga0268265_10718947 | Ga0268265_107189472 | 153 |
| 260 | 3300028381 | Ga0268264_10226506 | Ga0268264_102265062 | 153 |
| 261 | 3300028381 | Ga0268264_10292267 | Ga0268264_102922672 | 153 |
| 262 | 3300030521 | Ga0307511_10289271 | Ga0307511_102892712 | 153 |
| 263 | 3300031824 | Ga0307413_10506903 | Ga0307413_105069032 | 153 |
| 264 | 3300035113 | Ga0373936_0464862 | Ga0373936_0464862_92_559 | 153 |
| 265 | 3300035172 | Ga0373955_0168279 | Ga0373955_0168279_804_1271 | 153 |
| 266 | 3300035172 | Ga0373955_0305726 | Ga0373955_0305726_290_757 | 153 |
| 267 | 3300035410 | Ga0373924_0292947 | Ga0373924_0292947_224_691 | 153 |
| 268 | 3300036401 | Ga0373937_0012405 | Ga0373937_0012405_1658_2125 | 153 |
| 269 | 3300036401 | Ga0373937_0370300 | Ga0373937_0370300_121_588 | 153 |
| 270 | 3300036401 | Ga0373937_1000478 | Ga0373937_1000478_211_678 | 153 |
| 271 | 3300037068 | Ga0373925_0398317 | Ga0373925_0398317_479_952 | 153 |
| 272 | 3300042439 | Ga0439464_0089396 | Ga0439464_0089396_132_704 | 153 |
| 273 | 3300045051 | Ga0451576_0986814 | Ga0451576_0986814_266_736 | 153 |
| 274 | 3300045051 | Ga0451576_1942141 | Ga0451576_1942141_36_515 | 153 |
| 275 | 3300046462 | Ga0495651_0205239 | Ga0495651_0205239_240_707 | 153 |
| 276 | 3300046516 | Ga0495628_0427805 | Ga0495628_0427805_203_670 | 153 |
| 277 | 3300046516 | Ga0495628_0503820 | Ga0495628_0503820_98_565 | 153 |
| 278 | 3300046539 | Ga0495621_0442798 | Ga0495621_0442798_18_488 | 153 |
| 279 | 3300046543 | Ga0495645_0002325 | Ga0495645_0002325_639_1106 | 153 |
| 280 | 3300046678 | Ga0495599_0043797 | Ga0495599_0043797_652_1122 | 153 |
| 281 | 3300046678 | Ga0495599_0124401 | Ga0495599_0124401_446_913 | 153 |
| 282 | 3300046683 | Ga0495658_0083279 | Ga0495658_0083279_120_587 | 153 |
| 283 | 3300046689 | Ga0495613_0699965 | Ga0495613_0699965_141_608 | 153 |
| 284 | 3300046692 | Ga0495671_0245366 | Ga0495671_0245366_349_816 | 153 |
| 285 | 3300047322 | Ga0495680_0338784 | Ga0495680_0338784_57_524 | 153 |
| 286 | 3300047471 | Ga0495684_0030629 | Ga0495684_0030629_1128_1595 | 153 |
| 287 | 3300048904 | Ga0496101_0202761 | Ga0496101_0202761_185_655 | 153 |
| 288 | 3300048907 | Ga0496104_0429069 | Ga0496104_0429069_270_731 | 153 |
| 289 | 3300048908 | Ga0496105_0666239 | Ga0496105_0666239_294_761 | 153 |
| 290 | 3300048908 | Ga0496105_1063580 | Ga0496105_1063580_72_542 | 153 |
| 291 | 3300048918 | Ga0496115_0214081 | Ga0496115_0214081_985_1455 | 153 |
| 292 | 3300049588 | Ga0501072_0690087 | Ga0501072_0690087_110_574 | 153 |
| 293 | 3300049591 | Ga0501075_0322649 | Ga0501075_0322649_59_523 | 153 |
| 294 | 3300050507 | nmdc:mga05p37_539440_c1 | nmdc:mga05p37_539440_c1_610_1086 | 153 |
| 295 | 3300050507 | nmdc:mga05p37_645546_c1 | nmdc:mga05p37_645546_c1_302_778 | 153 |
| 296 | 3300050509 | nmdc:mga0qj67_1253555_c1 | nmdc:mga0qj67_1253555_c1_55_516 | 153 |
| 297 | 3300050509 | nmdc:mga0qj67_398088_c1 | nmdc:mga0qj67_398088_c1_86_562 | 153 |
| 298 | 3300050510 | nmdc:mga06r32_614683_c1 | nmdc:mga06r32_614683_c1_556_1017 | 153 |
| 299 | 3300050511 | nmdc:mga08y16_122872_c1 | nmdc:mga08y16_122872_c1_829_1308 | 153 |
| 300 | 3300050511 | nmdc:mga08y16_217979_c1 | nmdc:mga08y16_217979_c1_1200_1670 | 153 |
| 301 | 3300050511 | nmdc:mga08y16_26996_c1 | nmdc:mga08y16_26996_c1_2406_2882 | 153 |
| 302 | 3300050514 | nmdc:mga08x19_12387_c1 | nmdc:mga08x19_12387_c1_974_1438 | 153 |
| 303 | 3300053084 | Ga0495595_0022357 | Ga0495595_0022357_1408_1875 | 153 |
| 304 | 3300005338 | Ga0068868_100299800 | Ga0068868_1002998002 | 154 |
| 305 | 3300005356 | Ga0070674_100412060 | Ga0070674_1004120602 | 154 |
| 306 | 3300005356 | Ga0070674_100501274 | Ga0070674_1005012742 | 154 |
| 307 | 3300005518 | Ga0070699_100042236 | Ga0070699_1000422362 | 154 |
| 308 | 3300006871 | Ga0075434_100347945 | Ga0075434_1003479452 | 154 |
| 309 | 3300009147 | Ga0114129_10000426 | Ga0114129_1000042617 | 154 |
| 310 | 3300009177 | Ga0105248_10920304 | Ga0105248_109203041 | 154 |
| 311 | 3300013306 | Ga0163162_10501363 | Ga0163162_105013632 | 154 |
| 312 | 3300013306 | Ga0163162_10575760 | Ga0163162_105757602 | 154 |
| 313 | 3300013308 | Ga0157375_12210283 | Ga0157375_122102831 | 154 |
| 314 | 3300014325 | Ga0163163_10504106 | Ga0163163_105041062 | 154 |
| 315 | 3300014969 | Ga0157376_10200404 | Ga0157376_102004042 | 154 |
| 316 | 3300025919 | Ga0207657_10573303 | Ga0207657_105733031 | 154 |
| 317 | 3300025934 | Ga0207686_11044443 | Ga0207686_110444432 | 154 |
| 318 | 3300025938 | Ga0207704_10351195 | Ga0207704_103511952 | 154 |
| 319 | 3300025940 | Ga0207691_10122470 | Ga0207691_101224702 | 154 |
| 320 | 3300025941 | Ga0207711_10389796 | Ga0207711_103897962 | 154 |
| 321 | 3300036401 | Ga0373937_0382300 | Ga0373937_0382300_799_1290 | 154 |
| 322 | 3300046674 | Ga0495588_0512114 | Ga0495588_0512114_15_482 | 154 |
| 323 | 3300048917 | Ga0496114_0078312 | Ga0496114_0078312_551_1021 | 154 |
| 324 | 3300049569 | Ga0501032_0003850 | Ga0501032_0003850_7474_7953 | 154 |
| 325 | 3300049569 | Ga0501032_0004854 | Ga0501032_0004854_7583_8062 | 154 |
| 326 | 3300049570 | Ga0501033_0003710 | Ga0501033_0003710_2173_2652 | 154 |
| 327 | 3300049570 | Ga0501033_0023579 | Ga0501033_0023579_2038_2517 | 154 |
| 328 | 3300049570 | Ga0501033_0588083 | Ga0501033_0588083_85_594 | 154 |
| 329 | 3300049571 | Ga0501034_0036744 | Ga0501034_0036744_1289_1768 | 154 |
| 330 | 3300049571 | Ga0501034_0143034 | Ga0501034_0143034_201_680 | 154 |
| 331 | 3300049572 | Ga0501036_0003430 | Ga0501036_0003430_8799_9278 | 154 |
| 332 | 3300049572 | Ga0501036_0015810 | Ga0501036_0015810_4451_4930 | 154 |
| 333 | 3300049572 | Ga0501036_0047881 | Ga0501036_0047881_2373_2882 | 154 |
| 334 | 3300049572 | Ga0501036_1367980 | Ga0501036_1367980_19_498 | 154 |
| 335 | 3300049573 | Ga0501037_0020405 | Ga0501037_0020405_1729_2208 | 154 |
| 336 | 3300049573 | Ga0501037_0022219 | Ga0501037_0022219_2239_2718 | 154 |
| 337 | 3300049574 | Ga0501038_0025440 | Ga0501038_0025440_3380_3859 | 154 |
| 338 | 3300049574 | Ga0501038_0078591 | Ga0501038_0078591_359_838 | 154 |
| 339 | 3300049575 | Ga0501039_0054148 | Ga0501039_0054148_1468_1947 | 154 |
| 340 | 3300049575 | Ga0501039_0223794 | Ga0501039_0223794_461_970 | 154 |
| 341 | 3300049576 | Ga0501040_0014862 | Ga0501040_0014862_2496_3005 | 154 |
| 342 | 3300049576 | Ga0501040_0304172 | Ga0501040_0304172_478_957 | 154 |
| 343 | 3300049576 | Ga0501040_0484813 | Ga0501040_0484813_197_676 | 154 |
| 344 | 3300049577 | Ga0501041_0061439 | Ga0501041_0061439_1450_1959 | 154 |
| 345 | 3300049578 | Ga0501042_0076064 | Ga0501042_0076064_188_667 | 154 |
| 346 | 3300049578 | Ga0501042_0499453 | Ga0501042_0499453_184_663 | 154 |
| 347 | 3300049579 | Ga0501043_0016613 | Ga0501043_0016613_3151_3630 | 154 |
| 348 | 3300049580 | Ga0501046_0048701 | Ga0501046_0048701_2406_2885 | 154 |
| 349 | 3300049580 | Ga0501046_0105391 | Ga0501046_0105391_411_890 | 154 |
| 350 | 3300049581 | Ga0501047_0025544 | Ga0501047_0025544_3850_4329 | 154 |
| 351 | 3300049581 | Ga0501047_0045386 | Ga0501047_0045386_2080_2559 | 154 |
| 352 | 3300049581 | Ga0501047_0046619 | Ga0501047_0046619_3017_3496 | 154 |
| 353 | 3300049581 | Ga0501047_1236761 | Ga0501047_1236761_38_514 | 154 |
| 354 | 3300049582 | Ga0501048_0003526 | Ga0501048_0003526_478_957 | 154 |
| 355 | 3300049582 | Ga0501048_0025034 | Ga0501048_0025034_3027_3506 | 154 |
| 356 | 3300049582 | Ga0501048_0051788 | Ga0501048_0051788_2126_2635 | 154 |
| 357 | 3300049582 | Ga0501048_0077759 | Ga0501048_0077759_1563_2042 | 154 |
| 358 | 3300049583 | Ga0501067_0009296 | Ga0501067_0009296_3892_4371 | 154 |
| 359 | 3300049583 | Ga0501067_0259441 | Ga0501067_0259441_199_678 | 154 |
| 360 | 3300049584 | Ga0501068_0001251 | Ga0501068_0001251_1925_2404 | 154 |
| 361 | 3300049584 | Ga0501068_0007676 | Ga0501068_0007676_2834_3313 | 154 |
| 362 | 3300049584 | Ga0501068_0046814 | Ga0501068_0046814_1890_2369 | 154 |
| 363 | 3300049585 | Ga0501069_0009755 | Ga0501069_0009755_4566_5045 | 154 |
| 364 | 3300049585 | Ga0501069_0104145 | Ga0501069_0104145_140_619 | 154 |
| 365 | 3300049586 | Ga0501070_0018320 | Ga0501070_0018320_3773_4252 | 154 |
| 366 | 3300049587 | Ga0501071_0000369 | Ga0501071_0000369_9958_10437 | 154 |
| 367 | 3300049587 | Ga0501071_0030947 | Ga0501071_0030947_108_587 | 154 |
| 368 | 3300049587 | Ga0501071_0058867 | Ga0501071_0058867_2085_2594 | 154 |
| 369 | 3300049588 | Ga0501072_0089570 | Ga0501072_0089570_360_869 | 154 |
| 370 | 3300049588 | Ga0501072_0446882 | Ga0501072_0446882_288_767 | 154 |
| 371 | 3300049589 | Ga0501073_0003611 | Ga0501073_0003611_6238_6717 | 154 |
| 372 | 3300049589 | Ga0501073_0007039 | Ga0501073_0007039_2993_3472 | 154 |
| 373 | 3300049589 | Ga0501073_0069301 | Ga0501073_0069301_1563_2042 | 154 |
| 374 | 3300049590 | Ga0501074_0000449 | Ga0501074_0000449_16957_17436 | 154 |
| 375 | 3300049590 | Ga0501074_0022878 | Ga0501074_0022878_795_1274 | 154 |
| 376 | 3300049590 | Ga0501074_0032931 | Ga0501074_0032931_1507_1986 | 154 |
| 377 | 3300049590 | Ga0501074_0132167 | Ga0501074_0132167_58_567 | 154 |
| 378 | 3300049591 | Ga0501075_0031363 | Ga0501075_0031363_1642_2151 | 154 |
| 379 | 3300049592 | Ga0501076_0027186 | Ga0501076_0027186_2874_3383 | 154 |
| 380 | 3300049593 | Ga0501077_0075754 | Ga0501077_0075754_1410_1919 | 154 |
| 381 | 3300049741 | Ga0501079_0004204 | Ga0501079_0004204_9119_9598 | 154 |
| 382 | 3300049741 | Ga0501079_0005948 | Ga0501079_0005948_3855_4334 | 154 |
| 383 | 3300049741 | Ga0501079_0007653 | Ga0501079_0007653_1097_1576 | 154 |
| 384 | 3300049742 | Ga0501080_0051593 | Ga0501080_0051593_1931_2410 | 154 |
| 385 | 3300049742 | Ga0501080_0250133 | Ga0501080_0250133_1052_1561 | 154 |
| 386 | 3300049743 | Ga0501081_0031836 | Ga0501081_0031836_1977_2486 | 154 |
| 387 | 3300049744 | Ga0501083_0013241 | Ga0501083_0013241_3810_4289 | 154 |
| 388 | 3300049822 | Ga0501035_0003099 | Ga0501035_0003099_2534_3013 | 154 |
| 389 | 3300049822 | Ga0501035_0007716 | Ga0501035_0007716_3038_3517 | 154 |
| 390 | 3300049822 | Ga0501035_0060857 | Ga0501035_0060857_57_536 | 154 |
| 391 | 3300049823 | Ga0501044_0013275 | Ga0501044_0013275_4250_4729 | 154 |
| 392 | 3300049823 | Ga0501044_0133102 | Ga0501044_0133102_900_1379 | 154 |
| 393 | 3300049824 | Ga0501045_0002867 | Ga0501045_0002867_7084_7593 | 154 |
| 394 | 3300049824 | Ga0501045_0010485 | Ga0501045_0010485_10_489 | 154 |
| 395 | 3300050507 | nmdc:mga05p37_58752_c1 | nmdc:mga05p37_58752_c1_905_1378 | 154 |
| 396 | 3300050509 | nmdc:mga0qj67_7629_c1 | nmdc:mga0qj67_7629_c1_7157_7636 | 154 |
| 397 | 3300050512 | nmdc:mga0n895_48993_c1 | nmdc:mga0n895_48993_c1_636_1109 | 154 |
| 398 | 3300050512 | nmdc:mga0n895_630731_c1 | nmdc:mga0n895_630731_c1_168_632 | 154 |
| 399 | 3300054114 | Ga0501084_0013745 | Ga0501084_0013745_842_1351 | 154 |
| 400 | 3300060353 | Ga0501082_0002846 | Ga0501082_0002846_11889_12368 | 154 |
| 401 | 3300060353 | Ga0501082_0017551 | Ga0501082_0017551_1265_1744 | 154 |
| 402 | 3300060353 | Ga0501082_0036362 | Ga0501082_0036362_1328_1807 | 154 |
| 403 | 3300060353 | Ga0501082_0089451 | Ga0501082_0089451_1796_2305 | 154 |
| 404 | 3300061734 | Ga0530510_0016973 | Ga0530510_0016973_905_1414 | 154 |
| 405 | 3300005293 | Ga0065715_10154999 | Ga0065715_101549992 | 155 |
| 406 | 3300005293 | Ga0065715_10236571 | Ga0065715_102365712 | 155 |
| 407 | 3300005295 | Ga0065707_10004595 | Ga0065707_100045952 | 155 |
| 408 | 3300005295 | Ga0065707_10163550 | Ga0065707_101635502 | 155 |
| 409 | 3300005329 | Ga0070683_100098876 | Ga0070683_1000988761 | 155 |
| 410 | 3300005331 | Ga0070670_100423309 | Ga0070670_1004233092 | 155 |
| 411 | 3300005333 | Ga0070677_10059521 | Ga0070677_100595212 | 155 |
| 412 | 3300005345 | Ga0070692_10481672 | Ga0070692_104816721 | 155 |
| 413 | 3300005353 | Ga0070669_100012308 | Ga0070669_1000123087 | 155 |
| 414 | 3300005354 | Ga0070675_100219255 | Ga0070675_1002192552 | 155 |
| 415 | 3300005354 | Ga0070675_100876522 | Ga0070675_1008765221 | 155 |
| 416 | 3300005354 | Ga0070675_101308552 | Ga0070675_1013085521 | 155 |
| 417 | 3300005365 | Ga0070688_100041978 | Ga0070688_1000419782 | 155 |
| 418 | 3300005366 | Ga0070659_100311161 | Ga0070659_1003111611 | 155 |
| 419 | 3300005366 | Ga0070659_101352784 | Ga0070659_1013527841 | 155 |
| 420 | 3300005436 | Ga0070713_100755611 | Ga0070713_1007556112 | 155 |
| 421 | 3300005441 | Ga0070700_100253744 | Ga0070700_1002537442 | 155 |
| 422 | 3300005455 | Ga0070663_100578049 | Ga0070663_1005780491 | 155 |
| 423 | 3300005456 | Ga0070678_100354657 | Ga0070678_1003546572 | 155 |
| 424 | 3300005456 | Ga0070678_100529990 | Ga0070678_1005299902 | 155 |
| 425 | 3300005457 | Ga0070662_100371558 | Ga0070662_1003715582 | 155 |
| 426 | 3300005458 | Ga0070681_10387246 | Ga0070681_103872462 | 155 |
| 427 | 3300005545 | Ga0070695_100571070 | Ga0070695_1005710702 | 155 |
| 428 | 3300005547 | Ga0070693_100041130 | Ga0070693_1000411302 | 155 |
| 429 | 3300005549 | Ga0070704_100080788 | Ga0070704_1000807882 | 155 |
| 430 | 3300005549 | Ga0070704_100280490 | Ga0070704_1002804902 | 155 |
| 431 | 3300005549 | Ga0070704_101008460 | Ga0070704_1010084602 | 155 |
| 432 | 3300005577 | Ga0068857_100087396 | Ga0068857_1000873963 | 155 |
| 433 | 3300005617 | Ga0068859_100857192 | Ga0068859_1008571922 | 155 |
| 434 | 3300005844 | Ga0068862_100010510 | Ga0068862_1000105102 | 155 |
| 435 | 3300006237 | Ga0097621_100000125 | Ga0097621_10000012523 | 155 |
| 436 | 3300006237 | Ga0097621_100157874 | Ga0097621_1001578742 | 155 |
| 437 | 3300006358 | Ga0068871_100000134 | Ga0068871_10000013434 | 155 |
| 438 | 3300006844 | Ga0075428_100006263 | Ga0075428_10000626310 | 155 |
| 439 | 3300006846 | Ga0075430_100000722 | Ga0075430_10000072215 | 155 |
| 440 | 3300006846 | Ga0075430_100784597 | Ga0075430_1007845971 | 155 |
| 441 | 3300006847 | Ga0075431_100019089 | Ga0075431_1000190893 | 155 |
| 442 | 3300006847 | Ga0075431_100019172 | Ga0075431_1000191725 | 155 |
| 443 | 3300006847 | Ga0075431_101080915 | Ga0075431_1010809152 | 155 |
| 444 | 3300006852 | Ga0075433_10017226 | Ga0075433_100172264 | 155 |
| 445 | 3300006852 | Ga0075433_10219449 | Ga0075433_102194492 | 155 |
| 446 | 3300006871 | Ga0075434_100005743 | Ga0075434_1000057437 | 155 |
| 447 | 3300006871 | Ga0075434_100192132 | Ga0075434_1001921322 | 155 |
| 448 | 3300006871 | Ga0075434_100447361 | Ga0075434_1004473612 | 155 |
| 449 | 3300006871 | Ga0075434_100459628 | Ga0075434_1004596282 | 155 |
| 450 | 3300006871 | Ga0075434_100944548 | Ga0075434_1009445482 | 155 |
| 451 | 3300006880 | Ga0075429_100002690 | Ga0075429_10000269011 | 155 |
| 452 | 3300006880 | Ga0075429_100284206 | Ga0075429_1002842061 | 155 |
| 453 | 3300006880 | Ga0075429_101187194 | Ga0075429_1011871941 | 155 |
| 454 | 3300006881 | Ga0068865_100520064 | Ga0068865_1005200642 | 155 |
| 455 | 3300006931 | Ga0097620_100770166 | Ga0097620_1007701662 | 155 |
| 456 | 3300006931 | Ga0097620_100857188 | Ga0097620_1008571882 | 155 |
| 457 | 3300007076 | Ga0075435_100006762 | Ga0075435_1000067626 | 155 |
| 458 | 3300007076 | Ga0075435_100065440 | Ga0075435_1000654402 | 155 |
| 459 | 3300009093 | Ga0105240_11365940 | Ga0105240_113659402 | 155 |
| 460 | 3300009094 | Ga0111539_10000230 | Ga0111539_1000023030 | 155 |
| 461 | 3300009094 | Ga0111539_10003342 | Ga0111539_100033426 | 155 |
| 462 | 3300009094 | Ga0111539_10123958 | Ga0111539_101239583 | 155 |
| 463 | 3300009094 | Ga0111539_10135036 | Ga0111539_101350362 | 155 |
| 464 | 3300009094 | Ga0111539_10158865 | Ga0111539_101588652 | 155 |
| 465 | 3300009094 | Ga0111539_10192426 | Ga0111539_101924262 | 155 |
| 466 | 3300009094 | Ga0111539_10197521 | Ga0111539_101975212 | 155 |
| 467 | 3300009098 | Ga0105245_12905016 | Ga0105245_129050161 | 155 |
| 468 | 3300009147 | Ga0114129_10013149 | Ga0114129_100131496 | 155 |
| 469 | 3300009147 | Ga0114129_10014774 | Ga0114129_100147742 | 155 |
| 470 | 3300009147 | Ga0114129_11721348 | Ga0114129_117213482 | 155 |
| 471 | 3300009148 | Ga0105243_10960054 | Ga0105243_109600542 | 155 |
| 472 | 3300009148 | Ga0105243_10998721 | Ga0105243_109987211 | 155 |
| 473 | 3300009174 | Ga0105241_10463331 | Ga0105241_104633311 | 155 |
| 474 | 3300009553 | Ga0105249_10009745 | Ga0105249_100097455 | 155 |
| 475 | 3300009553 | Ga0105249_10267327 | Ga0105249_102673272 | 155 |
| 476 | 3300013296 | Ga0157374_10017943 | Ga0157374_100179432 | 155 |
| 477 | 3300013297 | Ga0157378_10009109 | Ga0157378_100091095 | 155 |
| 478 | 3300013306 | Ga0163162_11310218 | Ga0163162_113102182 | 155 |
| 479 | 3300013308 | Ga0157375_12826462 | Ga0157375_128264621 | 155 |
| 480 | 3300014325 | Ga0163163_10210923 | Ga0163163_102109232 | 155 |
| 481 | 3300014326 | Ga0157380_10287534 | Ga0157380_102875342 | 155 |
| 482 | 3300014326 | Ga0157380_10830505 | Ga0157380_108305052 | 155 |
| 483 | 3300014326 | Ga0157380_10902687 | Ga0157380_109026871 | 155 |
| 484 | 3300014326 | Ga0157380_10953974 | Ga0157380_109539742 | 155 |
| 485 | 3300014745 | Ga0157377_10063934 | Ga0157377_100639342 | 155 |
| 486 | 3300014968 | Ga0157379_10198779 | Ga0157379_101987792 | 155 |
| 487 | 3300014968 | Ga0157379_10274633 | Ga0157379_102746332 | 155 |
| 488 | 3300014969 | Ga0157376_10049362 | Ga0157376_100493622 | 155 |
| 489 | 3300025271 | Ga0207666_1026369 | Ga0207666_10263692 | 155 |
| 490 | 3300025901 | Ga0207688_10446579 | Ga0207688_104465791 | 155 |
| 491 | 3300025906 | Ga0207699_10298849 | Ga0207699_102988491 | 155 |
| 492 | 3300025912 | Ga0207707_10139577 | Ga0207707_101395772 | 155 |
| 493 | 3300025912 | Ga0207707_10360121 | Ga0207707_103601212 | 155 |
| 494 | 3300025923 | Ga0207681_10004564 | Ga0207681_100045642 | 155 |
| 495 | 3300025925 | Ga0207650_10359794 | Ga0207650_103597942 | 155 |
| 496 | 3300025932 | Ga0207690_10413689 | Ga0207690_104136891 | 155 |
| 497 | 3300025932 | Ga0207690_10520639 | Ga0207690_105206391 | 155 |
| 498 | 3300025933 | Ga0207706_10108716 | Ga0207706_101087162 | 155 |
| 499 | 3300025935 | Ga0207709_10649709 | Ga0207709_106497092 | 155 |
| 500 | 3300025961 | Ga0207712_10055161 | Ga0207712_100551611 | 155 |
| 501 | 3300026035 | Ga0207703_10078831 | Ga0207703_100788311 | 155 |
| 502 | 3300026075 | Ga0207708_10094753 | Ga0207708_100947532 | 155 |
| 503 | 3300026075 | Ga0207708_10161966 | Ga0207708_101619661 | 155 |
| 504 | 3300026075 | Ga0207708_10405455 | Ga0207708_104054552 | 155 |
| 505 | 3300026116 | Ga0207674_10102878 | Ga0207674_101028782 | 155 |
| 506 | 3300026121 | Ga0207683_10364934 | Ga0207683_103649342 | 155 |
| 507 | 3300026142 | Ga0207698_10218136 | Ga0207698_102181362 | 155 |
| 508 | 3300027907 | Ga0207428_10000531 | Ga0207428_1000053126 | 155 |
| 509 | 3300027907 | Ga0207428_10046855 | Ga0207428_100468552 | 155 |
| 510 | 3300027907 | Ga0207428_10460104 | Ga0207428_104601042 | 155 |
| 511 | 3300028380 | Ga0268265_11478861 | Ga0268265_114788611 | 155 |
| 512 | 3300028381 | Ga0268264_10453545 | Ga0268264_104535451 | 155 |
| 513 | 3300031548 | Ga0307408_100013807 | Ga0307408_1000138076 | 155 |
| 514 | 3300031548 | Ga0307408_100028512 | Ga0307408_1000285123 | 155 |
| 515 | 3300031731 | Ga0307405_11418614 | Ga0307405_114186141 | 155 |
| 516 | 3300031824 | Ga0307413_10174622 | Ga0307413_101746222 | 155 |
| 517 | 3300031901 | Ga0307406_10268399 | Ga0307406_102683992 | 155 |
| 518 | 3300031903 | Ga0307407_10240046 | Ga0307407_102400463 | 155 |
| 519 | 3300031903 | Ga0307407_10265782 | Ga0307407_102657822 | 155 |
| 520 | 3300031911 | Ga0307412_10136776 | Ga0307412_101367762 | 155 |
| 521 | 3300031995 | Ga0307409_100392431 | Ga0307409_1003924312 | 155 |
| 522 | 3300032002 | Ga0307416_100016217 | Ga0307416_1000162176 | 155 |
| 523 | 3300032002 | Ga0307416_100438454 | Ga0307416_1004384541 | 155 |
| 524 | 3300032002 | Ga0307416_100632165 | Ga0307416_1006321652 | 155 |
| 525 | 3300032002 | Ga0307416_100974381 | Ga0307416_1009743812 | 155 |
| 526 | 3300032005 | Ga0307411_10144227 | Ga0307411_101442272 | 155 |
| 527 | 3300032005 | Ga0307411_10446158 | Ga0307411_104461582 | 155 |
| 528 | 3300032126 | Ga0307415_100236844 | Ga0307415_1002368442 | 155 |
| 529 | 3300035114 | Ga0373939_0408306 | Ga0373939_0408306_17_493 | 155 |
| 530 | 3300035118 | Ga0373954_0409777 | Ga0373954_0409777_51_542 | 155 |
| 531 | 3300042008 | Ga0439450_003896 | Ga0439450_003896_291_788 | 155 |
| 532 | 3300042439 | Ga0439464_0002262 | Ga0439464_0002262_20_517 | 155 |
| 533 | 3300042439 | Ga0439464_0205519 | Ga0439464_0205519_48_515 | 155 |
| 534 | 3300042461 | Ga0439460_0130755 | Ga0439460_0130755_60_557 | 155 |
| 535 | 3300042530 | Ga0450916_002278 | Ga0450916_002278_1093_1563 | 155 |
| 536 | 3300045051 | Ga0451576_0461969 | Ga0451576_0461969_815_1306 | 155 |
| 537 | 3300046455 | Ga0495603_0088042 | Ga0495603_0088042_906_1397 | 155 |
| 538 | 3300046459 | Ga0495629_0269491 | Ga0495629_0269491_275_766 | 155 |
| 539 | 3300046472 | Ga0495580_0042467 | Ga0495580_0042467_71_547 | 155 |
| 540 | 3300046475 | Ga0495639_0048556 | Ga0495639_0048556_1168_1644 | 155 |
| 541 | 3300046499 | Ga0495594_0339188 | Ga0495594_0339188_177_653 | 155 |
| 542 | 3300046522 | Ga0495643_0002984 | Ga0495643_0002984_8992_9492 | 155 |
| 543 | 3300046531 | Ga0495665_0422780 | Ga0495665_0422780_153_629 | 155 |
| 544 | 3300048904 | Ga0496101_0129213 | Ga0496101_0129213_616_1107 | 155 |
| 545 | 3300048905 | Ga0496102_0010247 | Ga0496102_0010247_1522_2013 | 155 |
| 546 | 3300048905 | Ga0496102_0282283 | Ga0496102_0282283_101_595 | 155 |
| 547 | 3300048905 | Ga0496102_0379283 | Ga0496102_0379283_719_1186 | 155 |
| 548 | 3300048908 | Ga0496105_0615060 | Ga0496105_0615060_152_625 | 155 |
| 549 | 3300048909 | Ga0496106_0054612 | Ga0496106_0054612_339_830 | 155 |
| 550 | 3300048909 | Ga0496106_0597668 | Ga0496106_0597668_155_646 | 155 |
| 551 | 3300048912 | Ga0496109_0042829 | Ga0496109_0042829_2595_3086 | 155 |
| 552 | 3300048913 | Ga0496110_0120594 | Ga0496110_0120594_1853_2344 | 155 |
| 553 | 3300049514 | Ga0501291_009568 | Ga0501291_009568_743_1240 | 155 |
| 554 | 3300049522 | Ga0501299_005008 | Ga0501299_005008_134_619 | 155 |
| 555 | 3300049522 | Ga0501299_094995 | Ga0501299_094995_93_563 | 155 |
| 556 | 3300049523 | Ga0501300_054067 | Ga0501300_054067_112_609 | 155 |
| 557 | 3300049577 | Ga0501041_0066506 | Ga0501041_0066506_902_1393 | 155 |
| 558 | 3300049578 | Ga0501042_0313517 | Ga0501042_0313517_574_1080 | 155 |
| 559 | 3300049578 | Ga0501042_0594062 | Ga0501042_0594062_218_709 | 155 |
| 560 | 3300049579 | Ga0501043_0703662 | Ga0501043_0703662_213_704 | 155 |
| 561 | 3300049584 | Ga0501068_0191371 | Ga0501068_0191371_320_793 | 155 |
| 562 | 3300049587 | Ga0501071_0296193 | Ga0501071_0296193_605_1096 | 155 |
| 563 | 3300049587 | Ga0501071_0580256 | Ga0501071_0580256_87_557 | 155 |
| 564 | 3300049588 | Ga0501072_0162545 | Ga0501072_0162545_387_893 | 155 |
| 565 | 3300049588 | Ga0501072_0182961 | Ga0501072_0182961_764_1255 | 155 |
| 566 | 3300049588 | Ga0501072_0655680 | Ga0501072_0655680_209_679 | 155 |
| 567 | 3300049589 | Ga0501073_0109131 | Ga0501073_0109131_1366_1863 | 155 |
| 568 | 3300049589 | Ga0501073_0464242 | Ga0501073_0464242_15_506 | 155 |
| 569 | 3300049590 | Ga0501074_0089065 | Ga0501074_0089065_190_681 | 155 |
| 570 | 3300049590 | Ga0501074_0249386 | Ga0501074_0249386_527_1033 | 155 |
| 571 | 3300049591 | Ga0501075_0166972 | Ga0501075_0166972_994_1500 | 155 |
| 572 | 3300049591 | Ga0501075_0174013 | Ga0501075_0174013_1052_1543 | 155 |
| 573 | 3300049592 | Ga0501076_0093817 | Ga0501076_0093817_523_1014 | 155 |
| 574 | 3300049661 | Ga0501217_005251 | Ga0501217_005251_2134_2619 | 155 |
| 575 | 3300049661 | Ga0501217_017168 | Ga0501217_017168_994_1491 | 155 |
| 576 | 3300049679 | Ga0501249_014431 | Ga0501249_014431_637_1122 | 155 |
| 577 | 3300049741 | Ga0501079_0018154 | Ga0501079_0018154_3099_3590 | 155 |
| 578 | 3300049741 | Ga0501079_0401809 | Ga0501079_0401809_231_737 | 155 |
| 579 | 3300049742 | Ga0501080_0143848 | Ga0501080_0143848_271_762 | 155 |
| 580 | 3300049742 | Ga0501080_0791464 | Ga0501080_0791464_299_796 | 155 |
| 581 | 3300049743 | Ga0501081_0105438 | Ga0501081_0105438_541_1032 | 155 |
| 582 | 3300049743 | Ga0501081_0275222 | Ga0501081_0275222_589_1059 | 155 |
| 583 | 3300049760 | Ga0501263_015189 | Ga0501263_015189_449_934 | 155 |
| 584 | 3300049766 | Ga0501269_014350 | Ga0501269_014350_273_770 | 155 |
| 585 | 3300049824 | Ga0501045_0049979 | Ga0501045_0049979_1733_2239 | 155 |
| 586 | 3300050507 | nmdc:mga05p37_2516_c1 | nmdc:mga05p37_2516_c1_10464_10961 | 155 |
| 587 | 3300050507 | nmdc:mga05p37_7882_c1 | nmdc:mga05p37_7882_c1_11849_12349 | 155 |
| 588 | 3300050507 | nmdc:mga05p37_88013_c1 | nmdc:mga05p37_88013_c1_621_1112 | 155 |
| 589 | 3300050508 | nmdc:mga09592_114159_c1 | nmdc:mga09592_114159_c1_705_1205 | 155 |
| 590 | 3300050508 | nmdc:mga09592_4993_c1 | nmdc:mga09592_4993_c1_10122_10619 | 155 |
| 591 | 3300050509 | nmdc:mga0qj67_330482_c1 | nmdc:mga0qj67_330482_c1_722_1216 | 155 |
| 592 | 3300050509 | nmdc:mga0qj67_4908_c1 | nmdc:mga0qj67_4908_c1_5563_6060 | 155 |
| 593 | 3300050509 | nmdc:mga0qj67_760675_c1 | nmdc:mga0qj67_760675_c1_156_656 | 155 |
| 594 | 3300050510 | nmdc:mga06r32_150798_c1 | nmdc:mga06r32_150798_c1_1211_1714 | 155 |
| 595 | 3300050510 | nmdc:mga06r32_7703_c1 | nmdc:mga06r32_7703_c1_7108_7605 | 155 |
| 596 | 3300050511 | nmdc:mga08y16_28335_c1 | nmdc:mga08y16_28335_c1_2754_3254 | 155 |
| 597 | 3300050511 | nmdc:mga08y16_3154_c1 | nmdc:mga08y16_3154_c1_4332_4832 | 155 |
| 598 | 3300050511 | nmdc:mga08y16_506340_c1 | nmdc:mga08y16_506340_c1_191_694 | 155 |
| 599 | 3300050511 | nmdc:mga08y16_530460_c1 | nmdc:mga08y16_530460_c1_84_584 | 155 |
| 600 | 3300050512 | nmdc:mga0n895_149987_c1 | nmdc:mga0n895_149987_c1_788_1282 | 155 |
| 601 | 3300050512 | nmdc:mga0n895_178404_c1 | nmdc:mga0n895_178404_c1_1021_1497 | 155 |
| 602 | 3300050512 | nmdc:mga0n895_512256_c1 | nmdc:mga0n895_512256_c1_151_651 | 155 |
| 603 | 3300050512 | nmdc:mga0n895_699526_c1 | nmdc:mga0n895_699526_c1_60_551 | 155 |
| 604 | 3300050512 | nmdc:mga0n895_822456_c1 | nmdc:mga0n895_822456_c1_263_778 | 155 |
| 605 | 3300050513 | nmdc:mga0rr50_89061_c1 | nmdc:mga0rr50_89061_c1_187_687 | 155 |
| 606 | 3300050514 | nmdc:mga08x19_553990_c1 | nmdc:mga08x19_553990_c1_232_723 | 155 |
| 607 | 3300050515 | nmdc:mga0a205_158688_c1 | nmdc:mga0a205_158688_c1_243_764 | 155 |
| 608 | 3300050515 | nmdc:mga0a205_28813_c2 | nmdc:mga0a205_28813_c2_1282_1773 | 155 |
| 609 | 3300050515 | nmdc:mga0a205_31626_c1 | nmdc:mga0a205_31626_c1_1575_2120 | 155 |
| 610 | 3300050515 | nmdc:mga0a205_475330_c1 | nmdc:mga0a205_475330_c1_110_625 | 155 |
| 611 | 3300053085 | Ga0495619_0071960 | Ga0495619_0071960_714_1190 | 155 |
| 612 | 3300054114 | Ga0501084_0020526 | Ga0501084_0020526_2028_2519 | 155 |
| 613 | 3300054114 | Ga0501084_0134859 | Ga0501084_0134859_711_1208 | 155 |
| 614 | 3300054114 | Ga0501084_0203634 | Ga0501084_0203634_1013_1519 | 155 |
| 615 | 3300060353 | Ga0501082_0304075 | Ga0501082_0304075_241_732 | 155 |
| 616 | 3300005468 | Ga0070707_100900779 | Ga0070707_1009007791 | 156 |
| 617 | 3300006846 | Ga0075430_100000247 | Ga0075430_10000024718 | 156 |
| 618 | 3300011119 | Ga0105246_10143870 | Ga0105246_101438701 | 156 |
| 619 | 3300013308 | Ga0157375_10021964 | Ga0157375_100219642 | 156 |
| 620 | 3300025935 | Ga0207709_10386372 | Ga0207709_103863722 | 156 |
| 621 | 3300026116 | Ga0207674_10359673 | Ga0207674_103596733 | 156 |
| 622 | 3300027665 | Ga0209983_1040463 | Ga0209983_10404632 | 156 |
| 623 | 3300035085 | Ga0373929_0226116 | Ga0373929_0226116_30_521 | 156 |
| 624 | 3300035091 | Ga0373951_0056175 | Ga0373951_0056175_151_642 | 156 |
| 625 | 3300035092 | Ga0373952_0248037 | Ga0373952_0248037_26_517 | 156 |
| 626 | 3300035112 | Ga0373932_0015319 | Ga0373932_0015319_1287_1778 | 156 |
| 627 | 3300045051 | Ga0451576_0173529 | Ga0451576_0173529_171_662 | 156 |
| 628 | 3300050507 | nmdc:mga05p37_614492_c1 | nmdc:mga05p37_614492_c1_630_1121 | 156 |
| 629 | 3300050508 | nmdc:mga09592_58882_c1 | nmdc:mga09592_58882_c1_1858_2349 | 156 |
| 630 | 3300050511 | nmdc:mga08y16_176486_c1 | nmdc:mga08y16_176486_c1_1067_1558 | 156 |
| 631 | 3300050512 | nmdc:mga0n895_1515_c1 | nmdc:mga0n895_1515_c1_9989_10480 | 156 |
| 632 | 3300050515 | nmdc:mga0a205_613_c1 | nmdc:mga0a205_613_c1_9472_9963 | 156 |
| 633 | 3300003203 | JGI25406J46586_10085755 | JGI25406J46586_100857552 | 157 |
| 634 | 3300005985 | Ga0081539_10002012 | Ga0081539_1000201220 | 157 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5xf2-assembly1.cif.gz_A | crystal structure of semet-hldc from burkholderia pseudomallei | 0.9203 | 3 | 139 |
| 1n1d-assembly1.cif.gz_A | glycerol-3-phosphate cytidylyltransferase complexed with cdp-glycerol | 0.8848 | 23 | 152 |
| 5x9q-assembly1.cif.gz_B | crystal structure of hldc from burkholderia pseudomallei | 0.8771 | 3 | 157 |
| 2b7l-assembly2.cif.gz_D | crystal structure of ctp:glycerol-3-phosphate cytidylyltransferase from staphylococcus aureus | 0.8684 | 23 | 139 |
| 1n1d-assembly1.cif.gz_A | glycerol-3-phosphate cytidylyltransferase complexed with cdp-glycerol | 0.865 | 23 | 152 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P76658_320_476_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.976 | 1 | 154 | 3.40.50.620 |
| 1cozA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9105 | 23 | 152 | 3.40.50.620 |
| 1cozA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8901 | 23 | 152 | 3.40.50.620 |
| af_Q58579_1_142_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8712 | 22 | 157 | 3.40.50.620 |
| 2b7lD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8684 | 23 | 139 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8IR58-F1-model_v4 | D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase (EC 2.7.7.70) | 0.9998 | 2 | 154 |
GO:0005524
GO:0005975 GO:0009058 GO:0016773 GO:0016779 |
| AF-A0A7V2YBR4-F1-model_v4 | D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase (EC 2.7.7.70) | 0.9952 | 14 | 156 |
GO:0005524
GO:0005975 GO:0009058 GO:0016773 GO:0016779 |
| AF-A0A2V8FV91-F1-model_v4 | D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase (EC 2.7.7.70) | 0.9948 | 3 | 155 |
GO:0005524
GO:0005975 GO:0009058 GO:0016773 GO:0016779 |
| AF-A0A496TSE6-F1-model_v4 | D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase (EC 2.7.7.70) | 0.9942 | 22 | 154 |
GO:0005524
GO:0005975 GO:0009058 GO:0016773 GO:0016779 |
| AF-A0A1F9DQZ5-F1-model_v4 | D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase (EC 2.7.7.70) | 0.9936 | 22 | 154 |
GO:0005524
GO:0005975 GO:0009058 GO:0016773 GO:0016779 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar