F471185

General Info

Members Datasets Scaffolds Average Seq Length
634 285 627 180

Family's Representative Sequence

Representative Sequence 3300041451|Ga0451791_0319493|Ga0451791_0319493_26_655
Length 209
Sequence MSMPVCVLVTGVVATLYTYLGGIEAVIWVDVLQVAVLIGGAVLTLAADTALRQRRIVYGVATREQVAGKSGLELFEAMIAGALPAPPISETLDFLLVAAEHGRVVFQGRPGFAHYNPMGAVHGGWFATLLDSALGCAVGSTLPAGKAYTTAELKVNIVRPLSDKVPFVRADGRVIHGGNRMATADARLTGPDGKLYAHGSTTCFIFDAP

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
4 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
5 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
6 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
7 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
78 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
83 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
119 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
120 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
121 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
124 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
180 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
181 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
182 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
183 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
184 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
185 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
186 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
187 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
188 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
189 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
190 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
200 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
201 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
202 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
203 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
204 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
205 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
206 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
209 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
210 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
211 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
212 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
213 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
214 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
215 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
216 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
217 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
218 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
219 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
220 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
221 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
222 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
223 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
224 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
225 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
226 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
227 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
228 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
229 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
230 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
231 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
232 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
233 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
234 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
235 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
236 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
237 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
238 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
239 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
240 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
241 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
248 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
255 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
256 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
261 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
262 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
264 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
265 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
266 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
267 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
268 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
269 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
270 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
271 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
272 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
273 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
274 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
275 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
276 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
277 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
278 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
279 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
280 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
281 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
282 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
283 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
284 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
285 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.9
Metatranscriptomes 0
Isolates 1.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.51
Nodule 0
Rhizoplane 3.79
Rhizosphere 79.02
Stem 0
Stem Tuber 0
Unclassified 5.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000626 3300002773 Bacteria 18751
2 JGI25153J46596_10001224 3300003215 Bacteria 15474
3 JGI25153J46596_10005270 3300003215 Bacteria 6797
4 JGI25153J46596_10010478 3300003215 Bacteria 4189
5 rootH1_10008702 3300003316 Bacteria 1054
6 rootH1_10065105 3300003316 Bacteria 2086
7 rootL2_10016479 3300003322 Bacteria 4719
8 rootH1_10172482 3300003323 Bacteria 2585
9 Ga0055526_1003267 3300003771 Bacteria 10410
10 Ga0065714_10083810 3300005288 Bacteria 2230
11 Ga0070658_10102909 3300005327 Bacteria 2362
12 Ga0070658_10549331 3300005327 Bacteria 999
13 Ga0070676_10003406 3300005328 Bacteria 8277
14 Ga0070676_10251400 3300005328 Bacteria 1180
15 Ga0070683_100005352 3300005329 Bacteria 10701
16 Ga0070690_100008781 3300005330 Bacteria 5834
17 Ga0070690_100057629 3300005330 Bacteria 2494
18 Ga0070670_100009851 3300005331 Bacteria 8160
19 Ga0070670_100022200 3300005331 Bacteria 5462
20 Ga0070670_100054662 3300005331 Bacteria 3428
21 Ga0070670_100093239 3300005331 Bacteria 2590
22 Ga0070670_100212401 3300005331 Bacteria 1682
23 Ga0070670_100284617 3300005331 Bacteria 1444
24 Ga0070670_100559691 3300005331 Bacteria 1021
25 Ga0070670_100634621 3300005331 Bacteria 957
26 Ga0070670_100837947 3300005331 Bacteria 832
27 Ga0068869_100018976 3300005334 Bacteria 4689
28 Ga0068869_100069759 3300005334 Bacteria 2599
29 Ga0068869_100247077 3300005334 Bacteria 1424
30 Ga0068869_101100067 3300005334 Bacteria 695
31 Ga0070666_10007624 3300005335 Bacteria 6678
32 Ga0070666_10113018 3300005335 Bacteria 1879
33 Ga0068868_100001157 3300005338 Bacteria 18078
34 Ga0068868_100020570 3300005338 Bacteria 4962
35 Ga0068868_100374913 3300005338 Bacteria 1223
36 Ga0068868_100489457 3300005338 Bacteria 1076
37 Ga0068868_100780116 3300005338 Bacteria 861
38 Ga0070660_100068835 3300005339 Bacteria 2759
39 Ga0070660_100469025 3300005339 Bacteria 1046
40 Ga0070689_100056678 3300005340 Bacteria 3039
41 Ga0070689_100158102 3300005340 Bacteria 1831
42 Ga0070691_10006362 3300005341 Bacteria 5400
43 Ga0070687_100001572 3300005343 Bacteria 8114
44 Ga0070687_100387055 3300005343 Bacteria 913
45 Ga0070661_100332441 3300005344 Bacteria 1189
46 Ga0070692_10158748 3300005345 Bacteria 1294
47 Ga0070692_10176509 3300005345 Bacteria 1235
48 Ga0070668_100003697 3300005347 Bacteria 11294
49 Ga0070669_100001896 3300005353 Bacteria 15091
50 Ga0070669_100076757 3300005353 Bacteria 2480
51 Ga0070675_100001801 3300005354 Bacteria 15832
52 Ga0070675_100015725 3300005354 Bacteria 5988
53 Ga0070675_100101108 3300005354 Bacteria 2428
54 Ga0070675_100300711 3300005354 Bacteria 1413
55 Ga0070675_100641931 3300005354 Bacteria 964
56 Ga0070671_100006533 3300005355 Bacteria 9322
57 Ga0070671_100031094 3300005355 Bacteria 4408
58 Ga0070671_100080213 3300005355 Bacteria 2728
59 Ga0070671_100134987 3300005355 Bacteria 2080
60 Ga0070671_100148544 3300005355 Bacteria 1979
61 Ga0070671_100299367 3300005355 Bacteria 1369
62 Ga0070671_101107475 3300005355 Bacteria 695
63 Ga0070674_100016511 3300005356 Bacteria 4628
64 Ga0070674_100027973 3300005356 Bacteria 3699
65 Ga0070674_100362131 3300005356 Bacteria 1174
66 Ga0070674_100567373 3300005356 Bacteria 954
67 Ga0070674_101419264 3300005356 Bacteria 622
68 Ga0070673_100125273 3300005364 Bacteria 2149
69 Ga0070688_100587624 3300005365 Bacteria 851
70 Ga0070659_100305056 3300005366 Bacteria 1328
71 Ga0070659_101089857 3300005366 Bacteria 704
72 Ga0070667_100006750 3300005367 Bacteria 9531
73 Ga0070667_100009471 3300005367 Bacteria 8079
74 Ga0070667_100088937 3300005367 Bacteria 2652
75 Ga0070667_100264840 3300005367 Bacteria 1540
76 Ga0070701_10005622 3300005438 Bacteria 5199
77 Ga0070701_10212132 3300005438 Bacteria 1150
78 Ga0070700_100003632 3300005441 Bacteria 7982
79 Ga0070700_100049456 3300005441 Bacteria 2610
80 Ga0070700_100340640 3300005441 Bacteria 1108
81 Ga0070694_100099115 3300005444 Bacteria 2058
82 Ga0070708_100156079 3300005445 Bacteria 2125
83 Ga0070663_100315532 3300005455 Bacteria 1255
84 Ga0070678_100046649 3300005456 Bacteria 3109
85 Ga0070678_100084262 3300005456 Bacteria 2419
86 Ga0070678_100278890 3300005456 Bacteria 1413
87 Ga0070678_100324632 3300005456 Bacteria 1315
88 Ga0070678_100369736 3300005456 Bacteria 1238
89 Ga0070662_100000867 3300005457 Bacteria 18517
90 Ga0070662_100033229 3300005457 Bacteria 3630
91 Ga0070662_100110025 3300005457 Bacteria 2097
92 Ga0070662_100110273 3300005457 Bacteria 2095
93 Ga0070662_100961128 3300005457 Bacteria 730
94 Ga0070681_10277226 3300005458 Unclassified 1588
95 Ga0068867_100010500 3300005459 Bacteria 6533
96 Ga0068867_100027068 3300005459 Bacteria 4119
97 Ga0068867_100077768 3300005459 Bacteria 2494
98 Ga0068867_100088043 3300005459 Bacteria 2352
99 Ga0068867_100099511 3300005459 Bacteria 2218
100 Ga0070685_10590976 3300005466 Bacteria 798
101 Ga0070706_100001400 3300005467 Bacteria 25498
102 Ga0070707_100024364 3300005468 Bacteria 5731
103 Ga0070699_100067925 3300005518 Bacteria 3095
104 Ga0070684_100027307 3300005535 Bacteria 4815
105 Ga0070684_100127611 3300005535 Bacteria 2292
106 Ga0068853_100002880 3300005539 Bacteria 13055
107 Ga0068853_100132036 3300005539 Bacteria 2236
108 Ga0068853_100275663 3300005539 Bacteria 1550
109 Ga0068853_100591297 3300005539 Bacteria 1054
110 Ga0070672_100042239 3300005543 Bacteria 3510
111 Ga0070672_100049097 3300005543 Bacteria 3281
112 Ga0070672_100052344 3300005543 Bacteria 3187
113 Ga0070672_100098868 3300005543 Bacteria 2364
114 Ga0070672_100150560 3300005543 Bacteria 1924
115 Ga0070672_100474677 3300005543 Bacteria 1079
116 Ga0070686_100010433 3300005544 Bacteria 5238
117 Ga0070695_100369725 3300005545 Bacteria 1079
118 Ga0070696_100224312 3300005546 Bacteria 1411
119 Ga0070696_100570291 3300005546 Bacteria 909
120 Ga0070696_100687959 3300005546 Bacteria 832
121 Ga0070693_100029302 3300005547 Bacteria 3001
122 Ga0070693_100033937 3300005547 Unclassified 2820
123 Ga0070693_100467100 3300005547 Bacteria 889
124 Ga0070665_100078999 3300005548 Bacteria 3296
125 Ga0070665_100263121 3300005548 Bacteria 1726
126 Ga0070665_100672796 3300005548 Bacteria 1048
127 Ga0070704_100034645 3300005549 Bacteria 3426
128 Ga0068855_100051204 3300005563 Bacteria 4864
129 Ga0070664_100034883 3300005564 Bacteria 4222
130 Ga0070664_100055141 3300005564 Bacteria 3373
131 Ga0070664_100115387 3300005564 Bacteria 2347
132 Ga0070664_100362793 3300005564 Bacteria 1319
133 Ga0070664_100528380 3300005564 Bacteria 1089
134 Ga0070664_100614455 3300005564 Bacteria 1009
135 Ga0070664_100737964 3300005564 Bacteria 919
136 Ga0070664_100821690 3300005564 Bacteria 869
137 Ga0068857_100298591 3300005577 Bacteria 1485
138 Ga0068857_101497336 3300005577 Bacteria 657
139 Ga0068854_100027581 3300005578 Bacteria 3915
140 Ga0068854_100247616 3300005578 Bacteria 1422
141 Ga0068854_100304415 3300005578 Bacteria 1290
142 Ga0068856_100004035 3300005614 Bacteria 14702
143 Ga0068856_100022973 3300005614 Bacteria 6064
144 Ga0070702_100002012 3300005615 Bacteria 8576
145 Ga0070702_100014791 3300005615 Bacteria 3968
146 Ga0068852_100048509 3300005616 Bacteria 3628
147 Ga0068852_100054887 3300005616 Bacteria 3436
148 Ga0068852_100072682 3300005616 Bacteria 3023
149 Ga0068852_100139459 3300005616 Bacteria 2242
150 Ga0068852_100189947 3300005616 Bacteria 1938
151 Ga0068852_100447083 3300005616 Bacteria 1279
152 Ga0068859_100039890 3300005617 Bacteria 4712
153 Ga0068859_100492687 3300005617 Unclassified 1321
154 Ga0068864_100024340 3300005618 Bacteria 5093
155 Ga0068864_100092381 3300005618 Bacteria 2671
156 Ga0068864_100130063 3300005618 Bacteria 2260
157 Ga0068866_10006667 3300005718 Bacteria 4815
158 Ga0068866_10024416 3300005718 Bacteria 2827
159 Ga0068861_100003855 3300005719 Bacteria 10017
160 Ga0068861_100014498 3300005719 Bacteria 5533
161 Ga0068861_100062057 3300005719 Bacteria 2870
162 Ga0068851_10009705 3300005834 Bacteria 4482
163 Ga0068851_10020198 3300005834 Bacteria 3222
164 Ga0068851_10147537 3300005834 Bacteria 1284
165 Ga0068870_10107341 3300005840 Bacteria 1588
166 Ga0068863_100058398 3300005841 Bacteria 3651
167 Ga0068863_100067310 3300005841 Bacteria 3387
168 Ga0068863_100195703 3300005841 Bacteria 1943
169 Ga0068863_100323282 3300005841 Bacteria 1499
170 Ga0068863_100469384 3300005841 Bacteria 1237
171 Ga0068863_100570434 3300005841 Bacteria 1118
172 Ga0068858_100010960 3300005842 Bacteria 8567
173 Ga0068858_100036965 3300005842 Bacteria 4527
174 Ga0068858_100160326 3300005842 Bacteria 2118
175 Ga0068860_100003734 3300005843 Bacteria 15664
176 Ga0068860_100038970 3300005843 Unclassified 4546
177 Ga0068860_100176947 3300005843 Bacteria 2062
178 Ga0068860_100499385 3300005843 Bacteria 1214
179 Ga0068862_100032968 3300005844 Bacteria 4375
180 Ga0068862_100117932 3300005844 Unclassified 2336
181 Ga0075368_10120844 3300006042 Bacteria 1085
182 Ga0075368_10271359 3300006042 Bacteria 728
183 Ga0075363_100011747 3300006048 Bacteria 4203
184 Ga0075364_10083153 3300006051 Bacteria 2119
185 Ga0075362_10008211 3300006177 Bacteria 3985
186 Ga0075367_10007898 3300006178 Bacteria 5480
187 Ga0075367_10391512 3300006178 Bacteria 878
188 Ga0075369_10261906 3300006186 Bacteria 804
189 Ga0075366_10000574 3300006195 Bacteria 17235
190 Ga0075366_10009384 3300006195 Bacteria 5460
191 Ga0075366_10024978 3300006195 Bacteria 3487
192 Ga0075366_10063382 3300006195 Bacteria 2197
193 Ga0075366_10165958 3300006195 Bacteria 1339
194 Ga0075366_10192111 3300006195 Bacteria 1241
195 Ga0097621_100008850 3300006237 Bacteria 7277
196 Ga0097621_100022260 3300006237 Bacteria 4918
197 Ga0097621_100469840 3300006237 Bacteria 1136
198 Ga0075370_10000101 3300006353 Bacteria 27175
199 Ga0075370_10003489 3300006353 Bacteria 7492
200 Ga0075370_10009745 3300006353 Bacteria 5002
201 Ga0075370_10013018 3300006353 Bacteria 4413
202 Ga0075370_10068296 3300006353 Bacteria 2030
203 Ga0075370_10100492 3300006353 Bacteria 1674
204 Ga0075370_10298457 3300006353 Bacteria 958
205 Ga0068871_100061610 3300006358 Bacteria 3065
206 Ga0068871_100116623 3300006358 Bacteria 2251
207 Ga0068871_100151494 3300006358 Bacteria 1978
208 Ga0068871_100268515 3300006358 Bacteria 1490
209 Ga0068871_100396258 3300006358 Bacteria 1229
210 Ga0068871_100570288 3300006358 Bacteria 1027
211 Ga0068871_100780628 3300006358 Bacteria 880
212 Ga0068865_100001470 3300006881 Bacteria 13711
213 Ga0068865_100004220 3300006881 Bacteria 8664
214 Ga0068865_100135512 3300006881 Bacteria 1850
215 Ga0068865_101507896 3300006881 Bacteria 603
216 Ga0097620_100039889 3300006931 Bacteria 4712
217 Ga0097620_100492746 3300006931 Unclassified 1321
218 Ga0075435_100617748 3300007076 Bacteria 940
219 Ga0099795_10146531 3300007788 Bacteria 964
220 Ga0105240_10767524 3300009093 Bacteria 1047
221 Ga0111539_11014385 3300009094 Bacteria 965
222 Ga0105245_10045639 3300009098 Bacteria 3914
223 Ga0105245_10053156 3300009098 Bacteria 3635
224 Ga0105245_10147839 3300009098 Bacteria 2218
225 Ga0105247_10295951 3300009101 Bacteria 1121
226 Ga0105243_10009717 3300009148 Bacteria 7326
227 Ga0105243_10107881 3300009148 Bacteria 2323
228 Ga0105241_10310874 3300009174 Bacteria 1356
229 Ga0105242_10028362 3300009176 Bacteria 4456
230 Ga0105242_10133204 3300009176 Bacteria 2148
231 Ga0105242_10698144 3300009176 Bacteria 992
232 Ga0105242_10815350 3300009176 Bacteria 925
233 Ga0105248_10016659 3300009177 Bacteria 8090
234 Ga0105248_10024939 3300009177 Bacteria 6647
235 Ga0105248_10205361 3300009177 Bacteria 2220
236 Ga0105248_10262936 3300009177 Bacteria 1942
237 Ga0105248_10340107 3300009177 Bacteria 1690
238 Ga0105248_10368979 3300009177 Bacteria 1616
239 Ga0105248_10795155 3300009177 Bacteria 1068
240 Ga0105248_11599286 3300009177 Bacteria 738
241 Ga0105237_10737335 3300009545 Bacteria 992
242 Ga0105238_10129652 3300009551 Bacteria 2500
243 Ga0105238_10199888 3300009551 Bacteria 1974
244 Ga0105249_10006697 3300009553 Bacteria 10036
245 Ga0105249_10020193 3300009553 Bacteria 5953
246 Ga0105239_10050731 3300010375 Bacteria 4549
247 Ga0105239_10057462 3300010375 Bacteria 4268
248 Ga0105239_10479709 3300010375 Bacteria 1413
249 Ga0157373_10056085 3300013100 Bacteria 2798
250 Ga0157371_10044279 3300013102 Bacteria 3169
251 Ga0157371_10163818 3300013102 Bacteria 1588
252 Ga0157370_10292270 3300013104 Bacteria 1505
253 Ga0157370_10511963 3300013104 Bacteria 1102
254 Ga0157369_10015460 3300013105 Bacteria 8600
255 Ga0157369_10121995 3300013105 Bacteria 2764
256 Ga0157369_10717871 3300013105 Bacteria 1029
257 Ga0157374_10009658 3300013296 Bacteria 8284
258 Ga0157374_10054250 3300013296 Bacteria 3739
259 Ga0157374_10140338 3300013296 Bacteria 2345
260 Ga0157374_10358854 3300013296 Bacteria 1449
261 Ga0157374_11460756 3300013296 Bacteria 707
262 Ga0157378_10002867 3300013297 Bacteria 15374
263 Ga0157378_10100111 3300013297 Bacteria 2645
264 Ga0157378_10361287 3300013297 Bacteria 1421
265 Ga0157378_10526364 3300013297 Bacteria 1184
266 Ga0157378_10614164 3300013297 Bacteria 1100
267 Ga0163162_10018170 3300013306 Bacteria 6886
268 Ga0163162_10126710 3300013306 Bacteria 2660
269 Ga0163162_10274617 3300013306 Bacteria 1817
270 Ga0163162_10617515 3300013306 Bacteria 1209
271 Ga0163162_11575847 3300013306 Bacteria 749
272 Ga0157372_10156872 3300013307 Bacteria 2629
273 Ga0157372_10694628 3300013307 Bacteria 1184
274 Ga0157375_10005937 3300013308 Bacteria 10642
275 Ga0157375_10138694 3300013308 Bacteria 2557
276 Ga0157375_10683645 3300013308 Bacteria 1181
277 Ga0157375_11002201 3300013308 Bacteria 975
278 Ga0157375_11483675 3300013308 Bacteria 800
279 Ga0163163_10283569 3300014325 Bacteria 1708
280 Ga0157380_10001842 3300014326 Bacteria 14019
281 Ga0157380_10004961 3300014326 Bacteria 9272
282 Ga0157380_10028623 3300014326 Bacteria 4251
283 Ga0157380_11714647 3300014326 Bacteria 686
284 Ga0157377_10041978 3300014745 Bacteria 2539
285 Ga0157377_10514962 3300014745 Bacteria 839
286 Ga0157379_10010369 3300014968 Bacteria 8119
287 Ga0157379_10022863 3300014968 Bacteria 5541
288 Ga0157379_10054527 3300014968 Bacteria 3572
289 Ga0157376_10005027 3300014969 Bacteria 9221
290 Ga0157376_10394781 3300014969 Bacteria 1336
291 Ga0163161_10003912 3300017792 Bacteria 10448
292 Ga0163161_10018887 3300017792 Bacteria 4833
293 Ga0163161_10358088 3300017792 Bacteria 1161
294 Ga0163161_10589607 3300017792 Bacteria 915
295 Ga0213876_10108926 3300021384 Bacteria 1470
296 Ga0207425_1001646 3300025245 Bacteria 8994
297 Ga0209129_1000124 3300025258 Bacteria 133610
298 Ga0209129_1010372 3300025258 Bacteria 2331
299 Ga0209673_1013941 3300025273 Bacteria 3141
300 Ga0209564_1000057 3300025295 Bacteria 340400
301 Ga0209758_1000214 3300025297 Bacteria 126364
302 Ga0209758_1000232 3300025297 Bacteria 117382
303 Ga0209050_1001962 3300025298 Bacteria 19466
304 Ga0207697_10121369 3300025315 Bacteria 1125
305 Ga0207656_10120352 3300025321 Bacteria 1222
306 Ga0207656_10162776 3300025321 Bacteria 1063
307 Ga0207656_10179636 3300025321 Bacteria 1015
308 Ga0207656_10270796 3300025321 Bacteria 836
309 Ga0207682_10032102 3300025893 Bacteria 2110
310 Ga0207682_10157473 3300025893 Bacteria 1027
311 Ga0207682_10212261 3300025893 Bacteria 893
312 Ga0207642_10008108 3300025899 Bacteria 3586
313 Ga0207642_10011248 3300025899 Bacteria 3185
314 Ga0207688_10082590 3300025901 Bacteria 1836
315 Ga0207680_10005603 3300025903 Bacteria 6008
316 Ga0207680_10105518 3300025903 Bacteria 1818
317 Ga0207645_10005684 3300025907 Bacteria 9010
318 Ga0207645_10005861 3300025907 Bacteria 8853
319 Ga0207645_10009034 3300025907 Bacteria 6919
320 Ga0207643_10069703 3300025908 Bacteria 2021
321 Ga0207643_10112001 3300025908 Bacteria 1608
322 Ga0207705_10276060 3300025909 Bacteria 1286
323 Ga0207705_10485534 3300025909 Bacteria 959
324 Ga0207684_10023526 3300025910 Bacteria 5261
325 Ga0207707_11040437 3300025912 Bacteria 670
326 Ga0207662_10002506 3300025918 Bacteria 9229
327 Ga0207662_10095739 3300025918 Bacteria 1833
328 Ga0207657_10051902 3300025919 Bacteria 3562
329 Ga0207657_10084038 3300025919 Bacteria 2669
330 Ga0207657_10128705 3300025919 Bacteria 2077
331 Ga0207649_10225487 3300025920 Bacteria 1337
332 Ga0207649_10229311 3300025920 Bacteria 1327
333 Ga0207652_10693821 3300025921 Bacteria 909
334 Ga0207681_10000205 3300025923 Bacteria 47034
335 Ga0207681_10102559 3300025923 Bacteria 2066
336 Ga0207694_10038457 3300025924 Bacteria 3679
337 Ga0207694_11100775 3300025924 Bacteria 672
338 Ga0207650_10007303 3300025925 Bacteria 7524
339 Ga0207650_10236091 3300025925 Bacteria 1476
340 Ga0207650_10286062 3300025925 Bacteria 1343
341 Ga0207650_10737516 3300025925 Bacteria 833
342 Ga0207650_10802864 3300025925 Bacteria 798
343 Ga0207659_10005215 3300025926 Bacteria 7866
344 Ga0207659_10010457 3300025926 Bacteria 5833
345 Ga0207659_10079490 3300025926 Bacteria 2419
346 Ga0207659_10493104 3300025926 Bacteria 1036
347 Ga0207687_10059961 3300025927 Bacteria 2682
348 Ga0207687_10151931 3300025927 Bacteria 1768
349 Ga0207687_10210576 3300025927 Bacteria 1525
350 Ga0207644_10003975 3300025931 Bacteria 9600
351 Ga0207644_10079813 3300025931 Bacteria 2415
352 Ga0207644_10185223 3300025931 Bacteria 1634
353 Ga0207644_10282877 3300025931 Bacteria 1332
354 Ga0207644_10917312 3300025931 Bacteria 734
355 Ga0207644_10972056 3300025931 Bacteria 712
356 Ga0207690_10759542 3300025932 Bacteria 800
357 Ga0207706_10000933 3300025933 Bacteria 29885
358 Ga0207706_10058975 3300025933 Bacteria 3380
359 Ga0207706_10068601 3300025933 Bacteria 3120
360 Ga0207706_10137030 3300025933 Bacteria 2153
361 Ga0207686_10005743 3300025934 Bacteria 6654
362 Ga0207686_10046007 3300025934 Bacteria 2689
363 Ga0207686_10132229 3300025934 Bacteria 1713
364 Ga0207709_10018850 3300025935 Bacteria 3870
365 Ga0207709_10695097 3300025935 Bacteria 813
366 Ga0207670_10073773 3300025936 Bacteria 2367
367 Ga0207669_10017212 3300025937 Bacteria 3700
368 Ga0207669_10178409 3300025937 Bacteria 1520
369 Ga0207704_10001897 3300025938 Bacteria 9361
370 Ga0207704_10008784 3300025938 Bacteria 4850
371 Ga0207704_10103948 3300025938 Bacteria 1901
372 Ga0207665_10408825 3300025939 Bacteria 1035
373 Ga0207691_10057576 3300025940 Bacteria 3536
374 Ga0207691_10088408 3300025940 Bacteria 2779
375 Ga0207691_10108789 3300025940 Bacteria 2467
376 Ga0207691_10116352 3300025940 Bacteria 2373
377 Ga0207691_10130114 3300025940 Bacteria 2224
378 Ga0207691_10183778 3300025940 Bacteria 1826
379 Ga0207691_10305387 3300025940 Bacteria 1366
380 Ga0207711_10046230 3300025941 Bacteria 3719
381 Ga0207711_10073124 3300025941 Bacteria 2979
382 Ga0207711_10094411 3300025941 Bacteria 2636
383 Ga0207711_10118967 3300025941 Bacteria 2357
384 Ga0207711_10130815 3300025941 Bacteria 2250
385 Ga0207711_10182728 3300025941 Bacteria 1908
386 Ga0207711_11093609 3300025941 Bacteria 738
387 Ga0207689_10000150 3300025942 Bacteria 60037
388 Ga0207689_10004063 3300025942 Bacteria 13296
389 Ga0207689_10009202 3300025942 Bacteria 8543
390 Ga0207689_10015594 3300025942 Bacteria 6436
391 Ga0207689_10241497 3300025942 Bacteria 1493
392 Ga0207679_10140349 3300025945 Bacteria 1952
393 Ga0207679_10254378 3300025945 Bacteria 1495
394 Ga0207679_10267929 3300025945 Bacteria 1459
395 Ga0207679_10277740 3300025945 Bacteria 1435
396 Ga0207679_10403696 3300025945 Bacteria 1203
397 Ga0207679_10431039 3300025945 Bacteria 1166
398 Ga0207679_10646531 3300025945 Bacteria 956
399 Ga0207712_10195996 3300025961 Bacteria 1598
400 Ga0207668_10005035 3300025972 Bacteria 7779
401 Ga0207668_10159731 3300025972 Bacteria 1755
402 Ga0207640_10016633 3300025981 Bacteria 4284
403 Ga0207640_10061385 3300025981 Bacteria 2490
404 Ga0207640_10159840 3300025981 Bacteria 1666
405 Ga0207640_10221543 3300025981 Bacteria 1449
406 Ga0207658_10004115 3300025986 Bacteria 10141
407 Ga0207658_10012891 3300025986 Bacteria 5708
408 Ga0207677_10012436 3300026023 Bacteria 4893
409 Ga0207677_10361780 3300026023 Bacteria 1219
410 Ga0207677_10491281 3300026023 Bacteria 1059
411 Ga0207677_10630202 3300026023 Bacteria 944
412 Ga0207703_10002955 3300026035 Bacteria 14418
413 Ga0207703_10030559 3300026035 Bacteria 4258
414 Ga0207703_10047106 3300026035 Bacteria 3475
415 Ga0207703_11752365 3300026035 Bacteria 597
416 Ga0207639_10053565 3300026041 Bacteria 3079
417 Ga0207639_10097704 3300026041 Bacteria 2365
418 Ga0207639_10340022 3300026041 Bacteria 1338
419 Ga0207678_10002804 3300026067 Bacteria 15808
420 Ga0207678_10002944 3300026067 Bacteria 15425
421 Ga0207708_10026554 3300026075 Bacteria 4384
422 Ga0207702_10046560 3300026078 Bacteria 3652
423 Ga0207702_10329396 3300026078 Bacteria 1456
424 Ga0207702_10460110 3300026078 Bacteria 1236
425 Ga0207641_10003621 3300026088 Bacteria 13635
426 Ga0207641_10053797 3300026088 Bacteria 3414
427 Ga0207641_10303630 3300026088 Bacteria 1508
428 Ga0207641_11304217 3300026088 Bacteria 726
429 Ga0207648_10005311 3300026089 Bacteria 12992
430 Ga0207648_10007556 3300026089 Bacteria 10668
431 Ga0207648_10055085 3300026089 Bacteria 3472
432 Ga0207648_10067687 3300026089 Bacteria 3113
433 Ga0207648_10663180 3300026089 Bacteria 965
434 Ga0207676_10138408 3300026095 Bacteria 2081
435 Ga0207676_10212683 3300026095 Bacteria 1716
436 Ga0207674_10020946 3300026116 Bacteria 7053
437 Ga0207675_100001131 3300026118 Bacteria 26465
438 Ga0207675_100009115 3300026118 Bacteria 9313
439 Ga0207675_100087081 3300026118 Bacteria 2933
440 Ga0207675_100835190 3300026118 Bacteria 936
441 Ga0207683_10064766 3300026121 Bacteria 3222
442 Ga0207683_10076183 3300026121 Bacteria 2970
443 Ga0207683_10118663 3300026121 Bacteria 2373
444 Ga0207683_10251001 3300026121 Bacteria 1615
445 Ga0207683_10410869 3300026121 Bacteria 1246
446 Ga0207683_10438610 3300026121 Unclassified 1204
447 Ga0207683_10463914 3300026121 Bacteria 1168
448 Ga0207698_10007726 3300026142 Bacteria 6747
449 Ga0207698_10016066 3300026142 Bacteria 5035
450 Ga0207698_10028013 3300026142 Bacteria 4010
451 Ga0207698_10053123 3300026142 Bacteria 3108
452 Ga0207698_10054479 3300026142 Bacteria 3077
453 Ga0207698_10289791 3300026142 Bacteria 1519
454 Ga0207698_10716708 3300026142 Bacteria 997
455 Ga0207698_11013974 3300026142 Bacteria 841
456 Ga0209813_10027757 3300027866 Bacteria 1646
457 Ga0209813_10092905 3300027866 Bacteria 1016
458 Ga0268266_10092320 3300028379 Bacteria 2656
459 Ga0268266_10159657 3300028379 Bacteria 2038
460 Ga0268265_10011173 3300028380 Bacteria 6068
461 Ga0268265_10135120 3300028380 Unclassified 2056
462 Ga0268264_10004410 3300028381 Bacteria 12007
463 Ga0268264_10080643 3300028381 Bacteria 2779
464 Ga0268264_10380331 3300028381 Bacteria 1352
465 Ga0268264_10439710 3300028381 Bacteria 1261
466 Ga0307517_10000810 3300028786 Bacteria 53724
467 Ga0307517_10081360 3300028786 Bacteria 2762
468 Ga0307517_10142655 3300028786 Bacteria 1675
469 Ga0307515_10000381 3300028794 Bacteria 108373
470 Ga0307515_10002386 3300028794 Bacteria 40952
471 Ga0307515_10234812 3300028794 Bacteria 1617
472 Ga0307512_10059161 3300030522 Bacteria 2977
473 Ga0307512_10263606 3300030522 Bacteria 843
474 Ga0307513_10004294 3300031456 Bacteria 19052
475 Ga0307513_10026047 3300031456 Bacteria 6753
476 Ga0307513_10275714 3300031456 Bacteria 1462
477 Ga0307513_10485066 3300031456 Bacteria 955
478 Ga0307513_10516057 3300031456 Bacteria 911
479 Ga0307509_10050016 3300031507 Bacteria 4477
480 Ga0307408_100168832 3300031548 Bacteria 1745
481 Ga0307508_10000194 3300031616 Bacteria 73425
482 Ga0307508_10002132 3300031616 Bacteria 21213
483 Ga0307514_10011053 3300031649 Bacteria 7521
484 Ga0307516_10118500 3300031730 Bacteria 2441
485 Ga0307516_10208068 3300031730 Bacteria 1672
486 Ga0307516_10212500 3300031730 Bacteria 1648
487 Ga0307405_10078963 3300031731 Bacteria 2143
488 Ga0307405_10100216 3300031731 Bacteria 1941
489 Ga0307413_10093092 3300031824 Bacteria 1969
490 Ga0307410_10026154 3300031852 Bacteria 3670
491 Ga0307410_11018880 3300031852 Bacteria 715
492 Ga0307406_10027772 3300031901 Bacteria 3413
493 Ga0307406_10146179 3300031901 Bacteria 1680
494 Ga0307407_10270625 3300031903 Bacteria 1172
495 Ga0307412_10012955 3300031911 Bacteria 4876
496 Ga0307412_10022329 3300031911 Bacteria 3878
497 Ga0307409_100393451 3300031995 Bacteria 1321
498 Ga0307409_100630024 3300031995 Bacteria 1064
499 Ga0307409_100644887 3300031995 Bacteria 1052
500 Ga0307416_100070299 3300032002 Bacteria 2902
501 Ga0307416_100181522 3300032002 Bacteria 1973
502 Ga0307414_10055647 3300032004 Bacteria 2771
503 Ga0307411_10002725 3300032005 Bacteria 7925
504 Ga0307411_10032732 3300032005 Bacteria 3216
505 Ga0307415_100471881 3300032126 Bacteria 1090
506 Ga0307507_10068293 3300033179 Bacteria 3244
507 Ga0373928_0008445 3300035084 Bacteria 2000
508 Ga0373929_0044302 3300035085 Bacteria 999
509 Ga0373954_0146455 3300035118 Bacteria 1153
510 Ga0373943_0051007 3300035170 Bacteria 2036
511 Ga0373955_0464001 3300035172 Bacteria 772
512 Ga0373947_0758003 3300035725 Bacteria 662
513 Ga0373947_0800660 3300035725 Bacteria 643
514 Ga0373937_0078199 3300036401 Bacteria 3057
515 Ga0373925_0511525 3300037068 Bacteria 986
516 Ga0395905_0073623 3300037471 Bacteria 3202
517 Ga0436365_1519697 3300039437 Bacteria 1791
518 Ga0451789_1281368 3300041443 Bacteria 916
519 Ga0451791_0319493 3300041451 Bacteria 1145
520 Ga0451793_1115609 3300041452 Bacteria 1591
521 Ga0451795_1067193 3300041456 Bacteria 655
522 Ga0451800_1406008 3300041459 Bacteria 669
523 Ga0451835_0950027 3300041492 Bacteria 752
524 Ga0451839_0760707 3300041496 Bacteria 2250
525 Ga0451847_0835513 3300041503 Bacteria 713
526 Ga0451849_0548321 3300041505 Bacteria 949
527 Ga0451853_2274432 3300041512 Bacteria 757
528 Ga0439455_0008563 3300042012 Bacteria 2195
529 Ga0450894_012294 3300042131 Bacteria 1119
530 Ga0439460_0006452 3300042461 Bacteria 2911
531 Ga0451576_0567890 3300045051 Bacteria 1192
532 Ga0495583_0044197 3300046506 Bacteria 2069
533 Ga0495616_0174567 3300046513 Bacteria 959
534 Ga0495620_0144858 3300046515 Bacteria 928
535 Ga0495631_0094953 3300046518 Bacteria 1284
536 Ga0495632_0003621 3300046519 Bacteria 10864
537 Ga0495632_0011776 3300046519 Bacteria 5090
538 Ga0495632_0175496 3300046519 Bacteria 983
539 Ga0495632_0252601 3300046519 Bacteria 790
540 Ga0495632_0315781 3300046519 Bacteria 691
541 Ga0495643_0036252 3300046522 Bacteria 2711
542 Ga0495648_0118920 3300046524 Bacteria 1424
543 Ga0495648_0170745 3300046524 Bacteria 1115
544 Ga0495645_0244432 3300046543 Bacteria 1196
545 Ga0495668_0066901 3300046616 Bacteria 1977
546 Ga0495611_0043832 3300046648 Bacteria 2001
547 Ga0495625_0006631 3300046660 Bacteria 10274
548 Ga0495625_0146920 3300046660 Bacteria 1587
549 Ga0495635_0353614 3300046663 Bacteria 980
550 Ga0495647_0040042 3300046681 Bacteria 1779
551 Ga0495658_0012994 3300046683 Bacteria 4230
552 Ga0495658_0043733 3300046683 Bacteria 2507
553 Ga0495649_0013683 3300046694 Bacteria 4676
554 Ga0495660_0034709 3300046810 Bacteria 2821
555 Ga0495687_000196 3300047443 Bacteria 87053
556 Ga0495687_022632 3300047443 Bacteria 3013
557 Ga0495687_032090 3300047443 Bacteria 2402
558 Ga0495686_0341365 3300047472 Bacteria 816
559 Ga0496100_0123007 3300048903 Bacteria 1818
560 Ga0496101_0617782 3300048904 Bacteria 857
561 Ga0496104_0127565 3300048907 Bacteria 2443
562 Ga0496104_1116472 3300048907 Bacteria 692
563 Ga0496105_0392841 3300048908 Bacteria 1102
564 Ga0496105_0450813 3300048908 Bacteria 1016
565 Ga0496106_0072734 3300048909 Bacteria 2629
566 Ga0496107_0009370 3300048910 Bacteria 6788
567 Ga0496108_0243780 3300048911 Bacteria 1563
568 Ga0496109_0028870 3300048912 Bacteria 4966
569 Ga0496109_0627952 3300048912 Bacteria 1011
570 Ga0496110_0230701 3300048913 Bacteria 1684
571 Ga0496110_0761969 3300048913 Bacteria 871
572 Ga0496111_0152684 3300048914 Bacteria 1713
573 Ga0496112_0541582 3300048915 Bacteria 1098
574 Ga0496113_0572087 3300048916 Bacteria 906
575 Ga0496114_0062115 3300048917 Bacteria 3126
576 Ga0496114_0111742 3300048917 Bacteria 2342
577 Ga0496115_0283821 3300048918 Bacteria 1359
578 Ga0501043_0000004 3300049579 Bacteria 291085
579 Ga0501046_0000050 3300049580 Bacteria 134922
580 Ga0501047_0000012 3300049581 Bacteria 368824
581 Ga0501047_0078376 3300049581 Bacteria 3177
582 Ga0501048_0004275 3300049582 Bacteria 10882
583 Ga0501257_068131 3300049686 Bacteria 906
584 Ga0501262_039130 3300049759 Bacteria 704
585 Ga0501044_0217344 3300049823 Bacteria 1863
586 Ga0501045_0049296 3300049824 Bacteria 3070
587 nmdc:mga03683_40529_c1 3300050489 Bacteria 1910
588 nmdc:mga03n38_5373_c1 3300050490 Bacteria 4354
589 nmdc:mga0k408_1682_c1 3300050493 Bacteria 11938
590 nmdc:mga0k408_16862_c1 3300050493 Bacteria 4061
591 nmdc:mga0k408_190792_c1 3300050493 Bacteria 1223
592 nmdc:mga0k408_201322_c1 3300050493 Bacteria 1189
593 nmdc:mga0k408_243127_c1 3300050493 Bacteria 1075
594 nmdc:mga0k408_45759_c1 3300050493 Bacteria 2526
595 nmdc:mga0k408_59608_c1 3300050493 Bacteria 2218
596 nmdc:mga0k408_695_c1 3300050493 Bacteria 18463
597 nmdc:mga0k408_6998_c1 3300050493 Bacteria 6018
598 nmdc:mga06z11_104541_c1 3300050494 Bacteria 1559
599 nmdc:mga06z11_156159_c1 3300050494 Bacteria 1301
600 nmdc:mga04h51_38905_c1 3300050495 Bacteria 1542
601 nmdc:mga07m45_1045_c1 3300050496 Bacteria 12330
602 nmdc:mga07m45_185787_c1 3300050496 Bacteria 1209
603 nmdc:mga07m45_22889_c1 3300050496 Bacteria 3413
604 nmdc:mga07m45_24407_c1 3300050496 Bacteria 3312
605 nmdc:mga07m45_349480_c1 3300050496 Bacteria 859
606 nmdc:mga07m45_54386_c1 3300050496 Bacteria 2263
607 nmdc:mga08y16_471897_c1 3300050511 Bacteria 1277
608 nmdc:mga0n895_103710_c1 3300050512 Bacteria 2855
609 nmdc:mga0sz30_123221_c1 3300050516 Bacteria 1140
610 nmdc:mga0sz30_52910_c1 3300050516 Bacteria 1724
611 Ga0495601_0373953 3300053077 Bacteria 925
612 Ga0495595_0037426 3300053084 Bacteria 2206
613 Ga0500643_043685 3300053087 Bacteria 1306
614 Ga0500651_0080479 3300053093 Bacteria 2017
615 Ga0500651_0336097 3300053093 Bacteria 860
616 Ga0500651_0486450 3300053093 Bacteria 682
617 Ga0500562_025890 3300053108 Bacteria 1537
618 Ga0500642_0002746 3300053130 Bacteria 5212
619 Ga0500642_0032574 3300053130 Bacteria 2188
620 Ga0500652_000155 3300053131 Bacteria 26280
621 Ga0500658_0003329 3300053134 Bacteria 6093
622 Ga0500658_0056441 3300053134 Bacteria 1620
623 Ga0500568_0018673 3300053139 Bacteria 3028
624 Ga0500622_0000423 3300053156 Bacteria 40034
625 Ga0500627_0182952 3300053158 Bacteria 943
626 Ga0500570_124659 3300053724 Bacteria 999
627 Ga0500587_001023 3300053739 Bacteria 3789

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025918 Ga0207662_10095739 Ga0207662_100957392 161
2 3300005367 Ga0070667_100264840 Ga0070667_1002648402 165
3 3300042461 Ga0439460_0006452 Ga0439460_0006452_508_1056 166
4 3300005331 Ga0070670_100212401 Ga0070670_1002124013 168
5 3300005355 Ga0070671_100031094 Ga0070671_1000310945 168
6 3300005564 Ga0070664_100614455 Ga0070664_1006144552 168
7 3300005618 Ga0068864_100092381 Ga0068864_1000923811 168
8 3300005841 Ga0068863_100469384 Ga0068863_1004693842 168
9 3300006237 Ga0097621_100469840 Ga0097621_1004698402 168
10 3300006358 Ga0068871_100780628 Ga0068871_1007806282 168
11 3300013296 Ga0157374_10358854 Ga0157374_103588543 168
12 3300025909 Ga0207705_10485534 Ga0207705_104855342 168
13 3300025945 Ga0207679_10431039 Ga0207679_104310392 168
14 3300026023 Ga0207677_10491281 Ga0207677_104912812 168
15 3300026067 Ga0207678_10002804 Ga0207678_1000280412 168
16 3300026095 Ga0207676_10138408 Ga0207676_101384083 168
17 3300026121 Ga0207683_10118663 Ga0207683_101186633 168
18 3300046515 Ga0495620_0144858 Ga0495620_0144858_98_643 168
19 3300048912 Ga0496109_0627952 Ga0496109_0627952_74_619 168
20 3300005330 Ga0070690_100057629 Ga0070690_1000576294 169
21 3300005334 Ga0068869_100018976 Ga0068869_1000189762 169
22 3300005338 Ga0068868_100780116 Ga0068868_1007801162 169
23 3300005340 Ga0070689_100056678 Ga0070689_1000566782 169
24 3300005341 Ga0070691_10006362 Ga0070691_100063624 169
25 3300005343 Ga0070687_100387055 Ga0070687_1003870551 169
26 3300005345 Ga0070692_10176509 Ga0070692_101765091 169
27 3300005438 Ga0070701_10005622 Ga0070701_100056223 169
28 3300005441 Ga0070700_100003632 Ga0070700_1000036325 169
29 3300005444 Ga0070694_100099115 Ga0070694_1000991152 169
30 3300005458 Ga0070681_10277226 Ga0070681_102772261 169
31 3300005459 Ga0068867_100010500 Ga0068867_1000105004 169
32 3300005466 Ga0070685_10590976 Ga0070685_105909762 169
33 3300005544 Ga0070686_100010433 Ga0070686_1000104334 169
34 3300005546 Ga0070696_100224312 Ga0070696_1002243122 169
35 3300005546 Ga0070696_100687959 Ga0070696_1006879592 169
36 3300005547 Ga0070693_100033937 Ga0070693_1000339372 169
37 3300005549 Ga0070704_100034645 Ga0070704_1000346454 169
38 3300005615 Ga0070702_100002012 Ga0070702_1000020125 169
39 3300005617 Ga0068859_100492687 Ga0068859_1004926871 169
40 3300005718 Ga0068866_10006667 Ga0068866_100066674 169
41 3300005719 Ga0068861_100014498 Ga0068861_1000144984 169
42 3300005840 Ga0068870_10107341 Ga0068870_101073412 169
43 3300005842 Ga0068858_100036965 Ga0068858_1000369656 169
44 3300005843 Ga0068860_100499385 Ga0068860_1004993851 169
45 3300005844 Ga0068862_100117932 Ga0068862_1001179324 169
46 3300006237 Ga0097621_100008850 Ga0097621_1000088504 169
47 3300006358 Ga0068871_100151494 Ga0068871_1001514941 169
48 3300006881 Ga0068865_100004220 Ga0068865_1000042205 169
49 3300006931 Ga0097620_100492746 Ga0097620_1004927461 169
50 3300009098 Ga0105245_10053156 Ga0105245_100531563 169
51 3300009148 Ga0105243_10009717 Ga0105243_100097176 169
52 3300009176 Ga0105242_10028362 Ga0105242_100283624 169
53 3300009177 Ga0105248_10262936 Ga0105248_102629361 169
54 3300009551 Ga0105238_10199888 Ga0105238_101998881 169
55 3300009553 Ga0105249_10020193 Ga0105249_100201934 169
56 3300013297 Ga0157378_10002867 Ga0157378_100028672 169
57 3300013306 Ga0163162_10126710 Ga0163162_101267104 169
58 3300013308 Ga0157375_11483675 Ga0157375_114836752 169
59 3300014326 Ga0157380_10001842 Ga0157380_100018427 169
60 3300025899 Ga0207642_10008108 Ga0207642_100081083 169
61 3300025908 Ga0207643_10112001 Ga0207643_101120012 169
62 3300025912 Ga0207707_11040437 Ga0207707_110404371 169
63 3300025927 Ga0207687_10210576 Ga0207687_102105762 169
64 3300025934 Ga0207686_10005743 Ga0207686_100057434 169
65 3300025935 Ga0207709_10018850 Ga0207709_100188501 169
66 3300025936 Ga0207670_10073773 Ga0207670_100737734 169
67 3300025938 Ga0207704_10008784 Ga0207704_100087842 169
68 3300025941 Ga0207711_10182728 Ga0207711_101827284 169
69 3300025942 Ga0207689_10009202 Ga0207689_100092024 169
70 3300026035 Ga0207703_11752365 Ga0207703_117523651 169
71 3300026089 Ga0207648_10007556 Ga0207648_100075565 169
72 3300026118 Ga0207675_100009115 Ga0207675_1000091158 169
73 3300028380 Ga0268265_10135120 Ga0268265_101351204 169
74 3300028381 Ga0268264_10439710 Ga0268264_104397102 169
75 3300031901 Ga0307406_10027772 Ga0307406_100277725 169
76 3300031995 Ga0307409_100644887 Ga0307409_1006448872 169
77 3300032005 Ga0307411_10002725 Ga0307411_100027252 169
78 3300003316 rootH1_10065105 rootH1_100651051 170
79 3300003322 rootL2_10016479 rootL2_100164792 170
80 3300005445 Ga0070708_100156079 Ga0070708_1001560793 170
81 3300005467 Ga0070706_100001400 Ga0070706_10000140012 170
82 3300005468 Ga0070707_100024364 Ga0070707_1000243644 170
83 3300005518 Ga0070699_100067925 Ga0070699_1000679253 170
84 3300006178 Ga0075367_10007898 Ga0075367_100078984 170
85 3300006353 Ga0075370_10009745 Ga0075370_100097456 170
86 3300006353 Ga0075370_10068296 Ga0075370_100682963 170
87 3300007076 Ga0075435_100617748 Ga0075435_1006177481 170
88 3300025910 Ga0207684_10023526 Ga0207684_100235263 170
89 3300050493 nmdc:mga0k408_59608_c1 nmdc:mga0k408_59608_c1_1640_2188 170
90 3300050496 nmdc:mga07m45_24407_c1 nmdc:mga07m45_24407_c1_629_1234 170
91 3300050516 nmdc:mga0sz30_52910_c1 nmdc:mga0sz30_52910_c1_888_1469 170
92 3300050496 nmdc:mga07m45_54386_c1 nmdc:mga07m45_54386_c1_605_1147 171
93 3300005843 Ga0068860_100038970 Ga0068860_1000389702 174
94 3300028381 Ga0268264_10380331 Ga0268264_103803312 174
95 3300042131 Ga0450894_012294 Ga0450894_012294_198_740 174
96 3300049581 Ga0501047_0078376 Ga0501047_0078376_2097_2627 174
97 3300049823 Ga0501044_0217344 Ga0501044_0217344_1162_1692 174
98 3300003316 rootH1_10008702 rootH1_100087022 175
99 3300005327 Ga0070658_10102909 Ga0070658_101029092 175
100 3300005329 Ga0070683_100005352 Ga0070683_1000053527 175
101 3300005331 Ga0070670_100093239 Ga0070670_1000932393 175
102 3300005339 Ga0070660_100068835 Ga0070660_1000688354 175
103 3300005355 Ga0070671_100080213 Ga0070671_1000802133 175
104 3300005355 Ga0070671_101107475 Ga0070671_1011074751 175
105 3300005366 Ga0070659_100305056 Ga0070659_1003050562 175
106 3300005456 Ga0070678_100369736 Ga0070678_1003697362 175
107 3300005535 Ga0070684_100127611 Ga0070684_1001276111 175
108 3300005539 Ga0068853_100132036 Ga0068853_1001320363 175
109 3300005547 Ga0070693_100029302 Ga0070693_1000293023 175
110 3300005548 Ga0070665_100078999 Ga0070665_1000789994 175
111 3300005564 Ga0070664_100055141 Ga0070664_1000551412 175
112 3300005578 Ga0068854_100027581 Ga0068854_1000275814 175
113 3300005614 Ga0068856_100004035 Ga0068856_1000040357 175
114 3300005616 Ga0068852_100139459 Ga0068852_1001394593 175
115 3300005834 Ga0068851_10020198 Ga0068851_100201986 175
116 3300005841 Ga0068863_100067310 Ga0068863_1000673103 175
117 3300005843 Ga0068860_100176947 Ga0068860_1001769474 175
118 3300006195 Ga0075366_10165958 Ga0075366_101659583 175
119 3300006881 Ga0068865_100135512 Ga0068865_1001355123 175
120 3300007788 Ga0099795_10146531 Ga0099795_101465312 175
121 3300009093 Ga0105240_10767524 Ga0105240_107675242 175
122 3300009545 Ga0105237_10737335 Ga0105237_107373352 175
123 3300009551 Ga0105238_10129652 Ga0105238_101296523 175
124 3300013100 Ga0157373_10056085 Ga0157373_100560852 175
125 3300013102 Ga0157371_10044279 Ga0157371_100442793 175
126 3300013105 Ga0157369_10015460 Ga0157369_100154602 175
127 3300013296 Ga0157374_10140338 Ga0157374_101403382 175
128 3300013297 Ga0157378_10361287 Ga0157378_103612873 175
129 3300013306 Ga0163162_10617515 Ga0163162_106175152 175
130 3300013307 Ga0157372_10694628 Ga0157372_106946282 175
131 3300013308 Ga0157375_10138694 Ga0157375_101386943 175
132 3300025321 Ga0207656_10120352 Ga0207656_101203522 175
133 3300025919 Ga0207657_10051902 Ga0207657_100519021 175
134 3300025920 Ga0207649_10229311 Ga0207649_102293111 175
135 3300025924 Ga0207694_10038457 Ga0207694_100384573 175
136 3300025925 Ga0207650_10286062 Ga0207650_102860622 175
137 3300025931 Ga0207644_10282877 Ga0207644_102828772 175
138 3300025931 Ga0207644_10972056 Ga0207644_109720561 175
139 3300025945 Ga0207679_10277740 Ga0207679_102777403 175
140 3300025981 Ga0207640_10159840 Ga0207640_101598403 175
141 3300026041 Ga0207639_10053565 Ga0207639_100535653 175
142 3300026078 Ga0207702_10046560 Ga0207702_100465607 175
143 3300026088 Ga0207641_10053797 Ga0207641_100537973 175
144 3300026116 Ga0207674_10020946 Ga0207674_100209467 175
145 3300026142 Ga0207698_10007726 Ga0207698_100077261 175
146 3300028379 Ga0268266_10159657 Ga0268266_101596572 175
147 3300028794 Ga0307515_10234812 Ga0307515_102348123 175
148 3300046524 Ga0495648_0118920 Ga0495648_0118920_65_604 175
149 iso_pu_bacteria 2585428062 2587754506 175
150 iso_pu_bacteria 2643221592 2643972552 175
151 iso_pu_bacteria 2643221625 2644138440 175
152 iso_pu_bacteria 2643221648 2644273060 175
153 iso_pu_bacteria 2643221654 2644302118 175
154 3300005288 Ga0065714_10083810 Ga0065714_100838103 176
155 3300021384 Ga0213876_10108926 Ga0213876_101089262 176
156 3300031548 Ga0307408_100168832 Ga0307408_1001688322 176
157 3300031731 Ga0307405_10100216 Ga0307405_101002163 176
158 3300031911 Ga0307412_10012955 Ga0307412_100129553 176
159 3300031995 Ga0307409_100393451 Ga0307409_1003934513 176
160 3300032126 Ga0307415_100471881 Ga0307415_1004718812 176
161 3300037471 Ga0395905_0073623 Ga0395905_0073623_2237_2788 176
162 3300039437 Ga0436365_1519697 Ga0436365_1519697_867_1409 176
163 3300042012 Ga0439455_0008563 Ga0439455_0008563_1401_1961 176
164 iso_pu_bacteria 2585428057 2587727832 176
165 iso_pu_bacteria 2585428058 2587733853 176
166 3300005327 Ga0070658_10549331 Ga0070658_105493311 177
167 3300005328 Ga0070676_10003406 Ga0070676_100034064 177
168 3300005328 Ga0070676_10251400 Ga0070676_102514002 177
169 3300005330 Ga0070690_100008781 Ga0070690_1000087815 177
170 3300005331 Ga0070670_100009851 Ga0070670_1000098517 177
171 3300005331 Ga0070670_100022200 Ga0070670_1000222003 177
172 3300005331 Ga0070670_100559691 Ga0070670_1005596912 177
173 3300005331 Ga0070670_100634621 Ga0070670_1006346212 177
174 3300005331 Ga0070670_100837947 Ga0070670_1008379471 177
175 3300005334 Ga0068869_100069759 Ga0068869_1000697593 177
176 3300005334 Ga0068869_100247077 Ga0068869_1002470773 177
177 3300005335 Ga0070666_10007624 Ga0070666_100076246 177
178 3300005335 Ga0070666_10113018 Ga0070666_101130184 177
179 3300005338 Ga0068868_100001157 Ga0068868_1000011577 177
180 3300005338 Ga0068868_100020570 Ga0068868_1000205707 177
181 3300005338 Ga0068868_100489457 Ga0068868_1004894572 177
182 3300005339 Ga0070660_100469025 Ga0070660_1004690252 177
183 3300005340 Ga0070689_100158102 Ga0070689_1001581023 177
184 3300005343 Ga0070687_100001572 Ga0070687_10000157210 177
185 3300005344 Ga0070661_100332441 Ga0070661_1003324412 177
186 3300005345 Ga0070692_10158748 Ga0070692_101587482 177
187 3300005347 Ga0070668_100003697 Ga0070668_1000036977 177
188 3300005353 Ga0070669_100001896 Ga0070669_10000189610 177
189 3300005353 Ga0070669_100076757 Ga0070669_1000767573 177
190 3300005354 Ga0070675_100001801 Ga0070675_1000018016 177
191 3300005354 Ga0070675_100015725 Ga0070675_1000157254 177
192 3300005354 Ga0070675_100101108 Ga0070675_1001011083 177
193 3300005354 Ga0070675_100300711 Ga0070675_1003007112 177
194 3300005354 Ga0070675_100641931 Ga0070675_1006419312 177
195 3300005355 Ga0070671_100006533 Ga0070671_1000065332 177
196 3300005355 Ga0070671_100148544 Ga0070671_1001485443 177
197 3300005355 Ga0070671_100299367 Ga0070671_1002993672 177
198 3300005356 Ga0070674_100027973 Ga0070674_1000279734 177
199 3300005356 Ga0070674_100362131 Ga0070674_1003621312 177
200 3300005356 Ga0070674_100567373 Ga0070674_1005673732 177
201 3300005364 Ga0070673_100125273 Ga0070673_1001252733 177
202 3300005365 Ga0070688_100587624 Ga0070688_1005876241 177
203 3300005366 Ga0070659_101089857 Ga0070659_1010898571 177
204 3300005367 Ga0070667_100006750 Ga0070667_10000675011 177
205 3300005367 Ga0070667_100088937 Ga0070667_1000889373 177
206 3300005438 Ga0070701_10212132 Ga0070701_102121322 177
207 3300005441 Ga0070700_100049456 Ga0070700_1000494564 177
208 3300005441 Ga0070700_100340640 Ga0070700_1003406402 177
209 3300005455 Ga0070663_100315532 Ga0070663_1003155321 177
210 3300005456 Ga0070678_100046649 Ga0070678_1000466493 177
211 3300005456 Ga0070678_100084262 Ga0070678_1000842622 177
212 3300005456 Ga0070678_100278890 Ga0070678_1002788902 177
213 3300005456 Ga0070678_100324632 Ga0070678_1003246322 177
214 3300005457 Ga0070662_100000867 Ga0070662_1000008679 177
215 3300005457 Ga0070662_100033229 Ga0070662_1000332293 177
216 3300005457 Ga0070662_100110025 Ga0070662_1001100252 177
217 3300005457 Ga0070662_100110273 Ga0070662_1001102733 177
218 3300005457 Ga0070662_100961128 Ga0070662_1009611281 177
219 3300005459 Ga0068867_100027068 Ga0068867_1000270684 177
220 3300005459 Ga0068867_100088043 Ga0068867_1000880434 177
221 3300005535 Ga0070684_100027307 Ga0070684_1000273076 177
222 3300005539 Ga0068853_100002880 Ga0068853_1000028807 177
223 3300005539 Ga0068853_100275663 Ga0068853_1002756633 177
224 3300005539 Ga0068853_100591297 Ga0068853_1005912971 177
225 3300005543 Ga0070672_100049097 Ga0070672_1000490973 177
226 3300005543 Ga0070672_100052344 Ga0070672_1000523443 177
227 3300005543 Ga0070672_100098868 Ga0070672_1000988683 177
228 3300005543 Ga0070672_100150560 Ga0070672_1001505603 177
229 3300005543 Ga0070672_100474677 Ga0070672_1004746772 177
230 3300005545 Ga0070695_100369725 Ga0070695_1003697252 177
231 3300005546 Ga0070696_100570291 Ga0070696_1005702911 177
232 3300005547 Ga0070693_100467100 Ga0070693_1004671002 177
233 3300005548 Ga0070665_100672796 Ga0070665_1006727962 177
234 3300005563 Ga0068855_100051204 Ga0068855_1000512046 177
235 3300005564 Ga0070664_100034883 Ga0070664_1000348833 177
236 3300005564 Ga0070664_100115387 Ga0070664_1001153873 177
237 3300005564 Ga0070664_100362793 Ga0070664_1003627933 177
238 3300005564 Ga0070664_100528380 Ga0070664_1005283802 177
239 3300005564 Ga0070664_100821690 Ga0070664_1008216901 177
240 3300005577 Ga0068857_101497336 Ga0068857_1014973361 177
241 3300005578 Ga0068854_100247616 Ga0068854_1002476163 177
242 3300005578 Ga0068854_100304415 Ga0068854_1003044152 177
243 3300005615 Ga0070702_100014791 Ga0070702_1000147912 177
244 3300005616 Ga0068852_100048509 Ga0068852_1000485094 177
245 3300005616 Ga0068852_100054887 Ga0068852_1000548873 177
246 3300005616 Ga0068852_100072682 Ga0068852_1000726823 177
247 3300005616 Ga0068852_100189947 Ga0068852_1001899473 177
248 3300005616 Ga0068852_100447083 Ga0068852_1004470832 177
249 3300005617 Ga0068859_100039890 Ga0068859_1000398904 177
250 3300005618 Ga0068864_100024340 Ga0068864_1000243403 177
251 3300005618 Ga0068864_100130063 Ga0068864_1001300632 177
252 3300005718 Ga0068866_10024416 Ga0068866_100244163 177
253 3300005719 Ga0068861_100003855 Ga0068861_10000385511 177
254 3300005719 Ga0068861_100062057 Ga0068861_1000620573 177
255 3300005834 Ga0068851_10009705 Ga0068851_100097056 177
256 3300005841 Ga0068863_100058398 Ga0068863_1000583983 177
257 3300005841 Ga0068863_100195703 Ga0068863_1001957032 177
258 3300005841 Ga0068863_100323282 Ga0068863_1003232822 177
259 3300005841 Ga0068863_100570434 Ga0068863_1005704342 177
260 3300005842 Ga0068858_100010960 Ga0068858_1000109603 177
261 3300005842 Ga0068858_100160326 Ga0068858_1001603262 177
262 3300005843 Ga0068860_100003734 Ga0068860_1000037348 177
263 3300005844 Ga0068862_100032968 Ga0068862_1000329684 177
264 3300006237 Ga0097621_100022260 Ga0097621_1000222602 177
265 3300006358 Ga0068871_100061610 Ga0068871_1000616103 177
266 3300006358 Ga0068871_100116623 Ga0068871_1001166233 177
267 3300006358 Ga0068871_100268515 Ga0068871_1002685152 177
268 3300006358 Ga0068871_100396258 Ga0068871_1003962581 177
269 3300006358 Ga0068871_100570288 Ga0068871_1005702882 177
270 3300006881 Ga0068865_100001470 Ga0068865_10000147010 177
271 3300006881 Ga0068865_101507896 Ga0068865_1015078961 177
272 3300006931 Ga0097620_100039889 Ga0097620_1000398894 177
273 3300009094 Ga0111539_11014385 Ga0111539_110143851 177
274 3300009098 Ga0105245_10045639 Ga0105245_100456393 177
275 3300009101 Ga0105247_10295951 Ga0105247_102959512 177
276 3300009174 Ga0105241_10310874 Ga0105241_103108742 177
277 3300009176 Ga0105242_10133204 Ga0105242_101332043 177
278 3300009176 Ga0105242_10815350 Ga0105242_108153502 177
279 3300009177 Ga0105248_10016659 Ga0105248_100166593 177
280 3300009177 Ga0105248_10024939 Ga0105248_100249396 177
281 3300009177 Ga0105248_10205361 Ga0105248_102053613 177
282 3300009177 Ga0105248_10340107 Ga0105248_103401072 177
283 3300009177 Ga0105248_10368979 Ga0105248_103689792 177
284 3300009177 Ga0105248_11599286 Ga0105248_115992861 177
285 3300009553 Ga0105249_10006697 Ga0105249_100066977 177
286 3300010375 Ga0105239_10057462 Ga0105239_100574623 177
287 3300013102 Ga0157371_10163818 Ga0157371_101638182 177
288 3300013104 Ga0157370_10292270 Ga0157370_102922703 177
289 3300013104 Ga0157370_10511963 Ga0157370_105119632 177
290 3300013105 Ga0157369_10121995 Ga0157369_101219952 177
291 3300013105 Ga0157369_10717871 Ga0157369_107178712 177
292 3300013296 Ga0157374_10009658 Ga0157374_100096587 177
293 3300013296 Ga0157374_10054250 Ga0157374_100542505 177
294 3300013296 Ga0157374_11460756 Ga0157374_114607562 177
295 3300013297 Ga0157378_10100111 Ga0157378_101001113 177
296 3300013306 Ga0163162_10018170 Ga0163162_100181704 177
297 3300013306 Ga0163162_10274617 Ga0163162_102746172 177
298 3300013307 Ga0157372_10156872 Ga0157372_101568723 177
299 3300013308 Ga0157375_10005937 Ga0157375_1000593714 177
300 3300013308 Ga0157375_10683645 Ga0157375_106836452 177
301 3300013308 Ga0157375_11002201 Ga0157375_110022012 177
302 3300014325 Ga0163163_10283569 Ga0163163_102835693 177
303 3300014326 Ga0157380_10004961 Ga0157380_1000496111 177
304 3300014326 Ga0157380_10028623 Ga0157380_100286233 177
305 3300014326 Ga0157380_11714647 Ga0157380_117146471 177
306 3300014745 Ga0157377_10041978 Ga0157377_100419783 177
307 3300014745 Ga0157377_10514962 Ga0157377_105149622 177
308 3300014968 Ga0157379_10010369 Ga0157379_100103693 177
309 3300014968 Ga0157379_10022863 Ga0157379_100228633 177
310 3300014968 Ga0157379_10054527 Ga0157379_100545273 177
311 3300014969 Ga0157376_10005027 Ga0157376_100050274 177
312 3300014969 Ga0157376_10394781 Ga0157376_103947812 177
313 3300017792 Ga0163161_10003912 Ga0163161_100039127 177
314 3300017792 Ga0163161_10018887 Ga0163161_100188874 177
315 3300017792 Ga0163161_10358088 Ga0163161_103580882 177
316 3300025315 Ga0207697_10121369 Ga0207697_101213692 177
317 3300025321 Ga0207656_10179636 Ga0207656_101796362 177
318 3300025321 Ga0207656_10270796 Ga0207656_102707962 177
319 3300025893 Ga0207682_10032102 Ga0207682_100321022 177
320 3300025893 Ga0207682_10157473 Ga0207682_101574732 177
321 3300025899 Ga0207642_10011248 Ga0207642_100112484 177
322 3300025901 Ga0207688_10082590 Ga0207688_100825903 177
323 3300025903 Ga0207680_10005603 Ga0207680_100056033 177
324 3300025903 Ga0207680_10105518 Ga0207680_101055182 177
325 3300025907 Ga0207645_10005684 Ga0207645_100056846 177
326 3300025907 Ga0207645_10009034 Ga0207645_100090347 177
327 3300025908 Ga0207643_10069703 Ga0207643_100697034 177
328 3300025909 Ga0207705_10276060 Ga0207705_102760602 177
329 3300025918 Ga0207662_10002506 Ga0207662_100025065 177
330 3300025919 Ga0207657_10084038 Ga0207657_100840383 177
331 3300025919 Ga0207657_10128705 Ga0207657_101287053 177
332 3300025920 Ga0207649_10225487 Ga0207649_102254873 177
333 3300025921 Ga0207652_10693821 Ga0207652_106938211 177
334 3300025923 Ga0207681_10000205 Ga0207681_1000020535 177
335 3300025923 Ga0207681_10102559 Ga0207681_101025592 177
336 3300025924 Ga0207694_11100775 Ga0207694_111007751 177
337 3300025925 Ga0207650_10007303 Ga0207650_100073038 177
338 3300025925 Ga0207650_10737516 Ga0207650_107375162 177
339 3300025925 Ga0207650_10802864 Ga0207650_108028641 177
340 3300025926 Ga0207659_10005215 Ga0207659_100052157 177
341 3300025926 Ga0207659_10010457 Ga0207659_100104574 177
342 3300025926 Ga0207659_10079490 Ga0207659_100794903 177
343 3300025926 Ga0207659_10493104 Ga0207659_104931042 177
344 3300025927 Ga0207687_10059961 Ga0207687_100599611 177
345 3300025931 Ga0207644_10003975 Ga0207644_100039754 177
346 3300025931 Ga0207644_10079813 Ga0207644_100798133 177
347 3300025931 Ga0207644_10917312 Ga0207644_109173122 177
348 3300025932 Ga0207690_10759542 Ga0207690_107595422 177
349 3300025933 Ga0207706_10000933 Ga0207706_1000093326 177
350 3300025933 Ga0207706_10058975 Ga0207706_100589754 177
351 3300025933 Ga0207706_10068601 Ga0207706_100686012 177
352 3300025933 Ga0207706_10137030 Ga0207706_101370303 177
353 3300025934 Ga0207686_10046007 Ga0207686_100460073 177
354 3300025934 Ga0207686_10132229 Ga0207686_101322293 177
355 3300025935 Ga0207709_10695097 Ga0207709_106950972 177
356 3300025937 Ga0207669_10017212 Ga0207669_100172124 177
357 3300025937 Ga0207669_10178409 Ga0207669_101784092 177
358 3300025938 Ga0207704_10001897 Ga0207704_100018973 177
359 3300025938 Ga0207704_10103948 Ga0207704_101039483 177
360 3300025939 Ga0207665_10408825 Ga0207665_104088252 177
361 3300025940 Ga0207691_10057576 Ga0207691_100575763 177
362 3300025940 Ga0207691_10088408 Ga0207691_100884083 177
363 3300025940 Ga0207691_10108789 Ga0207691_101087892 177
364 3300025940 Ga0207691_10116352 Ga0207691_101163522 177
365 3300025940 Ga0207691_10130114 Ga0207691_101301142 177
366 3300025940 Ga0207691_10305387 Ga0207691_103053871 177
367 3300025941 Ga0207711_10046230 Ga0207711_100462304 177
368 3300025941 Ga0207711_10073124 Ga0207711_100731244 177
369 3300025941 Ga0207711_10094411 Ga0207711_100944114 177
370 3300025941 Ga0207711_10118967 Ga0207711_101189673 177
371 3300025941 Ga0207711_10130815 Ga0207711_101308153 177
372 3300025941 Ga0207711_11093609 Ga0207711_110936092 177
373 3300025942 Ga0207689_10000150 Ga0207689_1000015053 177
374 3300025942 Ga0207689_10004063 Ga0207689_100040633 177
375 3300025945 Ga0207679_10140349 Ga0207679_101403492 177
376 3300025945 Ga0207679_10254378 Ga0207679_102543783 177
377 3300025945 Ga0207679_10267929 Ga0207679_102679293 177
378 3300025945 Ga0207679_10646531 Ga0207679_106465311 177
379 3300025961 Ga0207712_10195996 Ga0207712_101959963 177
380 3300025972 Ga0207668_10005035 Ga0207668_100050358 177
381 3300025972 Ga0207668_10159731 Ga0207668_101597313 177
382 3300025981 Ga0207640_10061385 Ga0207640_100613853 177
383 3300025981 Ga0207640_10221543 Ga0207640_102215433 177
384 3300025986 Ga0207658_10012891 Ga0207658_100128914 177
385 3300026023 Ga0207677_10012436 Ga0207677_100124365 177
386 3300026035 Ga0207703_10002955 Ga0207703_1000295510 177
387 3300026035 Ga0207703_10030559 Ga0207703_100305595 177
388 3300026035 Ga0207703_10047106 Ga0207703_100471064 177
389 3300026041 Ga0207639_10097704 Ga0207639_100977043 177
390 3300026041 Ga0207639_10340022 Ga0207639_103400222 177
391 3300026067 Ga0207678_10002944 Ga0207678_1000294410 177
392 3300026075 Ga0207708_10026554 Ga0207708_100265544 177
393 3300026078 Ga0207702_10329396 Ga0207702_103293963 177
394 3300026088 Ga0207641_10003621 Ga0207641_100036217 177
395 3300026088 Ga0207641_10303630 Ga0207641_103036302 177
396 3300026088 Ga0207641_11304217 Ga0207641_113042171 177
397 3300026089 Ga0207648_10005311 Ga0207648_100053115 177
398 3300026095 Ga0207676_10212683 Ga0207676_102126833 177
399 3300026118 Ga0207675_100001131 Ga0207675_10000113130 177
400 3300026118 Ga0207675_100087081 Ga0207675_1000870814 177
401 3300026121 Ga0207683_10064766 Ga0207683_100647663 177
402 3300026121 Ga0207683_10076183 Ga0207683_100761834 177
403 3300026121 Ga0207683_10251001 Ga0207683_102510012 177
404 3300026121 Ga0207683_10410869 Ga0207683_104108692 177
405 3300026121 Ga0207683_10438610 Ga0207683_104386101 177
406 3300026121 Ga0207683_10463914 Ga0207683_104639142 177
407 3300026142 Ga0207698_10016066 Ga0207698_100160665 177
408 3300026142 Ga0207698_10028013 Ga0207698_100280134 177
409 3300026142 Ga0207698_10053123 Ga0207698_100531232 177
410 3300026142 Ga0207698_10289791 Ga0207698_102897912 177
411 3300026142 Ga0207698_10716708 Ga0207698_107167082 177
412 3300026142 Ga0207698_11013974 Ga0207698_110139742 177
413 3300028380 Ga0268265_10011173 Ga0268265_100111737 177
414 3300028381 Ga0268264_10004410 Ga0268264_100044106 177
415 3300028381 Ga0268264_10080643 Ga0268264_100806433 177
416 3300035084 Ga0373928_0008445 Ga0373928_0008445_850_1395 177
417 3300035085 Ga0373929_0044302 Ga0373929_0044302_281_826 177
418 3300035170 Ga0373943_0051007 Ga0373943_0051007_1022_1567 177
419 3300035172 Ga0373955_0464001 Ga0373955_0464001_18_563 177
420 3300035725 Ga0373947_0758003 Ga0373947_0758003_85_630 177
421 3300036401 Ga0373937_0078199 Ga0373937_0078199_2112_2657 177
422 3300037068 Ga0373925_0511525 Ga0373925_0511525_61_606 177
423 3300041451 Ga0451791_0319493 Ga0451791_0319493_26_655 177
424 3300041456 Ga0451795_1067193 Ga0451795_1067193_23_571 177
425 3300045051 Ga0451576_0567890 Ga0451576_0567890_219_764 177
426 3300046543 Ga0495645_0244432 Ga0495645_0244432_470_1015 177
427 3300046663 Ga0495635_0353614 Ga0495635_0353614_159_704 177
428 3300046681 Ga0495647_0040042 Ga0495647_0040042_260_805 177
429 3300046683 Ga0495658_0012994 Ga0495658_0012994_3650_4195 177
430 3300046683 Ga0495658_0043733 Ga0495658_0043733_949_1494 177
431 3300048903 Ga0496100_0123007 Ga0496100_0123007_840_1385 177
432 3300048904 Ga0496101_0617782 Ga0496101_0617782_112_657 177
433 3300048907 Ga0496104_0127565 Ga0496104_0127565_221_766 177
434 3300048907 Ga0496104_1116472 Ga0496104_1116472_20_565 177
435 3300048908 Ga0496105_0392841 Ga0496105_0392841_70_615 177
436 3300048908 Ga0496105_0450813 Ga0496105_0450813_17_562 177
437 3300048909 Ga0496106_0072734 Ga0496106_0072734_1505_2050 177
438 3300048910 Ga0496107_0009370 Ga0496107_0009370_917_1462 177
439 3300048911 Ga0496108_0243780 Ga0496108_0243780_805_1350 177
440 3300048912 Ga0496109_0028870 Ga0496109_0028870_3401_3946 177
441 3300048913 Ga0496110_0230701 Ga0496110_0230701_811_1395 177
442 3300048913 Ga0496110_0761969 Ga0496110_0761969_122_667 177
443 3300048914 Ga0496111_0152684 Ga0496111_0152684_313_858 177
444 3300048915 Ga0496112_0541582 Ga0496112_0541582_442_987 177
445 3300048917 Ga0496114_0062115 Ga0496114_0062115_95_640 177
446 3300048917 Ga0496114_0111742 Ga0496114_0111742_939_1523 177
447 3300048918 Ga0496115_0283821 Ga0496115_0283821_339_884 177
448 3300049686 Ga0501257_068131 Ga0501257_068131_11_559 177
449 3300049759 Ga0501262_039130 Ga0501262_039130_15_605 177
450 3300050489 nmdc:mga03683_40529_c1 nmdc:mga03683_40529_c1_301_834 177
451 3300050493 nmdc:mga0k408_16862_c1 nmdc:mga0k408_16862_c1_1275_1808 177
452 3300050511 nmdc:mga08y16_471897_c1 nmdc:mga08y16_471897_c1_202_786 177
453 3300050512 nmdc:mga0n895_103710_c1 nmdc:mga0n895_103710_c1_645_1190 177
454 3300053077 Ga0495601_0373953 Ga0495601_0373953_282_827 177
455 3300053084 Ga0495595_0037426 Ga0495595_0037426_1420_1965 177
456 3300005338 Ga0068868_100374913 Ga0068868_1003749132 178
457 3300005356 Ga0070674_101419264 Ga0070674_1014192641 178
458 3300005543 Ga0070672_100042239 Ga0070672_1000422393 178
459 3300009176 Ga0105242_10698144 Ga0105242_106981441 178
460 3300025940 Ga0207691_10183778 Ga0207691_101837783 178
461 3300026023 Ga0207677_10361780 Ga0207677_103617801 178
462 3300026089 Ga0207648_10663180 Ga0207648_106631802 178
463 3300031731 Ga0307405_10078963 Ga0307405_100789632 178
464 3300031852 Ga0307410_10026154 Ga0307410_100261542 178
465 3300031901 Ga0307406_10146179 Ga0307406_101461792 178
466 3300031903 Ga0307407_10270625 Ga0307407_102706252 178
467 3300031911 Ga0307412_10022329 Ga0307412_100223292 178
468 3300032002 Ga0307416_100181522 Ga0307416_1001815222 178
469 3300032004 Ga0307414_10055647 Ga0307414_100556472 178
470 3300005331 Ga0070670_100284617 Ga0070670_1002846172 179
471 3300005367 Ga0070667_100009471 Ga0070667_1000094715 179
472 3300005548 Ga0070665_100263121 Ga0070665_1002631212 179
473 3300009098 Ga0105245_10147839 Ga0105245_101478393 179
474 3300009177 Ga0105248_10795155 Ga0105248_107951552 179
475 3300010375 Ga0105239_10479709 Ga0105239_104797092 179
476 3300017792 Ga0163161_10589607 Ga0163161_105896072 179
477 3300025298 Ga0209050_1001962 Ga0209050_100196220 179
478 3300025927 Ga0207687_10151931 Ga0207687_101519312 179
479 3300025986 Ga0207658_10004115 Ga0207658_100041153 179
480 3300028379 Ga0268266_10092320 Ga0268266_100923203 179
481 3300028786 Ga0307517_10000810 Ga0307517_1000081015 179
482 3300028794 Ga0307515_10000381 Ga0307515_1000038115 179
483 3300028794 Ga0307515_10002386 Ga0307515_1000238613 179
484 3300030522 Ga0307512_10059161 Ga0307512_100591614 179
485 3300030522 Ga0307512_10263606 Ga0307512_102636062 179
486 3300031456 Ga0307513_10004294 Ga0307513_100042944 179
487 3300031456 Ga0307513_10026047 Ga0307513_100260473 179
488 3300031456 Ga0307513_10516057 Ga0307513_105160572 179
489 3300031507 Ga0307509_10050016 Ga0307509_100500165 179
490 3300031616 Ga0307508_10000194 Ga0307508_1000019424 179
491 3300031649 Ga0307514_10011053 Ga0307514_100110536 179
492 3300031730 Ga0307516_10118500 Ga0307516_101185003 179
493 3300033179 Ga0307507_10068293 Ga0307507_100682932 179
494 3300041492 Ga0451835_0950027 Ga0451835_0950027_201_740 179
495 3300041496 Ga0451839_0760707 Ga0451839_0760707_1028_1567 179
496 3300041505 Ga0451849_0548321 Ga0451849_0548321_45_584 179
497 3300041512 Ga0451853_2274432 Ga0451853_2274432_82_621 179
498 3300046519 Ga0495632_0175496 Ga0495632_0175496_312_854 179
499 3300046519 Ga0495632_0252601 Ga0495632_0252601_105_644 179
500 3300046522 Ga0495643_0036252 Ga0495643_0036252_703_1242 179
501 3300046660 Ga0495625_0006631 Ga0495625_0006631_8601_9140 179
502 3300047472 Ga0495686_0341365 Ga0495686_0341365_18_557 179
503 3300048916 Ga0496113_0572087 Ga0496113_0572087_214_753 179
504 3300050493 nmdc:mga0k408_243127_c1 nmdc:mga0k408_243127_c1_206_745 179
505 3300053134 Ga0500658_0056441 Ga0500658_0056441_21_560 179
506 3300053739 Ga0500587_001023 Ga0500587_001023_1276_1815 179
507 3300002773 JGI25152J39213_1000626 JGI25152J39213_100062612 180
508 3300003215 JGI25153J46596_10001224 JGI25153J46596_100012243 180
509 3300003215 JGI25153J46596_10005270 JGI25153J46596_100052702 180
510 3300003215 JGI25153J46596_10010478 JGI25153J46596_100104785 180
511 3300003323 rootH1_10172482 rootH1_101724824 180
512 3300003771 Ga0055526_1003267 Ga0055526_10032674 180
513 3300005331 Ga0070670_100054662 Ga0070670_1000546625 180
514 3300005334 Ga0068869_101100067 Ga0068869_1011000671 180
515 3300005355 Ga0070671_100134987 Ga0070671_1001349872 180
516 3300005356 Ga0070674_100016511 Ga0070674_1000165116 180
517 3300005459 Ga0068867_100077768 Ga0068867_1000777683 180
518 3300005459 Ga0068867_100099511 Ga0068867_1000995113 180
519 3300005564 Ga0070664_100737964 Ga0070664_1007379642 180
520 3300005577 Ga0068857_100298591 Ga0068857_1002985913 180
521 3300005614 Ga0068856_100022973 Ga0068856_1000229736 180
522 3300005834 Ga0068851_10147537 Ga0068851_101475372 180
523 3300006042 Ga0075368_10120844 Ga0075368_101208442 180
524 3300006042 Ga0075368_10271359 Ga0075368_102713591 180
525 3300006048 Ga0075363_100011747 Ga0075363_1000117474 180
526 3300006051 Ga0075364_10083153 Ga0075364_100831532 180
527 3300006177 Ga0075362_10008211 Ga0075362_100082114 180
528 3300006178 Ga0075367_10391512 Ga0075367_103915122 180
529 3300006186 Ga0075369_10261906 Ga0075369_102619061 180
530 3300006195 Ga0075366_10000574 Ga0075366_100005749 180
531 3300006195 Ga0075366_10009384 Ga0075366_100093842 180
532 3300006195 Ga0075366_10024978 Ga0075366_100249783 180
533 3300006195 Ga0075366_10063382 Ga0075366_100633823 180
534 3300006195 Ga0075366_10192111 Ga0075366_101921113 180
535 3300006353 Ga0075370_10000101 Ga0075370_100001019 180
536 3300006353 Ga0075370_10003489 Ga0075370_100034899 180
537 3300006353 Ga0075370_10013018 Ga0075370_100130185 180
538 3300006353 Ga0075370_10100492 Ga0075370_101004923 180
539 3300006353 Ga0075370_10298457 Ga0075370_102984571 180
540 3300009148 Ga0105243_10107881 Ga0105243_101078812 180
541 3300010375 Ga0105239_10050731 Ga0105239_100507313 180
542 3300013297 Ga0157378_10526364 Ga0157378_105263642 180
543 3300013297 Ga0157378_10614164 Ga0157378_106141642 180
544 3300013306 Ga0163162_11575847 Ga0163162_115758471 180
545 3300025245 Ga0207425_1001646 Ga0207425_10016463 180
546 3300025258 Ga0209129_1000124 Ga0209129_100012430 180
547 3300025258 Ga0209129_1010372 Ga0209129_10103722 180
548 3300025273 Ga0209673_1013941 Ga0209673_10139415 180
549 3300025295 Ga0209564_1000057 Ga0209564_100005791 180
550 3300025297 Ga0209758_1000214 Ga0209758_100021461 180
551 3300025297 Ga0209758_1000232 Ga0209758_100023260 180
552 3300025321 Ga0207656_10162776 Ga0207656_101627762 180
553 3300025893 Ga0207682_10212261 Ga0207682_102122611 180
554 3300025907 Ga0207645_10005861 Ga0207645_100058617 180
555 3300025925 Ga0207650_10236091 Ga0207650_102360912 180
556 3300025931 Ga0207644_10185223 Ga0207644_101852233 180
557 3300025942 Ga0207689_10015594 Ga0207689_100155949 180
558 3300025942 Ga0207689_10241497 Ga0207689_102414972 180
559 3300025945 Ga0207679_10403696 Ga0207679_104036962 180
560 3300025981 Ga0207640_10016633 Ga0207640_100166332 180
561 3300026023 Ga0207677_10630202 Ga0207677_106302022 180
562 3300026078 Ga0207702_10460110 Ga0207702_104601102 180
563 3300026089 Ga0207648_10055085 Ga0207648_100550853 180
564 3300026089 Ga0207648_10067687 Ga0207648_100676873 180
565 3300026118 Ga0207675_100835190 Ga0207675_1008351902 180
566 3300026142 Ga0207698_10054479 Ga0207698_100544793 180
567 3300027866 Ga0209813_10027757 Ga0209813_100277572 180
568 3300027866 Ga0209813_10092905 Ga0209813_100929052 180
569 3300028786 Ga0307517_10081360 Ga0307517_100813602 180
570 3300028786 Ga0307517_10142655 Ga0307517_101426553 180
571 3300031456 Ga0307513_10275714 Ga0307513_102757143 180
572 3300031456 Ga0307513_10485066 Ga0307513_104850662 180
573 3300031616 Ga0307508_10002132 Ga0307508_100021328 180
574 3300031730 Ga0307516_10208068 Ga0307516_102080683 180
575 3300031730 Ga0307516_10212500 Ga0307516_102125001 180
576 3300031824 Ga0307413_10093092 Ga0307413_100930924 180
577 3300031852 Ga0307410_11018880 Ga0307410_110188801 180
578 3300031995 Ga0307409_100630024 Ga0307409_1006300241 180
579 3300032002 Ga0307416_100070299 Ga0307416_1000702994 180
580 3300032005 Ga0307411_10032732 Ga0307411_100327325 180
581 3300035118 Ga0373954_0146455 Ga0373954_0146455_83_625 180
582 3300035725 Ga0373947_0800660 Ga0373947_0800660_46_588 180
583 3300041443 Ga0451789_1281368 Ga0451789_1281368_257_799 180
584 3300041452 Ga0451793_1115609 Ga0451793_1115609_775_1317 180
585 3300041459 Ga0451800_1406008 Ga0451800_1406008_41_583 180
586 3300041503 Ga0451847_0835513 Ga0451847_0835513_11_574 180
587 3300046506 Ga0495583_0044197 Ga0495583_0044197_1128_1670 180
588 3300046513 Ga0495616_0174567 Ga0495616_0174567_14_556 180
589 3300046518 Ga0495631_0094953 Ga0495631_0094953_60_632 180
590 3300046519 Ga0495632_0003621 Ga0495632_0003621_102_644 180
591 3300046519 Ga0495632_0011776 Ga0495632_0011776_1464_2006 180
592 3300046519 Ga0495632_0315781 Ga0495632_0315781_79_621 180
593 3300046524 Ga0495648_0170745 Ga0495648_0170745_146_718 180
594 3300046616 Ga0495668_0066901 Ga0495668_0066901_1093_1665 180
595 3300046648 Ga0495611_0043832 Ga0495611_0043832_1326_1868 180
596 3300046660 Ga0495625_0146920 Ga0495625_0146920_38_583 180
597 3300046694 Ga0495649_0013683 Ga0495649_0013683_651_1193 180
598 3300046810 Ga0495660_0034709 Ga0495660_0034709_816_1358 180
599 3300047443 Ga0495687_000196 Ga0495687_000196_66205_66777 180
600 3300047443 Ga0495687_022632 Ga0495687_022632_1624_2166 180
601 3300047443 Ga0495687_032090 Ga0495687_032090_237_779 180
602 3300049579 Ga0501043_0000004 Ga0501043_0000004_21022_21585 180
603 3300049580 Ga0501046_0000050 Ga0501046_0000050_98338_98901 180
604 3300049581 Ga0501047_0000012 Ga0501047_0000012_269931_270494 180
605 3300049582 Ga0501048_0004275 Ga0501048_0004275_3579_4142 180
606 3300049824 Ga0501045_0049296 Ga0501045_0049296_2418_2981 180
607 3300050490 nmdc:mga03n38_5373_c1 nmdc:mga03n38_5373_c1_3232_3804 180
608 3300050493 nmdc:mga0k408_1682_c1 nmdc:mga0k408_1682_c1_9482_10054 180
609 3300050493 nmdc:mga0k408_190792_c1 nmdc:mga0k408_190792_c1_212_754 180
610 3300050493 nmdc:mga0k408_201322_c1 nmdc:mga0k408_201322_c1_193_744 180
611 3300050493 nmdc:mga0k408_45759_c1 nmdc:mga0k408_45759_c1_1039_1581 180
612 3300050493 nmdc:mga0k408_695_c1 nmdc:mga0k408_695_c1_12562_13128 180
613 3300050493 nmdc:mga0k408_6998_c1 nmdc:mga0k408_6998_c1_52_594 180
614 3300050494 nmdc:mga06z11_104541_c1 nmdc:mga06z11_104541_c1_627_1169 180
615 3300050494 nmdc:mga06z11_156159_c1 nmdc:mga06z11_156159_c1_550_1092 180
616 3300050495 nmdc:mga04h51_38905_c1 nmdc:mga04h51_38905_c1_977_1519 180
617 3300050496 nmdc:mga07m45_1045_c1 nmdc:mga07m45_1045_c1_798_1340 180
618 3300050496 nmdc:mga07m45_185787_c1 nmdc:mga07m45_185787_c1_230_772 180
619 3300050496 nmdc:mga07m45_22889_c1 nmdc:mga07m45_22889_c1_257_823 180
620 3300050496 nmdc:mga07m45_349480_c1 nmdc:mga07m45_349480_c1_54_620 180
621 3300050516 nmdc:mga0sz30_123221_c1 nmdc:mga0sz30_123221_c1_195_737 180
622 3300053087 Ga0500643_043685 Ga0500643_043685_494_1036 180
623 3300053093 Ga0500651_0080479 Ga0500651_0080479_1166_1708 180
624 3300053093 Ga0500651_0336097 Ga0500651_0336097_45_587 180
625 3300053093 Ga0500651_0486450 Ga0500651_0486450_12_554 180
626 3300053108 Ga0500562_025890 Ga0500562_025890_720_1262 180
627 3300053130 Ga0500642_0002746 Ga0500642_0002746_4626_5168 180
628 3300053130 Ga0500642_0032574 Ga0500642_0032574_1270_1812 180
629 3300053131 Ga0500652_000155 Ga0500652_000155_10932_11474 180
630 3300053134 Ga0500658_0003329 Ga0500658_0003329_4048_4590 180
631 3300053139 Ga0500568_0018673 Ga0500568_0018673_749_1291 180
632 3300053156 Ga0500622_0000423 Ga0500622_0000423_9283_9825 180
633 3300053158 Ga0500627_0182952 Ga0500627_0182952_204_746 180
634 3300053724 Ga0500570_124659 Ga0500570_124659_119_661 180

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

118

197

0.93

PF00474

SSF

Sodium:solute symporter family

1

50

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hmb-assembly1.cif.gz_A crystal structure of s. sahachiroi azig 0.9504 58 179
3nwz-assembly3.cif.gz_D crystal structure of bh2602 protein from bacillus halodurans with coa, northeast structural genomics consortium target bhr199 0.9462 77 177
1zki-assembly1.cif.gz_B structure of conserved protein pa5202 from pseudomonas aeruginosa 0.9457 58 177
3nwz-assembly2.cif.gz_C crystal structure of bh2602 protein from bacillus halodurans with coa, northeast structural genomics consortium target bhr199 0.9438 76 177
2dsl-assembly1.cif.gz_A mutant n33d structure of phenylacetic acid degradation protein paai from thermus thermophilus hb8 0.9427 58 175
ID Description Score Start End Superfamily
1wluA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9427 58 175 3.10.129.10
4m20A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9344 58 176 3.10.129.10
3s4kB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9305 58 180 3.10.129.10
3nwzD00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9297 77 177 3.10.129.10
1zkiB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9296 58 177 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A1F4BJ79-F1-model_v4 Thioesterase domain-containing protein 0.9921 66 177 GO:0005829
GO:0061522
AF-A0A1M3BPM1-F1-model_v4 Phenylacetic acid degradation protein 0.9904 65 178 GO:0047617
AF-A0A4Q5PLE3-F1-model_v4 PaaI family thioesterase 0.9895 8 180 GO:0005829
GO:0061522
AF-A0A6P1KDZ5-F1-model_v4 Hotdog fold thioesterase 0.9883 58 179 GO:0016289
AF-A0A520G6K8-F1-model_v4 PaaI family thioesterase 0.9879 8 180 GO:0005829
GO:0061522

Feature Viewer

pLDDT pTM Quality
95.25 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map