F471185
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 634 | 285 | 627 | 180 |
Family's Representative Sequence
| Representative Sequence | 3300041451|Ga0451791_0319493|Ga0451791_0319493_26_655 |
| Length | 209 |
| Sequence | MSMPVCVLVTGVVATLYTYLGGIEAVIWVDVLQVAVLIGGAVLTLAADTALRQRRIVYGVATREQVAGKSGLELFEAMIAGALPAPPISETLDFLLVAAEHGRVVFQGRPGFAHYNPMGAVHGGWFATLLDSALGCAVGSTLPAGKAYTTAELKVNIVRPLSDKVPFVRADGRVIHGGNRMATADARLTGPDGKLYAHGSTTCFIFDAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 2 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 3 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 4 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 5 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 6 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 7 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 8 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 9 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 10 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 13 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 78 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 79 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 80 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 81 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 82 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 83 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 86 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 119 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 120 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 180 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 181 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 182 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 183 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 184 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 185 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 186 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 187 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 188 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 189 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 190 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 191 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 192 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 193 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 194 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 195 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 196 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 197 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 198 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 199 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 200 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 201 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 202 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 203 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 204 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 205 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 206 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 209 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 210 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 211 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 212 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 213 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 214 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 215 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 216 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 217 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 218 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 219 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 220 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 221 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 222 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 223 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 224 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 245 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 246 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 247 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 248 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 251 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 252 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 253 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 254 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 255 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 256 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 261 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 262 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 265 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 266 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 267 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 268 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 269 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 270 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 273 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 276 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 277 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 278 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 279 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 280 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 281 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 282 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 283 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 284 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 285 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.9 |
| Metatranscriptomes | 0 |
| Isolates | 1.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.51 |
| Nodule | 0 |
| Rhizoplane | 3.79 |
| Rhizosphere | 79.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.68 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25152J39213_1000626 | 3300002773 | Bacteria | 18751 |
| 2 | JGI25153J46596_10001224 | 3300003215 | Bacteria | 15474 |
| 3 | JGI25153J46596_10005270 | 3300003215 | Bacteria | 6797 |
| 4 | JGI25153J46596_10010478 | 3300003215 | Bacteria | 4189 |
| 5 | rootH1_10008702 | 3300003316 | Bacteria | 1054 |
| 6 | rootH1_10065105 | 3300003316 | Bacteria | 2086 |
| 7 | rootL2_10016479 | 3300003322 | Bacteria | 4719 |
| 8 | rootH1_10172482 | 3300003323 | Bacteria | 2585 |
| 9 | Ga0055526_1003267 | 3300003771 | Bacteria | 10410 |
| 10 | Ga0065714_10083810 | 3300005288 | Bacteria | 2230 |
| 11 | Ga0070658_10102909 | 3300005327 | Bacteria | 2362 |
| 12 | Ga0070658_10549331 | 3300005327 | Bacteria | 999 |
| 13 | Ga0070676_10003406 | 3300005328 | Bacteria | 8277 |
| 14 | Ga0070676_10251400 | 3300005328 | Bacteria | 1180 |
| 15 | Ga0070683_100005352 | 3300005329 | Bacteria | 10701 |
| 16 | Ga0070690_100008781 | 3300005330 | Bacteria | 5834 |
| 17 | Ga0070690_100057629 | 3300005330 | Bacteria | 2494 |
| 18 | Ga0070670_100009851 | 3300005331 | Bacteria | 8160 |
| 19 | Ga0070670_100022200 | 3300005331 | Bacteria | 5462 |
| 20 | Ga0070670_100054662 | 3300005331 | Bacteria | 3428 |
| 21 | Ga0070670_100093239 | 3300005331 | Bacteria | 2590 |
| 22 | Ga0070670_100212401 | 3300005331 | Bacteria | 1682 |
| 23 | Ga0070670_100284617 | 3300005331 | Bacteria | 1444 |
| 24 | Ga0070670_100559691 | 3300005331 | Bacteria | 1021 |
| 25 | Ga0070670_100634621 | 3300005331 | Bacteria | 957 |
| 26 | Ga0070670_100837947 | 3300005331 | Bacteria | 832 |
| 27 | Ga0068869_100018976 | 3300005334 | Bacteria | 4689 |
| 28 | Ga0068869_100069759 | 3300005334 | Bacteria | 2599 |
| 29 | Ga0068869_100247077 | 3300005334 | Bacteria | 1424 |
| 30 | Ga0068869_101100067 | 3300005334 | Bacteria | 695 |
| 31 | Ga0070666_10007624 | 3300005335 | Bacteria | 6678 |
| 32 | Ga0070666_10113018 | 3300005335 | Bacteria | 1879 |
| 33 | Ga0068868_100001157 | 3300005338 | Bacteria | 18078 |
| 34 | Ga0068868_100020570 | 3300005338 | Bacteria | 4962 |
| 35 | Ga0068868_100374913 | 3300005338 | Bacteria | 1223 |
| 36 | Ga0068868_100489457 | 3300005338 | Bacteria | 1076 |
| 37 | Ga0068868_100780116 | 3300005338 | Bacteria | 861 |
| 38 | Ga0070660_100068835 | 3300005339 | Bacteria | 2759 |
| 39 | Ga0070660_100469025 | 3300005339 | Bacteria | 1046 |
| 40 | Ga0070689_100056678 | 3300005340 | Bacteria | 3039 |
| 41 | Ga0070689_100158102 | 3300005340 | Bacteria | 1831 |
| 42 | Ga0070691_10006362 | 3300005341 | Bacteria | 5400 |
| 43 | Ga0070687_100001572 | 3300005343 | Bacteria | 8114 |
| 44 | Ga0070687_100387055 | 3300005343 | Bacteria | 913 |
| 45 | Ga0070661_100332441 | 3300005344 | Bacteria | 1189 |
| 46 | Ga0070692_10158748 | 3300005345 | Bacteria | 1294 |
| 47 | Ga0070692_10176509 | 3300005345 | Bacteria | 1235 |
| 48 | Ga0070668_100003697 | 3300005347 | Bacteria | 11294 |
| 49 | Ga0070669_100001896 | 3300005353 | Bacteria | 15091 |
| 50 | Ga0070669_100076757 | 3300005353 | Bacteria | 2480 |
| 51 | Ga0070675_100001801 | 3300005354 | Bacteria | 15832 |
| 52 | Ga0070675_100015725 | 3300005354 | Bacteria | 5988 |
| 53 | Ga0070675_100101108 | 3300005354 | Bacteria | 2428 |
| 54 | Ga0070675_100300711 | 3300005354 | Bacteria | 1413 |
| 55 | Ga0070675_100641931 | 3300005354 | Bacteria | 964 |
| 56 | Ga0070671_100006533 | 3300005355 | Bacteria | 9322 |
| 57 | Ga0070671_100031094 | 3300005355 | Bacteria | 4408 |
| 58 | Ga0070671_100080213 | 3300005355 | Bacteria | 2728 |
| 59 | Ga0070671_100134987 | 3300005355 | Bacteria | 2080 |
| 60 | Ga0070671_100148544 | 3300005355 | Bacteria | 1979 |
| 61 | Ga0070671_100299367 | 3300005355 | Bacteria | 1369 |
| 62 | Ga0070671_101107475 | 3300005355 | Bacteria | 695 |
| 63 | Ga0070674_100016511 | 3300005356 | Bacteria | 4628 |
| 64 | Ga0070674_100027973 | 3300005356 | Bacteria | 3699 |
| 65 | Ga0070674_100362131 | 3300005356 | Bacteria | 1174 |
| 66 | Ga0070674_100567373 | 3300005356 | Bacteria | 954 |
| 67 | Ga0070674_101419264 | 3300005356 | Bacteria | 622 |
| 68 | Ga0070673_100125273 | 3300005364 | Bacteria | 2149 |
| 69 | Ga0070688_100587624 | 3300005365 | Bacteria | 851 |
| 70 | Ga0070659_100305056 | 3300005366 | Bacteria | 1328 |
| 71 | Ga0070659_101089857 | 3300005366 | Bacteria | 704 |
| 72 | Ga0070667_100006750 | 3300005367 | Bacteria | 9531 |
| 73 | Ga0070667_100009471 | 3300005367 | Bacteria | 8079 |
| 74 | Ga0070667_100088937 | 3300005367 | Bacteria | 2652 |
| 75 | Ga0070667_100264840 | 3300005367 | Bacteria | 1540 |
| 76 | Ga0070701_10005622 | 3300005438 | Bacteria | 5199 |
| 77 | Ga0070701_10212132 | 3300005438 | Bacteria | 1150 |
| 78 | Ga0070700_100003632 | 3300005441 | Bacteria | 7982 |
| 79 | Ga0070700_100049456 | 3300005441 | Bacteria | 2610 |
| 80 | Ga0070700_100340640 | 3300005441 | Bacteria | 1108 |
| 81 | Ga0070694_100099115 | 3300005444 | Bacteria | 2058 |
| 82 | Ga0070708_100156079 | 3300005445 | Bacteria | 2125 |
| 83 | Ga0070663_100315532 | 3300005455 | Bacteria | 1255 |
| 84 | Ga0070678_100046649 | 3300005456 | Bacteria | 3109 |
| 85 | Ga0070678_100084262 | 3300005456 | Bacteria | 2419 |
| 86 | Ga0070678_100278890 | 3300005456 | Bacteria | 1413 |
| 87 | Ga0070678_100324632 | 3300005456 | Bacteria | 1315 |
| 88 | Ga0070678_100369736 | 3300005456 | Bacteria | 1238 |
| 89 | Ga0070662_100000867 | 3300005457 | Bacteria | 18517 |
| 90 | Ga0070662_100033229 | 3300005457 | Bacteria | 3630 |
| 91 | Ga0070662_100110025 | 3300005457 | Bacteria | 2097 |
| 92 | Ga0070662_100110273 | 3300005457 | Bacteria | 2095 |
| 93 | Ga0070662_100961128 | 3300005457 | Bacteria | 730 |
| 94 | Ga0070681_10277226 | 3300005458 | Unclassified | 1588 |
| 95 | Ga0068867_100010500 | 3300005459 | Bacteria | 6533 |
| 96 | Ga0068867_100027068 | 3300005459 | Bacteria | 4119 |
| 97 | Ga0068867_100077768 | 3300005459 | Bacteria | 2494 |
| 98 | Ga0068867_100088043 | 3300005459 | Bacteria | 2352 |
| 99 | Ga0068867_100099511 | 3300005459 | Bacteria | 2218 |
| 100 | Ga0070685_10590976 | 3300005466 | Bacteria | 798 |
| 101 | Ga0070706_100001400 | 3300005467 | Bacteria | 25498 |
| 102 | Ga0070707_100024364 | 3300005468 | Bacteria | 5731 |
| 103 | Ga0070699_100067925 | 3300005518 | Bacteria | 3095 |
| 104 | Ga0070684_100027307 | 3300005535 | Bacteria | 4815 |
| 105 | Ga0070684_100127611 | 3300005535 | Bacteria | 2292 |
| 106 | Ga0068853_100002880 | 3300005539 | Bacteria | 13055 |
| 107 | Ga0068853_100132036 | 3300005539 | Bacteria | 2236 |
| 108 | Ga0068853_100275663 | 3300005539 | Bacteria | 1550 |
| 109 | Ga0068853_100591297 | 3300005539 | Bacteria | 1054 |
| 110 | Ga0070672_100042239 | 3300005543 | Bacteria | 3510 |
| 111 | Ga0070672_100049097 | 3300005543 | Bacteria | 3281 |
| 112 | Ga0070672_100052344 | 3300005543 | Bacteria | 3187 |
| 113 | Ga0070672_100098868 | 3300005543 | Bacteria | 2364 |
| 114 | Ga0070672_100150560 | 3300005543 | Bacteria | 1924 |
| 115 | Ga0070672_100474677 | 3300005543 | Bacteria | 1079 |
| 116 | Ga0070686_100010433 | 3300005544 | Bacteria | 5238 |
| 117 | Ga0070695_100369725 | 3300005545 | Bacteria | 1079 |
| 118 | Ga0070696_100224312 | 3300005546 | Bacteria | 1411 |
| 119 | Ga0070696_100570291 | 3300005546 | Bacteria | 909 |
| 120 | Ga0070696_100687959 | 3300005546 | Bacteria | 832 |
| 121 | Ga0070693_100029302 | 3300005547 | Bacteria | 3001 |
| 122 | Ga0070693_100033937 | 3300005547 | Unclassified | 2820 |
| 123 | Ga0070693_100467100 | 3300005547 | Bacteria | 889 |
| 124 | Ga0070665_100078999 | 3300005548 | Bacteria | 3296 |
| 125 | Ga0070665_100263121 | 3300005548 | Bacteria | 1726 |
| 126 | Ga0070665_100672796 | 3300005548 | Bacteria | 1048 |
| 127 | Ga0070704_100034645 | 3300005549 | Bacteria | 3426 |
| 128 | Ga0068855_100051204 | 3300005563 | Bacteria | 4864 |
| 129 | Ga0070664_100034883 | 3300005564 | Bacteria | 4222 |
| 130 | Ga0070664_100055141 | 3300005564 | Bacteria | 3373 |
| 131 | Ga0070664_100115387 | 3300005564 | Bacteria | 2347 |
| 132 | Ga0070664_100362793 | 3300005564 | Bacteria | 1319 |
| 133 | Ga0070664_100528380 | 3300005564 | Bacteria | 1089 |
| 134 | Ga0070664_100614455 | 3300005564 | Bacteria | 1009 |
| 135 | Ga0070664_100737964 | 3300005564 | Bacteria | 919 |
| 136 | Ga0070664_100821690 | 3300005564 | Bacteria | 869 |
| 137 | Ga0068857_100298591 | 3300005577 | Bacteria | 1485 |
| 138 | Ga0068857_101497336 | 3300005577 | Bacteria | 657 |
| 139 | Ga0068854_100027581 | 3300005578 | Bacteria | 3915 |
| 140 | Ga0068854_100247616 | 3300005578 | Bacteria | 1422 |
| 141 | Ga0068854_100304415 | 3300005578 | Bacteria | 1290 |
| 142 | Ga0068856_100004035 | 3300005614 | Bacteria | 14702 |
| 143 | Ga0068856_100022973 | 3300005614 | Bacteria | 6064 |
| 144 | Ga0070702_100002012 | 3300005615 | Bacteria | 8576 |
| 145 | Ga0070702_100014791 | 3300005615 | Bacteria | 3968 |
| 146 | Ga0068852_100048509 | 3300005616 | Bacteria | 3628 |
| 147 | Ga0068852_100054887 | 3300005616 | Bacteria | 3436 |
| 148 | Ga0068852_100072682 | 3300005616 | Bacteria | 3023 |
| 149 | Ga0068852_100139459 | 3300005616 | Bacteria | 2242 |
| 150 | Ga0068852_100189947 | 3300005616 | Bacteria | 1938 |
| 151 | Ga0068852_100447083 | 3300005616 | Bacteria | 1279 |
| 152 | Ga0068859_100039890 | 3300005617 | Bacteria | 4712 |
| 153 | Ga0068859_100492687 | 3300005617 | Unclassified | 1321 |
| 154 | Ga0068864_100024340 | 3300005618 | Bacteria | 5093 |
| 155 | Ga0068864_100092381 | 3300005618 | Bacteria | 2671 |
| 156 | Ga0068864_100130063 | 3300005618 | Bacteria | 2260 |
| 157 | Ga0068866_10006667 | 3300005718 | Bacteria | 4815 |
| 158 | Ga0068866_10024416 | 3300005718 | Bacteria | 2827 |
| 159 | Ga0068861_100003855 | 3300005719 | Bacteria | 10017 |
| 160 | Ga0068861_100014498 | 3300005719 | Bacteria | 5533 |
| 161 | Ga0068861_100062057 | 3300005719 | Bacteria | 2870 |
| 162 | Ga0068851_10009705 | 3300005834 | Bacteria | 4482 |
| 163 | Ga0068851_10020198 | 3300005834 | Bacteria | 3222 |
| 164 | Ga0068851_10147537 | 3300005834 | Bacteria | 1284 |
| 165 | Ga0068870_10107341 | 3300005840 | Bacteria | 1588 |
| 166 | Ga0068863_100058398 | 3300005841 | Bacteria | 3651 |
| 167 | Ga0068863_100067310 | 3300005841 | Bacteria | 3387 |
| 168 | Ga0068863_100195703 | 3300005841 | Bacteria | 1943 |
| 169 | Ga0068863_100323282 | 3300005841 | Bacteria | 1499 |
| 170 | Ga0068863_100469384 | 3300005841 | Bacteria | 1237 |
| 171 | Ga0068863_100570434 | 3300005841 | Bacteria | 1118 |
| 172 | Ga0068858_100010960 | 3300005842 | Bacteria | 8567 |
| 173 | Ga0068858_100036965 | 3300005842 | Bacteria | 4527 |
| 174 | Ga0068858_100160326 | 3300005842 | Bacteria | 2118 |
| 175 | Ga0068860_100003734 | 3300005843 | Bacteria | 15664 |
| 176 | Ga0068860_100038970 | 3300005843 | Unclassified | 4546 |
| 177 | Ga0068860_100176947 | 3300005843 | Bacteria | 2062 |
| 178 | Ga0068860_100499385 | 3300005843 | Bacteria | 1214 |
| 179 | Ga0068862_100032968 | 3300005844 | Bacteria | 4375 |
| 180 | Ga0068862_100117932 | 3300005844 | Unclassified | 2336 |
| 181 | Ga0075368_10120844 | 3300006042 | Bacteria | 1085 |
| 182 | Ga0075368_10271359 | 3300006042 | Bacteria | 728 |
| 183 | Ga0075363_100011747 | 3300006048 | Bacteria | 4203 |
| 184 | Ga0075364_10083153 | 3300006051 | Bacteria | 2119 |
| 185 | Ga0075362_10008211 | 3300006177 | Bacteria | 3985 |
| 186 | Ga0075367_10007898 | 3300006178 | Bacteria | 5480 |
| 187 | Ga0075367_10391512 | 3300006178 | Bacteria | 878 |
| 188 | Ga0075369_10261906 | 3300006186 | Bacteria | 804 |
| 189 | Ga0075366_10000574 | 3300006195 | Bacteria | 17235 |
| 190 | Ga0075366_10009384 | 3300006195 | Bacteria | 5460 |
| 191 | Ga0075366_10024978 | 3300006195 | Bacteria | 3487 |
| 192 | Ga0075366_10063382 | 3300006195 | Bacteria | 2197 |
| 193 | Ga0075366_10165958 | 3300006195 | Bacteria | 1339 |
| 194 | Ga0075366_10192111 | 3300006195 | Bacteria | 1241 |
| 195 | Ga0097621_100008850 | 3300006237 | Bacteria | 7277 |
| 196 | Ga0097621_100022260 | 3300006237 | Bacteria | 4918 |
| 197 | Ga0097621_100469840 | 3300006237 | Bacteria | 1136 |
| 198 | Ga0075370_10000101 | 3300006353 | Bacteria | 27175 |
| 199 | Ga0075370_10003489 | 3300006353 | Bacteria | 7492 |
| 200 | Ga0075370_10009745 | 3300006353 | Bacteria | 5002 |
| 201 | Ga0075370_10013018 | 3300006353 | Bacteria | 4413 |
| 202 | Ga0075370_10068296 | 3300006353 | Bacteria | 2030 |
| 203 | Ga0075370_10100492 | 3300006353 | Bacteria | 1674 |
| 204 | Ga0075370_10298457 | 3300006353 | Bacteria | 958 |
| 205 | Ga0068871_100061610 | 3300006358 | Bacteria | 3065 |
| 206 | Ga0068871_100116623 | 3300006358 | Bacteria | 2251 |
| 207 | Ga0068871_100151494 | 3300006358 | Bacteria | 1978 |
| 208 | Ga0068871_100268515 | 3300006358 | Bacteria | 1490 |
| 209 | Ga0068871_100396258 | 3300006358 | Bacteria | 1229 |
| 210 | Ga0068871_100570288 | 3300006358 | Bacteria | 1027 |
| 211 | Ga0068871_100780628 | 3300006358 | Bacteria | 880 |
| 212 | Ga0068865_100001470 | 3300006881 | Bacteria | 13711 |
| 213 | Ga0068865_100004220 | 3300006881 | Bacteria | 8664 |
| 214 | Ga0068865_100135512 | 3300006881 | Bacteria | 1850 |
| 215 | Ga0068865_101507896 | 3300006881 | Bacteria | 603 |
| 216 | Ga0097620_100039889 | 3300006931 | Bacteria | 4712 |
| 217 | Ga0097620_100492746 | 3300006931 | Unclassified | 1321 |
| 218 | Ga0075435_100617748 | 3300007076 | Bacteria | 940 |
| 219 | Ga0099795_10146531 | 3300007788 | Bacteria | 964 |
| 220 | Ga0105240_10767524 | 3300009093 | Bacteria | 1047 |
| 221 | Ga0111539_11014385 | 3300009094 | Bacteria | 965 |
| 222 | Ga0105245_10045639 | 3300009098 | Bacteria | 3914 |
| 223 | Ga0105245_10053156 | 3300009098 | Bacteria | 3635 |
| 224 | Ga0105245_10147839 | 3300009098 | Bacteria | 2218 |
| 225 | Ga0105247_10295951 | 3300009101 | Bacteria | 1121 |
| 226 | Ga0105243_10009717 | 3300009148 | Bacteria | 7326 |
| 227 | Ga0105243_10107881 | 3300009148 | Bacteria | 2323 |
| 228 | Ga0105241_10310874 | 3300009174 | Bacteria | 1356 |
| 229 | Ga0105242_10028362 | 3300009176 | Bacteria | 4456 |
| 230 | Ga0105242_10133204 | 3300009176 | Bacteria | 2148 |
| 231 | Ga0105242_10698144 | 3300009176 | Bacteria | 992 |
| 232 | Ga0105242_10815350 | 3300009176 | Bacteria | 925 |
| 233 | Ga0105248_10016659 | 3300009177 | Bacteria | 8090 |
| 234 | Ga0105248_10024939 | 3300009177 | Bacteria | 6647 |
| 235 | Ga0105248_10205361 | 3300009177 | Bacteria | 2220 |
| 236 | Ga0105248_10262936 | 3300009177 | Bacteria | 1942 |
| 237 | Ga0105248_10340107 | 3300009177 | Bacteria | 1690 |
| 238 | Ga0105248_10368979 | 3300009177 | Bacteria | 1616 |
| 239 | Ga0105248_10795155 | 3300009177 | Bacteria | 1068 |
| 240 | Ga0105248_11599286 | 3300009177 | Bacteria | 738 |
| 241 | Ga0105237_10737335 | 3300009545 | Bacteria | 992 |
| 242 | Ga0105238_10129652 | 3300009551 | Bacteria | 2500 |
| 243 | Ga0105238_10199888 | 3300009551 | Bacteria | 1974 |
| 244 | Ga0105249_10006697 | 3300009553 | Bacteria | 10036 |
| 245 | Ga0105249_10020193 | 3300009553 | Bacteria | 5953 |
| 246 | Ga0105239_10050731 | 3300010375 | Bacteria | 4549 |
| 247 | Ga0105239_10057462 | 3300010375 | Bacteria | 4268 |
| 248 | Ga0105239_10479709 | 3300010375 | Bacteria | 1413 |
| 249 | Ga0157373_10056085 | 3300013100 | Bacteria | 2798 |
| 250 | Ga0157371_10044279 | 3300013102 | Bacteria | 3169 |
| 251 | Ga0157371_10163818 | 3300013102 | Bacteria | 1588 |
| 252 | Ga0157370_10292270 | 3300013104 | Bacteria | 1505 |
| 253 | Ga0157370_10511963 | 3300013104 | Bacteria | 1102 |
| 254 | Ga0157369_10015460 | 3300013105 | Bacteria | 8600 |
| 255 | Ga0157369_10121995 | 3300013105 | Bacteria | 2764 |
| 256 | Ga0157369_10717871 | 3300013105 | Bacteria | 1029 |
| 257 | Ga0157374_10009658 | 3300013296 | Bacteria | 8284 |
| 258 | Ga0157374_10054250 | 3300013296 | Bacteria | 3739 |
| 259 | Ga0157374_10140338 | 3300013296 | Bacteria | 2345 |
| 260 | Ga0157374_10358854 | 3300013296 | Bacteria | 1449 |
| 261 | Ga0157374_11460756 | 3300013296 | Bacteria | 707 |
| 262 | Ga0157378_10002867 | 3300013297 | Bacteria | 15374 |
| 263 | Ga0157378_10100111 | 3300013297 | Bacteria | 2645 |
| 264 | Ga0157378_10361287 | 3300013297 | Bacteria | 1421 |
| 265 | Ga0157378_10526364 | 3300013297 | Bacteria | 1184 |
| 266 | Ga0157378_10614164 | 3300013297 | Bacteria | 1100 |
| 267 | Ga0163162_10018170 | 3300013306 | Bacteria | 6886 |
| 268 | Ga0163162_10126710 | 3300013306 | Bacteria | 2660 |
| 269 | Ga0163162_10274617 | 3300013306 | Bacteria | 1817 |
| 270 | Ga0163162_10617515 | 3300013306 | Bacteria | 1209 |
| 271 | Ga0163162_11575847 | 3300013306 | Bacteria | 749 |
| 272 | Ga0157372_10156872 | 3300013307 | Bacteria | 2629 |
| 273 | Ga0157372_10694628 | 3300013307 | Bacteria | 1184 |
| 274 | Ga0157375_10005937 | 3300013308 | Bacteria | 10642 |
| 275 | Ga0157375_10138694 | 3300013308 | Bacteria | 2557 |
| 276 | Ga0157375_10683645 | 3300013308 | Bacteria | 1181 |
| 277 | Ga0157375_11002201 | 3300013308 | Bacteria | 975 |
| 278 | Ga0157375_11483675 | 3300013308 | Bacteria | 800 |
| 279 | Ga0163163_10283569 | 3300014325 | Bacteria | 1708 |
| 280 | Ga0157380_10001842 | 3300014326 | Bacteria | 14019 |
| 281 | Ga0157380_10004961 | 3300014326 | Bacteria | 9272 |
| 282 | Ga0157380_10028623 | 3300014326 | Bacteria | 4251 |
| 283 | Ga0157380_11714647 | 3300014326 | Bacteria | 686 |
| 284 | Ga0157377_10041978 | 3300014745 | Bacteria | 2539 |
| 285 | Ga0157377_10514962 | 3300014745 | Bacteria | 839 |
| 286 | Ga0157379_10010369 | 3300014968 | Bacteria | 8119 |
| 287 | Ga0157379_10022863 | 3300014968 | Bacteria | 5541 |
| 288 | Ga0157379_10054527 | 3300014968 | Bacteria | 3572 |
| 289 | Ga0157376_10005027 | 3300014969 | Bacteria | 9221 |
| 290 | Ga0157376_10394781 | 3300014969 | Bacteria | 1336 |
| 291 | Ga0163161_10003912 | 3300017792 | Bacteria | 10448 |
| 292 | Ga0163161_10018887 | 3300017792 | Bacteria | 4833 |
| 293 | Ga0163161_10358088 | 3300017792 | Bacteria | 1161 |
| 294 | Ga0163161_10589607 | 3300017792 | Bacteria | 915 |
| 295 | Ga0213876_10108926 | 3300021384 | Bacteria | 1470 |
| 296 | Ga0207425_1001646 | 3300025245 | Bacteria | 8994 |
| 297 | Ga0209129_1000124 | 3300025258 | Bacteria | 133610 |
| 298 | Ga0209129_1010372 | 3300025258 | Bacteria | 2331 |
| 299 | Ga0209673_1013941 | 3300025273 | Bacteria | 3141 |
| 300 | Ga0209564_1000057 | 3300025295 | Bacteria | 340400 |
| 301 | Ga0209758_1000214 | 3300025297 | Bacteria | 126364 |
| 302 | Ga0209758_1000232 | 3300025297 | Bacteria | 117382 |
| 303 | Ga0209050_1001962 | 3300025298 | Bacteria | 19466 |
| 304 | Ga0207697_10121369 | 3300025315 | Bacteria | 1125 |
| 305 | Ga0207656_10120352 | 3300025321 | Bacteria | 1222 |
| 306 | Ga0207656_10162776 | 3300025321 | Bacteria | 1063 |
| 307 | Ga0207656_10179636 | 3300025321 | Bacteria | 1015 |
| 308 | Ga0207656_10270796 | 3300025321 | Bacteria | 836 |
| 309 | Ga0207682_10032102 | 3300025893 | Bacteria | 2110 |
| 310 | Ga0207682_10157473 | 3300025893 | Bacteria | 1027 |
| 311 | Ga0207682_10212261 | 3300025893 | Bacteria | 893 |
| 312 | Ga0207642_10008108 | 3300025899 | Bacteria | 3586 |
| 313 | Ga0207642_10011248 | 3300025899 | Bacteria | 3185 |
| 314 | Ga0207688_10082590 | 3300025901 | Bacteria | 1836 |
| 315 | Ga0207680_10005603 | 3300025903 | Bacteria | 6008 |
| 316 | Ga0207680_10105518 | 3300025903 | Bacteria | 1818 |
| 317 | Ga0207645_10005684 | 3300025907 | Bacteria | 9010 |
| 318 | Ga0207645_10005861 | 3300025907 | Bacteria | 8853 |
| 319 | Ga0207645_10009034 | 3300025907 | Bacteria | 6919 |
| 320 | Ga0207643_10069703 | 3300025908 | Bacteria | 2021 |
| 321 | Ga0207643_10112001 | 3300025908 | Bacteria | 1608 |
| 322 | Ga0207705_10276060 | 3300025909 | Bacteria | 1286 |
| 323 | Ga0207705_10485534 | 3300025909 | Bacteria | 959 |
| 324 | Ga0207684_10023526 | 3300025910 | Bacteria | 5261 |
| 325 | Ga0207707_11040437 | 3300025912 | Bacteria | 670 |
| 326 | Ga0207662_10002506 | 3300025918 | Bacteria | 9229 |
| 327 | Ga0207662_10095739 | 3300025918 | Bacteria | 1833 |
| 328 | Ga0207657_10051902 | 3300025919 | Bacteria | 3562 |
| 329 | Ga0207657_10084038 | 3300025919 | Bacteria | 2669 |
| 330 | Ga0207657_10128705 | 3300025919 | Bacteria | 2077 |
| 331 | Ga0207649_10225487 | 3300025920 | Bacteria | 1337 |
| 332 | Ga0207649_10229311 | 3300025920 | Bacteria | 1327 |
| 333 | Ga0207652_10693821 | 3300025921 | Bacteria | 909 |
| 334 | Ga0207681_10000205 | 3300025923 | Bacteria | 47034 |
| 335 | Ga0207681_10102559 | 3300025923 | Bacteria | 2066 |
| 336 | Ga0207694_10038457 | 3300025924 | Bacteria | 3679 |
| 337 | Ga0207694_11100775 | 3300025924 | Bacteria | 672 |
| 338 | Ga0207650_10007303 | 3300025925 | Bacteria | 7524 |
| 339 | Ga0207650_10236091 | 3300025925 | Bacteria | 1476 |
| 340 | Ga0207650_10286062 | 3300025925 | Bacteria | 1343 |
| 341 | Ga0207650_10737516 | 3300025925 | Bacteria | 833 |
| 342 | Ga0207650_10802864 | 3300025925 | Bacteria | 798 |
| 343 | Ga0207659_10005215 | 3300025926 | Bacteria | 7866 |
| 344 | Ga0207659_10010457 | 3300025926 | Bacteria | 5833 |
| 345 | Ga0207659_10079490 | 3300025926 | Bacteria | 2419 |
| 346 | Ga0207659_10493104 | 3300025926 | Bacteria | 1036 |
| 347 | Ga0207687_10059961 | 3300025927 | Bacteria | 2682 |
| 348 | Ga0207687_10151931 | 3300025927 | Bacteria | 1768 |
| 349 | Ga0207687_10210576 | 3300025927 | Bacteria | 1525 |
| 350 | Ga0207644_10003975 | 3300025931 | Bacteria | 9600 |
| 351 | Ga0207644_10079813 | 3300025931 | Bacteria | 2415 |
| 352 | Ga0207644_10185223 | 3300025931 | Bacteria | 1634 |
| 353 | Ga0207644_10282877 | 3300025931 | Bacteria | 1332 |
| 354 | Ga0207644_10917312 | 3300025931 | Bacteria | 734 |
| 355 | Ga0207644_10972056 | 3300025931 | Bacteria | 712 |
| 356 | Ga0207690_10759542 | 3300025932 | Bacteria | 800 |
| 357 | Ga0207706_10000933 | 3300025933 | Bacteria | 29885 |
| 358 | Ga0207706_10058975 | 3300025933 | Bacteria | 3380 |
| 359 | Ga0207706_10068601 | 3300025933 | Bacteria | 3120 |
| 360 | Ga0207706_10137030 | 3300025933 | Bacteria | 2153 |
| 361 | Ga0207686_10005743 | 3300025934 | Bacteria | 6654 |
| 362 | Ga0207686_10046007 | 3300025934 | Bacteria | 2689 |
| 363 | Ga0207686_10132229 | 3300025934 | Bacteria | 1713 |
| 364 | Ga0207709_10018850 | 3300025935 | Bacteria | 3870 |
| 365 | Ga0207709_10695097 | 3300025935 | Bacteria | 813 |
| 366 | Ga0207670_10073773 | 3300025936 | Bacteria | 2367 |
| 367 | Ga0207669_10017212 | 3300025937 | Bacteria | 3700 |
| 368 | Ga0207669_10178409 | 3300025937 | Bacteria | 1520 |
| 369 | Ga0207704_10001897 | 3300025938 | Bacteria | 9361 |
| 370 | Ga0207704_10008784 | 3300025938 | Bacteria | 4850 |
| 371 | Ga0207704_10103948 | 3300025938 | Bacteria | 1901 |
| 372 | Ga0207665_10408825 | 3300025939 | Bacteria | 1035 |
| 373 | Ga0207691_10057576 | 3300025940 | Bacteria | 3536 |
| 374 | Ga0207691_10088408 | 3300025940 | Bacteria | 2779 |
| 375 | Ga0207691_10108789 | 3300025940 | Bacteria | 2467 |
| 376 | Ga0207691_10116352 | 3300025940 | Bacteria | 2373 |
| 377 | Ga0207691_10130114 | 3300025940 | Bacteria | 2224 |
| 378 | Ga0207691_10183778 | 3300025940 | Bacteria | 1826 |
| 379 | Ga0207691_10305387 | 3300025940 | Bacteria | 1366 |
| 380 | Ga0207711_10046230 | 3300025941 | Bacteria | 3719 |
| 381 | Ga0207711_10073124 | 3300025941 | Bacteria | 2979 |
| 382 | Ga0207711_10094411 | 3300025941 | Bacteria | 2636 |
| 383 | Ga0207711_10118967 | 3300025941 | Bacteria | 2357 |
| 384 | Ga0207711_10130815 | 3300025941 | Bacteria | 2250 |
| 385 | Ga0207711_10182728 | 3300025941 | Bacteria | 1908 |
| 386 | Ga0207711_11093609 | 3300025941 | Bacteria | 738 |
| 387 | Ga0207689_10000150 | 3300025942 | Bacteria | 60037 |
| 388 | Ga0207689_10004063 | 3300025942 | Bacteria | 13296 |
| 389 | Ga0207689_10009202 | 3300025942 | Bacteria | 8543 |
| 390 | Ga0207689_10015594 | 3300025942 | Bacteria | 6436 |
| 391 | Ga0207689_10241497 | 3300025942 | Bacteria | 1493 |
| 392 | Ga0207679_10140349 | 3300025945 | Bacteria | 1952 |
| 393 | Ga0207679_10254378 | 3300025945 | Bacteria | 1495 |
| 394 | Ga0207679_10267929 | 3300025945 | Bacteria | 1459 |
| 395 | Ga0207679_10277740 | 3300025945 | Bacteria | 1435 |
| 396 | Ga0207679_10403696 | 3300025945 | Bacteria | 1203 |
| 397 | Ga0207679_10431039 | 3300025945 | Bacteria | 1166 |
| 398 | Ga0207679_10646531 | 3300025945 | Bacteria | 956 |
| 399 | Ga0207712_10195996 | 3300025961 | Bacteria | 1598 |
| 400 | Ga0207668_10005035 | 3300025972 | Bacteria | 7779 |
| 401 | Ga0207668_10159731 | 3300025972 | Bacteria | 1755 |
| 402 | Ga0207640_10016633 | 3300025981 | Bacteria | 4284 |
| 403 | Ga0207640_10061385 | 3300025981 | Bacteria | 2490 |
| 404 | Ga0207640_10159840 | 3300025981 | Bacteria | 1666 |
| 405 | Ga0207640_10221543 | 3300025981 | Bacteria | 1449 |
| 406 | Ga0207658_10004115 | 3300025986 | Bacteria | 10141 |
| 407 | Ga0207658_10012891 | 3300025986 | Bacteria | 5708 |
| 408 | Ga0207677_10012436 | 3300026023 | Bacteria | 4893 |
| 409 | Ga0207677_10361780 | 3300026023 | Bacteria | 1219 |
| 410 | Ga0207677_10491281 | 3300026023 | Bacteria | 1059 |
| 411 | Ga0207677_10630202 | 3300026023 | Bacteria | 944 |
| 412 | Ga0207703_10002955 | 3300026035 | Bacteria | 14418 |
| 413 | Ga0207703_10030559 | 3300026035 | Bacteria | 4258 |
| 414 | Ga0207703_10047106 | 3300026035 | Bacteria | 3475 |
| 415 | Ga0207703_11752365 | 3300026035 | Bacteria | 597 |
| 416 | Ga0207639_10053565 | 3300026041 | Bacteria | 3079 |
| 417 | Ga0207639_10097704 | 3300026041 | Bacteria | 2365 |
| 418 | Ga0207639_10340022 | 3300026041 | Bacteria | 1338 |
| 419 | Ga0207678_10002804 | 3300026067 | Bacteria | 15808 |
| 420 | Ga0207678_10002944 | 3300026067 | Bacteria | 15425 |
| 421 | Ga0207708_10026554 | 3300026075 | Bacteria | 4384 |
| 422 | Ga0207702_10046560 | 3300026078 | Bacteria | 3652 |
| 423 | Ga0207702_10329396 | 3300026078 | Bacteria | 1456 |
| 424 | Ga0207702_10460110 | 3300026078 | Bacteria | 1236 |
| 425 | Ga0207641_10003621 | 3300026088 | Bacteria | 13635 |
| 426 | Ga0207641_10053797 | 3300026088 | Bacteria | 3414 |
| 427 | Ga0207641_10303630 | 3300026088 | Bacteria | 1508 |
| 428 | Ga0207641_11304217 | 3300026088 | Bacteria | 726 |
| 429 | Ga0207648_10005311 | 3300026089 | Bacteria | 12992 |
| 430 | Ga0207648_10007556 | 3300026089 | Bacteria | 10668 |
| 431 | Ga0207648_10055085 | 3300026089 | Bacteria | 3472 |
| 432 | Ga0207648_10067687 | 3300026089 | Bacteria | 3113 |
| 433 | Ga0207648_10663180 | 3300026089 | Bacteria | 965 |
| 434 | Ga0207676_10138408 | 3300026095 | Bacteria | 2081 |
| 435 | Ga0207676_10212683 | 3300026095 | Bacteria | 1716 |
| 436 | Ga0207674_10020946 | 3300026116 | Bacteria | 7053 |
| 437 | Ga0207675_100001131 | 3300026118 | Bacteria | 26465 |
| 438 | Ga0207675_100009115 | 3300026118 | Bacteria | 9313 |
| 439 | Ga0207675_100087081 | 3300026118 | Bacteria | 2933 |
| 440 | Ga0207675_100835190 | 3300026118 | Bacteria | 936 |
| 441 | Ga0207683_10064766 | 3300026121 | Bacteria | 3222 |
| 442 | Ga0207683_10076183 | 3300026121 | Bacteria | 2970 |
| 443 | Ga0207683_10118663 | 3300026121 | Bacteria | 2373 |
| 444 | Ga0207683_10251001 | 3300026121 | Bacteria | 1615 |
| 445 | Ga0207683_10410869 | 3300026121 | Bacteria | 1246 |
| 446 | Ga0207683_10438610 | 3300026121 | Unclassified | 1204 |
| 447 | Ga0207683_10463914 | 3300026121 | Bacteria | 1168 |
| 448 | Ga0207698_10007726 | 3300026142 | Bacteria | 6747 |
| 449 | Ga0207698_10016066 | 3300026142 | Bacteria | 5035 |
| 450 | Ga0207698_10028013 | 3300026142 | Bacteria | 4010 |
| 451 | Ga0207698_10053123 | 3300026142 | Bacteria | 3108 |
| 452 | Ga0207698_10054479 | 3300026142 | Bacteria | 3077 |
| 453 | Ga0207698_10289791 | 3300026142 | Bacteria | 1519 |
| 454 | Ga0207698_10716708 | 3300026142 | Bacteria | 997 |
| 455 | Ga0207698_11013974 | 3300026142 | Bacteria | 841 |
| 456 | Ga0209813_10027757 | 3300027866 | Bacteria | 1646 |
| 457 | Ga0209813_10092905 | 3300027866 | Bacteria | 1016 |
| 458 | Ga0268266_10092320 | 3300028379 | Bacteria | 2656 |
| 459 | Ga0268266_10159657 | 3300028379 | Bacteria | 2038 |
| 460 | Ga0268265_10011173 | 3300028380 | Bacteria | 6068 |
| 461 | Ga0268265_10135120 | 3300028380 | Unclassified | 2056 |
| 462 | Ga0268264_10004410 | 3300028381 | Bacteria | 12007 |
| 463 | Ga0268264_10080643 | 3300028381 | Bacteria | 2779 |
| 464 | Ga0268264_10380331 | 3300028381 | Bacteria | 1352 |
| 465 | Ga0268264_10439710 | 3300028381 | Bacteria | 1261 |
| 466 | Ga0307517_10000810 | 3300028786 | Bacteria | 53724 |
| 467 | Ga0307517_10081360 | 3300028786 | Bacteria | 2762 |
| 468 | Ga0307517_10142655 | 3300028786 | Bacteria | 1675 |
| 469 | Ga0307515_10000381 | 3300028794 | Bacteria | 108373 |
| 470 | Ga0307515_10002386 | 3300028794 | Bacteria | 40952 |
| 471 | Ga0307515_10234812 | 3300028794 | Bacteria | 1617 |
| 472 | Ga0307512_10059161 | 3300030522 | Bacteria | 2977 |
| 473 | Ga0307512_10263606 | 3300030522 | Bacteria | 843 |
| 474 | Ga0307513_10004294 | 3300031456 | Bacteria | 19052 |
| 475 | Ga0307513_10026047 | 3300031456 | Bacteria | 6753 |
| 476 | Ga0307513_10275714 | 3300031456 | Bacteria | 1462 |
| 477 | Ga0307513_10485066 | 3300031456 | Bacteria | 955 |
| 478 | Ga0307513_10516057 | 3300031456 | Bacteria | 911 |
| 479 | Ga0307509_10050016 | 3300031507 | Bacteria | 4477 |
| 480 | Ga0307408_100168832 | 3300031548 | Bacteria | 1745 |
| 481 | Ga0307508_10000194 | 3300031616 | Bacteria | 73425 |
| 482 | Ga0307508_10002132 | 3300031616 | Bacteria | 21213 |
| 483 | Ga0307514_10011053 | 3300031649 | Bacteria | 7521 |
| 484 | Ga0307516_10118500 | 3300031730 | Bacteria | 2441 |
| 485 | Ga0307516_10208068 | 3300031730 | Bacteria | 1672 |
| 486 | Ga0307516_10212500 | 3300031730 | Bacteria | 1648 |
| 487 | Ga0307405_10078963 | 3300031731 | Bacteria | 2143 |
| 488 | Ga0307405_10100216 | 3300031731 | Bacteria | 1941 |
| 489 | Ga0307413_10093092 | 3300031824 | Bacteria | 1969 |
| 490 | Ga0307410_10026154 | 3300031852 | Bacteria | 3670 |
| 491 | Ga0307410_11018880 | 3300031852 | Bacteria | 715 |
| 492 | Ga0307406_10027772 | 3300031901 | Bacteria | 3413 |
| 493 | Ga0307406_10146179 | 3300031901 | Bacteria | 1680 |
| 494 | Ga0307407_10270625 | 3300031903 | Bacteria | 1172 |
| 495 | Ga0307412_10012955 | 3300031911 | Bacteria | 4876 |
| 496 | Ga0307412_10022329 | 3300031911 | Bacteria | 3878 |
| 497 | Ga0307409_100393451 | 3300031995 | Bacteria | 1321 |
| 498 | Ga0307409_100630024 | 3300031995 | Bacteria | 1064 |
| 499 | Ga0307409_100644887 | 3300031995 | Bacteria | 1052 |
| 500 | Ga0307416_100070299 | 3300032002 | Bacteria | 2902 |
| 501 | Ga0307416_100181522 | 3300032002 | Bacteria | 1973 |
| 502 | Ga0307414_10055647 | 3300032004 | Bacteria | 2771 |
| 503 | Ga0307411_10002725 | 3300032005 | Bacteria | 7925 |
| 504 | Ga0307411_10032732 | 3300032005 | Bacteria | 3216 |
| 505 | Ga0307415_100471881 | 3300032126 | Bacteria | 1090 |
| 506 | Ga0307507_10068293 | 3300033179 | Bacteria | 3244 |
| 507 | Ga0373928_0008445 | 3300035084 | Bacteria | 2000 |
| 508 | Ga0373929_0044302 | 3300035085 | Bacteria | 999 |
| 509 | Ga0373954_0146455 | 3300035118 | Bacteria | 1153 |
| 510 | Ga0373943_0051007 | 3300035170 | Bacteria | 2036 |
| 511 | Ga0373955_0464001 | 3300035172 | Bacteria | 772 |
| 512 | Ga0373947_0758003 | 3300035725 | Bacteria | 662 |
| 513 | Ga0373947_0800660 | 3300035725 | Bacteria | 643 |
| 514 | Ga0373937_0078199 | 3300036401 | Bacteria | 3057 |
| 515 | Ga0373925_0511525 | 3300037068 | Bacteria | 986 |
| 516 | Ga0395905_0073623 | 3300037471 | Bacteria | 3202 |
| 517 | Ga0436365_1519697 | 3300039437 | Bacteria | 1791 |
| 518 | Ga0451789_1281368 | 3300041443 | Bacteria | 916 |
| 519 | Ga0451791_0319493 | 3300041451 | Bacteria | 1145 |
| 520 | Ga0451793_1115609 | 3300041452 | Bacteria | 1591 |
| 521 | Ga0451795_1067193 | 3300041456 | Bacteria | 655 |
| 522 | Ga0451800_1406008 | 3300041459 | Bacteria | 669 |
| 523 | Ga0451835_0950027 | 3300041492 | Bacteria | 752 |
| 524 | Ga0451839_0760707 | 3300041496 | Bacteria | 2250 |
| 525 | Ga0451847_0835513 | 3300041503 | Bacteria | 713 |
| 526 | Ga0451849_0548321 | 3300041505 | Bacteria | 949 |
| 527 | Ga0451853_2274432 | 3300041512 | Bacteria | 757 |
| 528 | Ga0439455_0008563 | 3300042012 | Bacteria | 2195 |
| 529 | Ga0450894_012294 | 3300042131 | Bacteria | 1119 |
| 530 | Ga0439460_0006452 | 3300042461 | Bacteria | 2911 |
| 531 | Ga0451576_0567890 | 3300045051 | Bacteria | 1192 |
| 532 | Ga0495583_0044197 | 3300046506 | Bacteria | 2069 |
| 533 | Ga0495616_0174567 | 3300046513 | Bacteria | 959 |
| 534 | Ga0495620_0144858 | 3300046515 | Bacteria | 928 |
| 535 | Ga0495631_0094953 | 3300046518 | Bacteria | 1284 |
| 536 | Ga0495632_0003621 | 3300046519 | Bacteria | 10864 |
| 537 | Ga0495632_0011776 | 3300046519 | Bacteria | 5090 |
| 538 | Ga0495632_0175496 | 3300046519 | Bacteria | 983 |
| 539 | Ga0495632_0252601 | 3300046519 | Bacteria | 790 |
| 540 | Ga0495632_0315781 | 3300046519 | Bacteria | 691 |
| 541 | Ga0495643_0036252 | 3300046522 | Bacteria | 2711 |
| 542 | Ga0495648_0118920 | 3300046524 | Bacteria | 1424 |
| 543 | Ga0495648_0170745 | 3300046524 | Bacteria | 1115 |
| 544 | Ga0495645_0244432 | 3300046543 | Bacteria | 1196 |
| 545 | Ga0495668_0066901 | 3300046616 | Bacteria | 1977 |
| 546 | Ga0495611_0043832 | 3300046648 | Bacteria | 2001 |
| 547 | Ga0495625_0006631 | 3300046660 | Bacteria | 10274 |
| 548 | Ga0495625_0146920 | 3300046660 | Bacteria | 1587 |
| 549 | Ga0495635_0353614 | 3300046663 | Bacteria | 980 |
| 550 | Ga0495647_0040042 | 3300046681 | Bacteria | 1779 |
| 551 | Ga0495658_0012994 | 3300046683 | Bacteria | 4230 |
| 552 | Ga0495658_0043733 | 3300046683 | Bacteria | 2507 |
| 553 | Ga0495649_0013683 | 3300046694 | Bacteria | 4676 |
| 554 | Ga0495660_0034709 | 3300046810 | Bacteria | 2821 |
| 555 | Ga0495687_000196 | 3300047443 | Bacteria | 87053 |
| 556 | Ga0495687_022632 | 3300047443 | Bacteria | 3013 |
| 557 | Ga0495687_032090 | 3300047443 | Bacteria | 2402 |
| 558 | Ga0495686_0341365 | 3300047472 | Bacteria | 816 |
| 559 | Ga0496100_0123007 | 3300048903 | Bacteria | 1818 |
| 560 | Ga0496101_0617782 | 3300048904 | Bacteria | 857 |
| 561 | Ga0496104_0127565 | 3300048907 | Bacteria | 2443 |
| 562 | Ga0496104_1116472 | 3300048907 | Bacteria | 692 |
| 563 | Ga0496105_0392841 | 3300048908 | Bacteria | 1102 |
| 564 | Ga0496105_0450813 | 3300048908 | Bacteria | 1016 |
| 565 | Ga0496106_0072734 | 3300048909 | Bacteria | 2629 |
| 566 | Ga0496107_0009370 | 3300048910 | Bacteria | 6788 |
| 567 | Ga0496108_0243780 | 3300048911 | Bacteria | 1563 |
| 568 | Ga0496109_0028870 | 3300048912 | Bacteria | 4966 |
| 569 | Ga0496109_0627952 | 3300048912 | Bacteria | 1011 |
| 570 | Ga0496110_0230701 | 3300048913 | Bacteria | 1684 |
| 571 | Ga0496110_0761969 | 3300048913 | Bacteria | 871 |
| 572 | Ga0496111_0152684 | 3300048914 | Bacteria | 1713 |
| 573 | Ga0496112_0541582 | 3300048915 | Bacteria | 1098 |
| 574 | Ga0496113_0572087 | 3300048916 | Bacteria | 906 |
| 575 | Ga0496114_0062115 | 3300048917 | Bacteria | 3126 |
| 576 | Ga0496114_0111742 | 3300048917 | Bacteria | 2342 |
| 577 | Ga0496115_0283821 | 3300048918 | Bacteria | 1359 |
| 578 | Ga0501043_0000004 | 3300049579 | Bacteria | 291085 |
| 579 | Ga0501046_0000050 | 3300049580 | Bacteria | 134922 |
| 580 | Ga0501047_0000012 | 3300049581 | Bacteria | 368824 |
| 581 | Ga0501047_0078376 | 3300049581 | Bacteria | 3177 |
| 582 | Ga0501048_0004275 | 3300049582 | Bacteria | 10882 |
| 583 | Ga0501257_068131 | 3300049686 | Bacteria | 906 |
| 584 | Ga0501262_039130 | 3300049759 | Bacteria | 704 |
| 585 | Ga0501044_0217344 | 3300049823 | Bacteria | 1863 |
| 586 | Ga0501045_0049296 | 3300049824 | Bacteria | 3070 |
| 587 | nmdc:mga03683_40529_c1 | 3300050489 | Bacteria | 1910 |
| 588 | nmdc:mga03n38_5373_c1 | 3300050490 | Bacteria | 4354 |
| 589 | nmdc:mga0k408_1682_c1 | 3300050493 | Bacteria | 11938 |
| 590 | nmdc:mga0k408_16862_c1 | 3300050493 | Bacteria | 4061 |
| 591 | nmdc:mga0k408_190792_c1 | 3300050493 | Bacteria | 1223 |
| 592 | nmdc:mga0k408_201322_c1 | 3300050493 | Bacteria | 1189 |
| 593 | nmdc:mga0k408_243127_c1 | 3300050493 | Bacteria | 1075 |
| 594 | nmdc:mga0k408_45759_c1 | 3300050493 | Bacteria | 2526 |
| 595 | nmdc:mga0k408_59608_c1 | 3300050493 | Bacteria | 2218 |
| 596 | nmdc:mga0k408_695_c1 | 3300050493 | Bacteria | 18463 |
| 597 | nmdc:mga0k408_6998_c1 | 3300050493 | Bacteria | 6018 |
| 598 | nmdc:mga06z11_104541_c1 | 3300050494 | Bacteria | 1559 |
| 599 | nmdc:mga06z11_156159_c1 | 3300050494 | Bacteria | 1301 |
| 600 | nmdc:mga04h51_38905_c1 | 3300050495 | Bacteria | 1542 |
| 601 | nmdc:mga07m45_1045_c1 | 3300050496 | Bacteria | 12330 |
| 602 | nmdc:mga07m45_185787_c1 | 3300050496 | Bacteria | 1209 |
| 603 | nmdc:mga07m45_22889_c1 | 3300050496 | Bacteria | 3413 |
| 604 | nmdc:mga07m45_24407_c1 | 3300050496 | Bacteria | 3312 |
| 605 | nmdc:mga07m45_349480_c1 | 3300050496 | Bacteria | 859 |
| 606 | nmdc:mga07m45_54386_c1 | 3300050496 | Bacteria | 2263 |
| 607 | nmdc:mga08y16_471897_c1 | 3300050511 | Bacteria | 1277 |
| 608 | nmdc:mga0n895_103710_c1 | 3300050512 | Bacteria | 2855 |
| 609 | nmdc:mga0sz30_123221_c1 | 3300050516 | Bacteria | 1140 |
| 610 | nmdc:mga0sz30_52910_c1 | 3300050516 | Bacteria | 1724 |
| 611 | Ga0495601_0373953 | 3300053077 | Bacteria | 925 |
| 612 | Ga0495595_0037426 | 3300053084 | Bacteria | 2206 |
| 613 | Ga0500643_043685 | 3300053087 | Bacteria | 1306 |
| 614 | Ga0500651_0080479 | 3300053093 | Bacteria | 2017 |
| 615 | Ga0500651_0336097 | 3300053093 | Bacteria | 860 |
| 616 | Ga0500651_0486450 | 3300053093 | Bacteria | 682 |
| 617 | Ga0500562_025890 | 3300053108 | Bacteria | 1537 |
| 618 | Ga0500642_0002746 | 3300053130 | Bacteria | 5212 |
| 619 | Ga0500642_0032574 | 3300053130 | Bacteria | 2188 |
| 620 | Ga0500652_000155 | 3300053131 | Bacteria | 26280 |
| 621 | Ga0500658_0003329 | 3300053134 | Bacteria | 6093 |
| 622 | Ga0500658_0056441 | 3300053134 | Bacteria | 1620 |
| 623 | Ga0500568_0018673 | 3300053139 | Bacteria | 3028 |
| 624 | Ga0500622_0000423 | 3300053156 | Bacteria | 40034 |
| 625 | Ga0500627_0182952 | 3300053158 | Bacteria | 943 |
| 626 | Ga0500570_124659 | 3300053724 | Bacteria | 999 |
| 627 | Ga0500587_001023 | 3300053739 | Bacteria | 3789 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025918 | Ga0207662_10095739 | Ga0207662_100957392 | 161 |
| 2 | 3300005367 | Ga0070667_100264840 | Ga0070667_1002648402 | 165 |
| 3 | 3300042461 | Ga0439460_0006452 | Ga0439460_0006452_508_1056 | 166 |
| 4 | 3300005331 | Ga0070670_100212401 | Ga0070670_1002124013 | 168 |
| 5 | 3300005355 | Ga0070671_100031094 | Ga0070671_1000310945 | 168 |
| 6 | 3300005564 | Ga0070664_100614455 | Ga0070664_1006144552 | 168 |
| 7 | 3300005618 | Ga0068864_100092381 | Ga0068864_1000923811 | 168 |
| 8 | 3300005841 | Ga0068863_100469384 | Ga0068863_1004693842 | 168 |
| 9 | 3300006237 | Ga0097621_100469840 | Ga0097621_1004698402 | 168 |
| 10 | 3300006358 | Ga0068871_100780628 | Ga0068871_1007806282 | 168 |
| 11 | 3300013296 | Ga0157374_10358854 | Ga0157374_103588543 | 168 |
| 12 | 3300025909 | Ga0207705_10485534 | Ga0207705_104855342 | 168 |
| 13 | 3300025945 | Ga0207679_10431039 | Ga0207679_104310392 | 168 |
| 14 | 3300026023 | Ga0207677_10491281 | Ga0207677_104912812 | 168 |
| 15 | 3300026067 | Ga0207678_10002804 | Ga0207678_1000280412 | 168 |
| 16 | 3300026095 | Ga0207676_10138408 | Ga0207676_101384083 | 168 |
| 17 | 3300026121 | Ga0207683_10118663 | Ga0207683_101186633 | 168 |
| 18 | 3300046515 | Ga0495620_0144858 | Ga0495620_0144858_98_643 | 168 |
| 19 | 3300048912 | Ga0496109_0627952 | Ga0496109_0627952_74_619 | 168 |
| 20 | 3300005330 | Ga0070690_100057629 | Ga0070690_1000576294 | 169 |
| 21 | 3300005334 | Ga0068869_100018976 | Ga0068869_1000189762 | 169 |
| 22 | 3300005338 | Ga0068868_100780116 | Ga0068868_1007801162 | 169 |
| 23 | 3300005340 | Ga0070689_100056678 | Ga0070689_1000566782 | 169 |
| 24 | 3300005341 | Ga0070691_10006362 | Ga0070691_100063624 | 169 |
| 25 | 3300005343 | Ga0070687_100387055 | Ga0070687_1003870551 | 169 |
| 26 | 3300005345 | Ga0070692_10176509 | Ga0070692_101765091 | 169 |
| 27 | 3300005438 | Ga0070701_10005622 | Ga0070701_100056223 | 169 |
| 28 | 3300005441 | Ga0070700_100003632 | Ga0070700_1000036325 | 169 |
| 29 | 3300005444 | Ga0070694_100099115 | Ga0070694_1000991152 | 169 |
| 30 | 3300005458 | Ga0070681_10277226 | Ga0070681_102772261 | 169 |
| 31 | 3300005459 | Ga0068867_100010500 | Ga0068867_1000105004 | 169 |
| 32 | 3300005466 | Ga0070685_10590976 | Ga0070685_105909762 | 169 |
| 33 | 3300005544 | Ga0070686_100010433 | Ga0070686_1000104334 | 169 |
| 34 | 3300005546 | Ga0070696_100224312 | Ga0070696_1002243122 | 169 |
| 35 | 3300005546 | Ga0070696_100687959 | Ga0070696_1006879592 | 169 |
| 36 | 3300005547 | Ga0070693_100033937 | Ga0070693_1000339372 | 169 |
| 37 | 3300005549 | Ga0070704_100034645 | Ga0070704_1000346454 | 169 |
| 38 | 3300005615 | Ga0070702_100002012 | Ga0070702_1000020125 | 169 |
| 39 | 3300005617 | Ga0068859_100492687 | Ga0068859_1004926871 | 169 |
| 40 | 3300005718 | Ga0068866_10006667 | Ga0068866_100066674 | 169 |
| 41 | 3300005719 | Ga0068861_100014498 | Ga0068861_1000144984 | 169 |
| 42 | 3300005840 | Ga0068870_10107341 | Ga0068870_101073412 | 169 |
| 43 | 3300005842 | Ga0068858_100036965 | Ga0068858_1000369656 | 169 |
| 44 | 3300005843 | Ga0068860_100499385 | Ga0068860_1004993851 | 169 |
| 45 | 3300005844 | Ga0068862_100117932 | Ga0068862_1001179324 | 169 |
| 46 | 3300006237 | Ga0097621_100008850 | Ga0097621_1000088504 | 169 |
| 47 | 3300006358 | Ga0068871_100151494 | Ga0068871_1001514941 | 169 |
| 48 | 3300006881 | Ga0068865_100004220 | Ga0068865_1000042205 | 169 |
| 49 | 3300006931 | Ga0097620_100492746 | Ga0097620_1004927461 | 169 |
| 50 | 3300009098 | Ga0105245_10053156 | Ga0105245_100531563 | 169 |
| 51 | 3300009148 | Ga0105243_10009717 | Ga0105243_100097176 | 169 |
| 52 | 3300009176 | Ga0105242_10028362 | Ga0105242_100283624 | 169 |
| 53 | 3300009177 | Ga0105248_10262936 | Ga0105248_102629361 | 169 |
| 54 | 3300009551 | Ga0105238_10199888 | Ga0105238_101998881 | 169 |
| 55 | 3300009553 | Ga0105249_10020193 | Ga0105249_100201934 | 169 |
| 56 | 3300013297 | Ga0157378_10002867 | Ga0157378_100028672 | 169 |
| 57 | 3300013306 | Ga0163162_10126710 | Ga0163162_101267104 | 169 |
| 58 | 3300013308 | Ga0157375_11483675 | Ga0157375_114836752 | 169 |
| 59 | 3300014326 | Ga0157380_10001842 | Ga0157380_100018427 | 169 |
| 60 | 3300025899 | Ga0207642_10008108 | Ga0207642_100081083 | 169 |
| 61 | 3300025908 | Ga0207643_10112001 | Ga0207643_101120012 | 169 |
| 62 | 3300025912 | Ga0207707_11040437 | Ga0207707_110404371 | 169 |
| 63 | 3300025927 | Ga0207687_10210576 | Ga0207687_102105762 | 169 |
| 64 | 3300025934 | Ga0207686_10005743 | Ga0207686_100057434 | 169 |
| 65 | 3300025935 | Ga0207709_10018850 | Ga0207709_100188501 | 169 |
| 66 | 3300025936 | Ga0207670_10073773 | Ga0207670_100737734 | 169 |
| 67 | 3300025938 | Ga0207704_10008784 | Ga0207704_100087842 | 169 |
| 68 | 3300025941 | Ga0207711_10182728 | Ga0207711_101827284 | 169 |
| 69 | 3300025942 | Ga0207689_10009202 | Ga0207689_100092024 | 169 |
| 70 | 3300026035 | Ga0207703_11752365 | Ga0207703_117523651 | 169 |
| 71 | 3300026089 | Ga0207648_10007556 | Ga0207648_100075565 | 169 |
| 72 | 3300026118 | Ga0207675_100009115 | Ga0207675_1000091158 | 169 |
| 73 | 3300028380 | Ga0268265_10135120 | Ga0268265_101351204 | 169 |
| 74 | 3300028381 | Ga0268264_10439710 | Ga0268264_104397102 | 169 |
| 75 | 3300031901 | Ga0307406_10027772 | Ga0307406_100277725 | 169 |
| 76 | 3300031995 | Ga0307409_100644887 | Ga0307409_1006448872 | 169 |
| 77 | 3300032005 | Ga0307411_10002725 | Ga0307411_100027252 | 169 |
| 78 | 3300003316 | rootH1_10065105 | rootH1_100651051 | 170 |
| 79 | 3300003322 | rootL2_10016479 | rootL2_100164792 | 170 |
| 80 | 3300005445 | Ga0070708_100156079 | Ga0070708_1001560793 | 170 |
| 81 | 3300005467 | Ga0070706_100001400 | Ga0070706_10000140012 | 170 |
| 82 | 3300005468 | Ga0070707_100024364 | Ga0070707_1000243644 | 170 |
| 83 | 3300005518 | Ga0070699_100067925 | Ga0070699_1000679253 | 170 |
| 84 | 3300006178 | Ga0075367_10007898 | Ga0075367_100078984 | 170 |
| 85 | 3300006353 | Ga0075370_10009745 | Ga0075370_100097456 | 170 |
| 86 | 3300006353 | Ga0075370_10068296 | Ga0075370_100682963 | 170 |
| 87 | 3300007076 | Ga0075435_100617748 | Ga0075435_1006177481 | 170 |
| 88 | 3300025910 | Ga0207684_10023526 | Ga0207684_100235263 | 170 |
| 89 | 3300050493 | nmdc:mga0k408_59608_c1 | nmdc:mga0k408_59608_c1_1640_2188 | 170 |
| 90 | 3300050496 | nmdc:mga07m45_24407_c1 | nmdc:mga07m45_24407_c1_629_1234 | 170 |
| 91 | 3300050516 | nmdc:mga0sz30_52910_c1 | nmdc:mga0sz30_52910_c1_888_1469 | 170 |
| 92 | 3300050496 | nmdc:mga07m45_54386_c1 | nmdc:mga07m45_54386_c1_605_1147 | 171 |
| 93 | 3300005843 | Ga0068860_100038970 | Ga0068860_1000389702 | 174 |
| 94 | 3300028381 | Ga0268264_10380331 | Ga0268264_103803312 | 174 |
| 95 | 3300042131 | Ga0450894_012294 | Ga0450894_012294_198_740 | 174 |
| 96 | 3300049581 | Ga0501047_0078376 | Ga0501047_0078376_2097_2627 | 174 |
| 97 | 3300049823 | Ga0501044_0217344 | Ga0501044_0217344_1162_1692 | 174 |
| 98 | 3300003316 | rootH1_10008702 | rootH1_100087022 | 175 |
| 99 | 3300005327 | Ga0070658_10102909 | Ga0070658_101029092 | 175 |
| 100 | 3300005329 | Ga0070683_100005352 | Ga0070683_1000053527 | 175 |
| 101 | 3300005331 | Ga0070670_100093239 | Ga0070670_1000932393 | 175 |
| 102 | 3300005339 | Ga0070660_100068835 | Ga0070660_1000688354 | 175 |
| 103 | 3300005355 | Ga0070671_100080213 | Ga0070671_1000802133 | 175 |
| 104 | 3300005355 | Ga0070671_101107475 | Ga0070671_1011074751 | 175 |
| 105 | 3300005366 | Ga0070659_100305056 | Ga0070659_1003050562 | 175 |
| 106 | 3300005456 | Ga0070678_100369736 | Ga0070678_1003697362 | 175 |
| 107 | 3300005535 | Ga0070684_100127611 | Ga0070684_1001276111 | 175 |
| 108 | 3300005539 | Ga0068853_100132036 | Ga0068853_1001320363 | 175 |
| 109 | 3300005547 | Ga0070693_100029302 | Ga0070693_1000293023 | 175 |
| 110 | 3300005548 | Ga0070665_100078999 | Ga0070665_1000789994 | 175 |
| 111 | 3300005564 | Ga0070664_100055141 | Ga0070664_1000551412 | 175 |
| 112 | 3300005578 | Ga0068854_100027581 | Ga0068854_1000275814 | 175 |
| 113 | 3300005614 | Ga0068856_100004035 | Ga0068856_1000040357 | 175 |
| 114 | 3300005616 | Ga0068852_100139459 | Ga0068852_1001394593 | 175 |
| 115 | 3300005834 | Ga0068851_10020198 | Ga0068851_100201986 | 175 |
| 116 | 3300005841 | Ga0068863_100067310 | Ga0068863_1000673103 | 175 |
| 117 | 3300005843 | Ga0068860_100176947 | Ga0068860_1001769474 | 175 |
| 118 | 3300006195 | Ga0075366_10165958 | Ga0075366_101659583 | 175 |
| 119 | 3300006881 | Ga0068865_100135512 | Ga0068865_1001355123 | 175 |
| 120 | 3300007788 | Ga0099795_10146531 | Ga0099795_101465312 | 175 |
| 121 | 3300009093 | Ga0105240_10767524 | Ga0105240_107675242 | 175 |
| 122 | 3300009545 | Ga0105237_10737335 | Ga0105237_107373352 | 175 |
| 123 | 3300009551 | Ga0105238_10129652 | Ga0105238_101296523 | 175 |
| 124 | 3300013100 | Ga0157373_10056085 | Ga0157373_100560852 | 175 |
| 125 | 3300013102 | Ga0157371_10044279 | Ga0157371_100442793 | 175 |
| 126 | 3300013105 | Ga0157369_10015460 | Ga0157369_100154602 | 175 |
| 127 | 3300013296 | Ga0157374_10140338 | Ga0157374_101403382 | 175 |
| 128 | 3300013297 | Ga0157378_10361287 | Ga0157378_103612873 | 175 |
| 129 | 3300013306 | Ga0163162_10617515 | Ga0163162_106175152 | 175 |
| 130 | 3300013307 | Ga0157372_10694628 | Ga0157372_106946282 | 175 |
| 131 | 3300013308 | Ga0157375_10138694 | Ga0157375_101386943 | 175 |
| 132 | 3300025321 | Ga0207656_10120352 | Ga0207656_101203522 | 175 |
| 133 | 3300025919 | Ga0207657_10051902 | Ga0207657_100519021 | 175 |
| 134 | 3300025920 | Ga0207649_10229311 | Ga0207649_102293111 | 175 |
| 135 | 3300025924 | Ga0207694_10038457 | Ga0207694_100384573 | 175 |
| 136 | 3300025925 | Ga0207650_10286062 | Ga0207650_102860622 | 175 |
| 137 | 3300025931 | Ga0207644_10282877 | Ga0207644_102828772 | 175 |
| 138 | 3300025931 | Ga0207644_10972056 | Ga0207644_109720561 | 175 |
| 139 | 3300025945 | Ga0207679_10277740 | Ga0207679_102777403 | 175 |
| 140 | 3300025981 | Ga0207640_10159840 | Ga0207640_101598403 | 175 |
| 141 | 3300026041 | Ga0207639_10053565 | Ga0207639_100535653 | 175 |
| 142 | 3300026078 | Ga0207702_10046560 | Ga0207702_100465607 | 175 |
| 143 | 3300026088 | Ga0207641_10053797 | Ga0207641_100537973 | 175 |
| 144 | 3300026116 | Ga0207674_10020946 | Ga0207674_100209467 | 175 |
| 145 | 3300026142 | Ga0207698_10007726 | Ga0207698_100077261 | 175 |
| 146 | 3300028379 | Ga0268266_10159657 | Ga0268266_101596572 | 175 |
| 147 | 3300028794 | Ga0307515_10234812 | Ga0307515_102348123 | 175 |
| 148 | 3300046524 | Ga0495648_0118920 | Ga0495648_0118920_65_604 | 175 |
| 149 | iso_pu_bacteria | 2585428062 | 2587754506 | 175 |
| 150 | iso_pu_bacteria | 2643221592 | 2643972552 | 175 |
| 151 | iso_pu_bacteria | 2643221625 | 2644138440 | 175 |
| 152 | iso_pu_bacteria | 2643221648 | 2644273060 | 175 |
| 153 | iso_pu_bacteria | 2643221654 | 2644302118 | 175 |
| 154 | 3300005288 | Ga0065714_10083810 | Ga0065714_100838103 | 176 |
| 155 | 3300021384 | Ga0213876_10108926 | Ga0213876_101089262 | 176 |
| 156 | 3300031548 | Ga0307408_100168832 | Ga0307408_1001688322 | 176 |
| 157 | 3300031731 | Ga0307405_10100216 | Ga0307405_101002163 | 176 |
| 158 | 3300031911 | Ga0307412_10012955 | Ga0307412_100129553 | 176 |
| 159 | 3300031995 | Ga0307409_100393451 | Ga0307409_1003934513 | 176 |
| 160 | 3300032126 | Ga0307415_100471881 | Ga0307415_1004718812 | 176 |
| 161 | 3300037471 | Ga0395905_0073623 | Ga0395905_0073623_2237_2788 | 176 |
| 162 | 3300039437 | Ga0436365_1519697 | Ga0436365_1519697_867_1409 | 176 |
| 163 | 3300042012 | Ga0439455_0008563 | Ga0439455_0008563_1401_1961 | 176 |
| 164 | iso_pu_bacteria | 2585428057 | 2587727832 | 176 |
| 165 | iso_pu_bacteria | 2585428058 | 2587733853 | 176 |
| 166 | 3300005327 | Ga0070658_10549331 | Ga0070658_105493311 | 177 |
| 167 | 3300005328 | Ga0070676_10003406 | Ga0070676_100034064 | 177 |
| 168 | 3300005328 | Ga0070676_10251400 | Ga0070676_102514002 | 177 |
| 169 | 3300005330 | Ga0070690_100008781 | Ga0070690_1000087815 | 177 |
| 170 | 3300005331 | Ga0070670_100009851 | Ga0070670_1000098517 | 177 |
| 171 | 3300005331 | Ga0070670_100022200 | Ga0070670_1000222003 | 177 |
| 172 | 3300005331 | Ga0070670_100559691 | Ga0070670_1005596912 | 177 |
| 173 | 3300005331 | Ga0070670_100634621 | Ga0070670_1006346212 | 177 |
| 174 | 3300005331 | Ga0070670_100837947 | Ga0070670_1008379471 | 177 |
| 175 | 3300005334 | Ga0068869_100069759 | Ga0068869_1000697593 | 177 |
| 176 | 3300005334 | Ga0068869_100247077 | Ga0068869_1002470773 | 177 |
| 177 | 3300005335 | Ga0070666_10007624 | Ga0070666_100076246 | 177 |
| 178 | 3300005335 | Ga0070666_10113018 | Ga0070666_101130184 | 177 |
| 179 | 3300005338 | Ga0068868_100001157 | Ga0068868_1000011577 | 177 |
| 180 | 3300005338 | Ga0068868_100020570 | Ga0068868_1000205707 | 177 |
| 181 | 3300005338 | Ga0068868_100489457 | Ga0068868_1004894572 | 177 |
| 182 | 3300005339 | Ga0070660_100469025 | Ga0070660_1004690252 | 177 |
| 183 | 3300005340 | Ga0070689_100158102 | Ga0070689_1001581023 | 177 |
| 184 | 3300005343 | Ga0070687_100001572 | Ga0070687_10000157210 | 177 |
| 185 | 3300005344 | Ga0070661_100332441 | Ga0070661_1003324412 | 177 |
| 186 | 3300005345 | Ga0070692_10158748 | Ga0070692_101587482 | 177 |
| 187 | 3300005347 | Ga0070668_100003697 | Ga0070668_1000036977 | 177 |
| 188 | 3300005353 | Ga0070669_100001896 | Ga0070669_10000189610 | 177 |
| 189 | 3300005353 | Ga0070669_100076757 | Ga0070669_1000767573 | 177 |
| 190 | 3300005354 | Ga0070675_100001801 | Ga0070675_1000018016 | 177 |
| 191 | 3300005354 | Ga0070675_100015725 | Ga0070675_1000157254 | 177 |
| 192 | 3300005354 | Ga0070675_100101108 | Ga0070675_1001011083 | 177 |
| 193 | 3300005354 | Ga0070675_100300711 | Ga0070675_1003007112 | 177 |
| 194 | 3300005354 | Ga0070675_100641931 | Ga0070675_1006419312 | 177 |
| 195 | 3300005355 | Ga0070671_100006533 | Ga0070671_1000065332 | 177 |
| 196 | 3300005355 | Ga0070671_100148544 | Ga0070671_1001485443 | 177 |
| 197 | 3300005355 | Ga0070671_100299367 | Ga0070671_1002993672 | 177 |
| 198 | 3300005356 | Ga0070674_100027973 | Ga0070674_1000279734 | 177 |
| 199 | 3300005356 | Ga0070674_100362131 | Ga0070674_1003621312 | 177 |
| 200 | 3300005356 | Ga0070674_100567373 | Ga0070674_1005673732 | 177 |
| 201 | 3300005364 | Ga0070673_100125273 | Ga0070673_1001252733 | 177 |
| 202 | 3300005365 | Ga0070688_100587624 | Ga0070688_1005876241 | 177 |
| 203 | 3300005366 | Ga0070659_101089857 | Ga0070659_1010898571 | 177 |
| 204 | 3300005367 | Ga0070667_100006750 | Ga0070667_10000675011 | 177 |
| 205 | 3300005367 | Ga0070667_100088937 | Ga0070667_1000889373 | 177 |
| 206 | 3300005438 | Ga0070701_10212132 | Ga0070701_102121322 | 177 |
| 207 | 3300005441 | Ga0070700_100049456 | Ga0070700_1000494564 | 177 |
| 208 | 3300005441 | Ga0070700_100340640 | Ga0070700_1003406402 | 177 |
| 209 | 3300005455 | Ga0070663_100315532 | Ga0070663_1003155321 | 177 |
| 210 | 3300005456 | Ga0070678_100046649 | Ga0070678_1000466493 | 177 |
| 211 | 3300005456 | Ga0070678_100084262 | Ga0070678_1000842622 | 177 |
| 212 | 3300005456 | Ga0070678_100278890 | Ga0070678_1002788902 | 177 |
| 213 | 3300005456 | Ga0070678_100324632 | Ga0070678_1003246322 | 177 |
| 214 | 3300005457 | Ga0070662_100000867 | Ga0070662_1000008679 | 177 |
| 215 | 3300005457 | Ga0070662_100033229 | Ga0070662_1000332293 | 177 |
| 216 | 3300005457 | Ga0070662_100110025 | Ga0070662_1001100252 | 177 |
| 217 | 3300005457 | Ga0070662_100110273 | Ga0070662_1001102733 | 177 |
| 218 | 3300005457 | Ga0070662_100961128 | Ga0070662_1009611281 | 177 |
| 219 | 3300005459 | Ga0068867_100027068 | Ga0068867_1000270684 | 177 |
| 220 | 3300005459 | Ga0068867_100088043 | Ga0068867_1000880434 | 177 |
| 221 | 3300005535 | Ga0070684_100027307 | Ga0070684_1000273076 | 177 |
| 222 | 3300005539 | Ga0068853_100002880 | Ga0068853_1000028807 | 177 |
| 223 | 3300005539 | Ga0068853_100275663 | Ga0068853_1002756633 | 177 |
| 224 | 3300005539 | Ga0068853_100591297 | Ga0068853_1005912971 | 177 |
| 225 | 3300005543 | Ga0070672_100049097 | Ga0070672_1000490973 | 177 |
| 226 | 3300005543 | Ga0070672_100052344 | Ga0070672_1000523443 | 177 |
| 227 | 3300005543 | Ga0070672_100098868 | Ga0070672_1000988683 | 177 |
| 228 | 3300005543 | Ga0070672_100150560 | Ga0070672_1001505603 | 177 |
| 229 | 3300005543 | Ga0070672_100474677 | Ga0070672_1004746772 | 177 |
| 230 | 3300005545 | Ga0070695_100369725 | Ga0070695_1003697252 | 177 |
| 231 | 3300005546 | Ga0070696_100570291 | Ga0070696_1005702911 | 177 |
| 232 | 3300005547 | Ga0070693_100467100 | Ga0070693_1004671002 | 177 |
| 233 | 3300005548 | Ga0070665_100672796 | Ga0070665_1006727962 | 177 |
| 234 | 3300005563 | Ga0068855_100051204 | Ga0068855_1000512046 | 177 |
| 235 | 3300005564 | Ga0070664_100034883 | Ga0070664_1000348833 | 177 |
| 236 | 3300005564 | Ga0070664_100115387 | Ga0070664_1001153873 | 177 |
| 237 | 3300005564 | Ga0070664_100362793 | Ga0070664_1003627933 | 177 |
| 238 | 3300005564 | Ga0070664_100528380 | Ga0070664_1005283802 | 177 |
| 239 | 3300005564 | Ga0070664_100821690 | Ga0070664_1008216901 | 177 |
| 240 | 3300005577 | Ga0068857_101497336 | Ga0068857_1014973361 | 177 |
| 241 | 3300005578 | Ga0068854_100247616 | Ga0068854_1002476163 | 177 |
| 242 | 3300005578 | Ga0068854_100304415 | Ga0068854_1003044152 | 177 |
| 243 | 3300005615 | Ga0070702_100014791 | Ga0070702_1000147912 | 177 |
| 244 | 3300005616 | Ga0068852_100048509 | Ga0068852_1000485094 | 177 |
| 245 | 3300005616 | Ga0068852_100054887 | Ga0068852_1000548873 | 177 |
| 246 | 3300005616 | Ga0068852_100072682 | Ga0068852_1000726823 | 177 |
| 247 | 3300005616 | Ga0068852_100189947 | Ga0068852_1001899473 | 177 |
| 248 | 3300005616 | Ga0068852_100447083 | Ga0068852_1004470832 | 177 |
| 249 | 3300005617 | Ga0068859_100039890 | Ga0068859_1000398904 | 177 |
| 250 | 3300005618 | Ga0068864_100024340 | Ga0068864_1000243403 | 177 |
| 251 | 3300005618 | Ga0068864_100130063 | Ga0068864_1001300632 | 177 |
| 252 | 3300005718 | Ga0068866_10024416 | Ga0068866_100244163 | 177 |
| 253 | 3300005719 | Ga0068861_100003855 | Ga0068861_10000385511 | 177 |
| 254 | 3300005719 | Ga0068861_100062057 | Ga0068861_1000620573 | 177 |
| 255 | 3300005834 | Ga0068851_10009705 | Ga0068851_100097056 | 177 |
| 256 | 3300005841 | Ga0068863_100058398 | Ga0068863_1000583983 | 177 |
| 257 | 3300005841 | Ga0068863_100195703 | Ga0068863_1001957032 | 177 |
| 258 | 3300005841 | Ga0068863_100323282 | Ga0068863_1003232822 | 177 |
| 259 | 3300005841 | Ga0068863_100570434 | Ga0068863_1005704342 | 177 |
| 260 | 3300005842 | Ga0068858_100010960 | Ga0068858_1000109603 | 177 |
| 261 | 3300005842 | Ga0068858_100160326 | Ga0068858_1001603262 | 177 |
| 262 | 3300005843 | Ga0068860_100003734 | Ga0068860_1000037348 | 177 |
| 263 | 3300005844 | Ga0068862_100032968 | Ga0068862_1000329684 | 177 |
| 264 | 3300006237 | Ga0097621_100022260 | Ga0097621_1000222602 | 177 |
| 265 | 3300006358 | Ga0068871_100061610 | Ga0068871_1000616103 | 177 |
| 266 | 3300006358 | Ga0068871_100116623 | Ga0068871_1001166233 | 177 |
| 267 | 3300006358 | Ga0068871_100268515 | Ga0068871_1002685152 | 177 |
| 268 | 3300006358 | Ga0068871_100396258 | Ga0068871_1003962581 | 177 |
| 269 | 3300006358 | Ga0068871_100570288 | Ga0068871_1005702882 | 177 |
| 270 | 3300006881 | Ga0068865_100001470 | Ga0068865_10000147010 | 177 |
| 271 | 3300006881 | Ga0068865_101507896 | Ga0068865_1015078961 | 177 |
| 272 | 3300006931 | Ga0097620_100039889 | Ga0097620_1000398894 | 177 |
| 273 | 3300009094 | Ga0111539_11014385 | Ga0111539_110143851 | 177 |
| 274 | 3300009098 | Ga0105245_10045639 | Ga0105245_100456393 | 177 |
| 275 | 3300009101 | Ga0105247_10295951 | Ga0105247_102959512 | 177 |
| 276 | 3300009174 | Ga0105241_10310874 | Ga0105241_103108742 | 177 |
| 277 | 3300009176 | Ga0105242_10133204 | Ga0105242_101332043 | 177 |
| 278 | 3300009176 | Ga0105242_10815350 | Ga0105242_108153502 | 177 |
| 279 | 3300009177 | Ga0105248_10016659 | Ga0105248_100166593 | 177 |
| 280 | 3300009177 | Ga0105248_10024939 | Ga0105248_100249396 | 177 |
| 281 | 3300009177 | Ga0105248_10205361 | Ga0105248_102053613 | 177 |
| 282 | 3300009177 | Ga0105248_10340107 | Ga0105248_103401072 | 177 |
| 283 | 3300009177 | Ga0105248_10368979 | Ga0105248_103689792 | 177 |
| 284 | 3300009177 | Ga0105248_11599286 | Ga0105248_115992861 | 177 |
| 285 | 3300009553 | Ga0105249_10006697 | Ga0105249_100066977 | 177 |
| 286 | 3300010375 | Ga0105239_10057462 | Ga0105239_100574623 | 177 |
| 287 | 3300013102 | Ga0157371_10163818 | Ga0157371_101638182 | 177 |
| 288 | 3300013104 | Ga0157370_10292270 | Ga0157370_102922703 | 177 |
| 289 | 3300013104 | Ga0157370_10511963 | Ga0157370_105119632 | 177 |
| 290 | 3300013105 | Ga0157369_10121995 | Ga0157369_101219952 | 177 |
| 291 | 3300013105 | Ga0157369_10717871 | Ga0157369_107178712 | 177 |
| 292 | 3300013296 | Ga0157374_10009658 | Ga0157374_100096587 | 177 |
| 293 | 3300013296 | Ga0157374_10054250 | Ga0157374_100542505 | 177 |
| 294 | 3300013296 | Ga0157374_11460756 | Ga0157374_114607562 | 177 |
| 295 | 3300013297 | Ga0157378_10100111 | Ga0157378_101001113 | 177 |
| 296 | 3300013306 | Ga0163162_10018170 | Ga0163162_100181704 | 177 |
| 297 | 3300013306 | Ga0163162_10274617 | Ga0163162_102746172 | 177 |
| 298 | 3300013307 | Ga0157372_10156872 | Ga0157372_101568723 | 177 |
| 299 | 3300013308 | Ga0157375_10005937 | Ga0157375_1000593714 | 177 |
| 300 | 3300013308 | Ga0157375_10683645 | Ga0157375_106836452 | 177 |
| 301 | 3300013308 | Ga0157375_11002201 | Ga0157375_110022012 | 177 |
| 302 | 3300014325 | Ga0163163_10283569 | Ga0163163_102835693 | 177 |
| 303 | 3300014326 | Ga0157380_10004961 | Ga0157380_1000496111 | 177 |
| 304 | 3300014326 | Ga0157380_10028623 | Ga0157380_100286233 | 177 |
| 305 | 3300014326 | Ga0157380_11714647 | Ga0157380_117146471 | 177 |
| 306 | 3300014745 | Ga0157377_10041978 | Ga0157377_100419783 | 177 |
| 307 | 3300014745 | Ga0157377_10514962 | Ga0157377_105149622 | 177 |
| 308 | 3300014968 | Ga0157379_10010369 | Ga0157379_100103693 | 177 |
| 309 | 3300014968 | Ga0157379_10022863 | Ga0157379_100228633 | 177 |
| 310 | 3300014968 | Ga0157379_10054527 | Ga0157379_100545273 | 177 |
| 311 | 3300014969 | Ga0157376_10005027 | Ga0157376_100050274 | 177 |
| 312 | 3300014969 | Ga0157376_10394781 | Ga0157376_103947812 | 177 |
| 313 | 3300017792 | Ga0163161_10003912 | Ga0163161_100039127 | 177 |
| 314 | 3300017792 | Ga0163161_10018887 | Ga0163161_100188874 | 177 |
| 315 | 3300017792 | Ga0163161_10358088 | Ga0163161_103580882 | 177 |
| 316 | 3300025315 | Ga0207697_10121369 | Ga0207697_101213692 | 177 |
| 317 | 3300025321 | Ga0207656_10179636 | Ga0207656_101796362 | 177 |
| 318 | 3300025321 | Ga0207656_10270796 | Ga0207656_102707962 | 177 |
| 319 | 3300025893 | Ga0207682_10032102 | Ga0207682_100321022 | 177 |
| 320 | 3300025893 | Ga0207682_10157473 | Ga0207682_101574732 | 177 |
| 321 | 3300025899 | Ga0207642_10011248 | Ga0207642_100112484 | 177 |
| 322 | 3300025901 | Ga0207688_10082590 | Ga0207688_100825903 | 177 |
| 323 | 3300025903 | Ga0207680_10005603 | Ga0207680_100056033 | 177 |
| 324 | 3300025903 | Ga0207680_10105518 | Ga0207680_101055182 | 177 |
| 325 | 3300025907 | Ga0207645_10005684 | Ga0207645_100056846 | 177 |
| 326 | 3300025907 | Ga0207645_10009034 | Ga0207645_100090347 | 177 |
| 327 | 3300025908 | Ga0207643_10069703 | Ga0207643_100697034 | 177 |
| 328 | 3300025909 | Ga0207705_10276060 | Ga0207705_102760602 | 177 |
| 329 | 3300025918 | Ga0207662_10002506 | Ga0207662_100025065 | 177 |
| 330 | 3300025919 | Ga0207657_10084038 | Ga0207657_100840383 | 177 |
| 331 | 3300025919 | Ga0207657_10128705 | Ga0207657_101287053 | 177 |
| 332 | 3300025920 | Ga0207649_10225487 | Ga0207649_102254873 | 177 |
| 333 | 3300025921 | Ga0207652_10693821 | Ga0207652_106938211 | 177 |
| 334 | 3300025923 | Ga0207681_10000205 | Ga0207681_1000020535 | 177 |
| 335 | 3300025923 | Ga0207681_10102559 | Ga0207681_101025592 | 177 |
| 336 | 3300025924 | Ga0207694_11100775 | Ga0207694_111007751 | 177 |
| 337 | 3300025925 | Ga0207650_10007303 | Ga0207650_100073038 | 177 |
| 338 | 3300025925 | Ga0207650_10737516 | Ga0207650_107375162 | 177 |
| 339 | 3300025925 | Ga0207650_10802864 | Ga0207650_108028641 | 177 |
| 340 | 3300025926 | Ga0207659_10005215 | Ga0207659_100052157 | 177 |
| 341 | 3300025926 | Ga0207659_10010457 | Ga0207659_100104574 | 177 |
| 342 | 3300025926 | Ga0207659_10079490 | Ga0207659_100794903 | 177 |
| 343 | 3300025926 | Ga0207659_10493104 | Ga0207659_104931042 | 177 |
| 344 | 3300025927 | Ga0207687_10059961 | Ga0207687_100599611 | 177 |
| 345 | 3300025931 | Ga0207644_10003975 | Ga0207644_100039754 | 177 |
| 346 | 3300025931 | Ga0207644_10079813 | Ga0207644_100798133 | 177 |
| 347 | 3300025931 | Ga0207644_10917312 | Ga0207644_109173122 | 177 |
| 348 | 3300025932 | Ga0207690_10759542 | Ga0207690_107595422 | 177 |
| 349 | 3300025933 | Ga0207706_10000933 | Ga0207706_1000093326 | 177 |
| 350 | 3300025933 | Ga0207706_10058975 | Ga0207706_100589754 | 177 |
| 351 | 3300025933 | Ga0207706_10068601 | Ga0207706_100686012 | 177 |
| 352 | 3300025933 | Ga0207706_10137030 | Ga0207706_101370303 | 177 |
| 353 | 3300025934 | Ga0207686_10046007 | Ga0207686_100460073 | 177 |
| 354 | 3300025934 | Ga0207686_10132229 | Ga0207686_101322293 | 177 |
| 355 | 3300025935 | Ga0207709_10695097 | Ga0207709_106950972 | 177 |
| 356 | 3300025937 | Ga0207669_10017212 | Ga0207669_100172124 | 177 |
| 357 | 3300025937 | Ga0207669_10178409 | Ga0207669_101784092 | 177 |
| 358 | 3300025938 | Ga0207704_10001897 | Ga0207704_100018973 | 177 |
| 359 | 3300025938 | Ga0207704_10103948 | Ga0207704_101039483 | 177 |
| 360 | 3300025939 | Ga0207665_10408825 | Ga0207665_104088252 | 177 |
| 361 | 3300025940 | Ga0207691_10057576 | Ga0207691_100575763 | 177 |
| 362 | 3300025940 | Ga0207691_10088408 | Ga0207691_100884083 | 177 |
| 363 | 3300025940 | Ga0207691_10108789 | Ga0207691_101087892 | 177 |
| 364 | 3300025940 | Ga0207691_10116352 | Ga0207691_101163522 | 177 |
| 365 | 3300025940 | Ga0207691_10130114 | Ga0207691_101301142 | 177 |
| 366 | 3300025940 | Ga0207691_10305387 | Ga0207691_103053871 | 177 |
| 367 | 3300025941 | Ga0207711_10046230 | Ga0207711_100462304 | 177 |
| 368 | 3300025941 | Ga0207711_10073124 | Ga0207711_100731244 | 177 |
| 369 | 3300025941 | Ga0207711_10094411 | Ga0207711_100944114 | 177 |
| 370 | 3300025941 | Ga0207711_10118967 | Ga0207711_101189673 | 177 |
| 371 | 3300025941 | Ga0207711_10130815 | Ga0207711_101308153 | 177 |
| 372 | 3300025941 | Ga0207711_11093609 | Ga0207711_110936092 | 177 |
| 373 | 3300025942 | Ga0207689_10000150 | Ga0207689_1000015053 | 177 |
| 374 | 3300025942 | Ga0207689_10004063 | Ga0207689_100040633 | 177 |
| 375 | 3300025945 | Ga0207679_10140349 | Ga0207679_101403492 | 177 |
| 376 | 3300025945 | Ga0207679_10254378 | Ga0207679_102543783 | 177 |
| 377 | 3300025945 | Ga0207679_10267929 | Ga0207679_102679293 | 177 |
| 378 | 3300025945 | Ga0207679_10646531 | Ga0207679_106465311 | 177 |
| 379 | 3300025961 | Ga0207712_10195996 | Ga0207712_101959963 | 177 |
| 380 | 3300025972 | Ga0207668_10005035 | Ga0207668_100050358 | 177 |
| 381 | 3300025972 | Ga0207668_10159731 | Ga0207668_101597313 | 177 |
| 382 | 3300025981 | Ga0207640_10061385 | Ga0207640_100613853 | 177 |
| 383 | 3300025981 | Ga0207640_10221543 | Ga0207640_102215433 | 177 |
| 384 | 3300025986 | Ga0207658_10012891 | Ga0207658_100128914 | 177 |
| 385 | 3300026023 | Ga0207677_10012436 | Ga0207677_100124365 | 177 |
| 386 | 3300026035 | Ga0207703_10002955 | Ga0207703_1000295510 | 177 |
| 387 | 3300026035 | Ga0207703_10030559 | Ga0207703_100305595 | 177 |
| 388 | 3300026035 | Ga0207703_10047106 | Ga0207703_100471064 | 177 |
| 389 | 3300026041 | Ga0207639_10097704 | Ga0207639_100977043 | 177 |
| 390 | 3300026041 | Ga0207639_10340022 | Ga0207639_103400222 | 177 |
| 391 | 3300026067 | Ga0207678_10002944 | Ga0207678_1000294410 | 177 |
| 392 | 3300026075 | Ga0207708_10026554 | Ga0207708_100265544 | 177 |
| 393 | 3300026078 | Ga0207702_10329396 | Ga0207702_103293963 | 177 |
| 394 | 3300026088 | Ga0207641_10003621 | Ga0207641_100036217 | 177 |
| 395 | 3300026088 | Ga0207641_10303630 | Ga0207641_103036302 | 177 |
| 396 | 3300026088 | Ga0207641_11304217 | Ga0207641_113042171 | 177 |
| 397 | 3300026089 | Ga0207648_10005311 | Ga0207648_100053115 | 177 |
| 398 | 3300026095 | Ga0207676_10212683 | Ga0207676_102126833 | 177 |
| 399 | 3300026118 | Ga0207675_100001131 | Ga0207675_10000113130 | 177 |
| 400 | 3300026118 | Ga0207675_100087081 | Ga0207675_1000870814 | 177 |
| 401 | 3300026121 | Ga0207683_10064766 | Ga0207683_100647663 | 177 |
| 402 | 3300026121 | Ga0207683_10076183 | Ga0207683_100761834 | 177 |
| 403 | 3300026121 | Ga0207683_10251001 | Ga0207683_102510012 | 177 |
| 404 | 3300026121 | Ga0207683_10410869 | Ga0207683_104108692 | 177 |
| 405 | 3300026121 | Ga0207683_10438610 | Ga0207683_104386101 | 177 |
| 406 | 3300026121 | Ga0207683_10463914 | Ga0207683_104639142 | 177 |
| 407 | 3300026142 | Ga0207698_10016066 | Ga0207698_100160665 | 177 |
| 408 | 3300026142 | Ga0207698_10028013 | Ga0207698_100280134 | 177 |
| 409 | 3300026142 | Ga0207698_10053123 | Ga0207698_100531232 | 177 |
| 410 | 3300026142 | Ga0207698_10289791 | Ga0207698_102897912 | 177 |
| 411 | 3300026142 | Ga0207698_10716708 | Ga0207698_107167082 | 177 |
| 412 | 3300026142 | Ga0207698_11013974 | Ga0207698_110139742 | 177 |
| 413 | 3300028380 | Ga0268265_10011173 | Ga0268265_100111737 | 177 |
| 414 | 3300028381 | Ga0268264_10004410 | Ga0268264_100044106 | 177 |
| 415 | 3300028381 | Ga0268264_10080643 | Ga0268264_100806433 | 177 |
| 416 | 3300035084 | Ga0373928_0008445 | Ga0373928_0008445_850_1395 | 177 |
| 417 | 3300035085 | Ga0373929_0044302 | Ga0373929_0044302_281_826 | 177 |
| 418 | 3300035170 | Ga0373943_0051007 | Ga0373943_0051007_1022_1567 | 177 |
| 419 | 3300035172 | Ga0373955_0464001 | Ga0373955_0464001_18_563 | 177 |
| 420 | 3300035725 | Ga0373947_0758003 | Ga0373947_0758003_85_630 | 177 |
| 421 | 3300036401 | Ga0373937_0078199 | Ga0373937_0078199_2112_2657 | 177 |
| 422 | 3300037068 | Ga0373925_0511525 | Ga0373925_0511525_61_606 | 177 |
| 423 | 3300041451 | Ga0451791_0319493 | Ga0451791_0319493_26_655 | 177 |
| 424 | 3300041456 | Ga0451795_1067193 | Ga0451795_1067193_23_571 | 177 |
| 425 | 3300045051 | Ga0451576_0567890 | Ga0451576_0567890_219_764 | 177 |
| 426 | 3300046543 | Ga0495645_0244432 | Ga0495645_0244432_470_1015 | 177 |
| 427 | 3300046663 | Ga0495635_0353614 | Ga0495635_0353614_159_704 | 177 |
| 428 | 3300046681 | Ga0495647_0040042 | Ga0495647_0040042_260_805 | 177 |
| 429 | 3300046683 | Ga0495658_0012994 | Ga0495658_0012994_3650_4195 | 177 |
| 430 | 3300046683 | Ga0495658_0043733 | Ga0495658_0043733_949_1494 | 177 |
| 431 | 3300048903 | Ga0496100_0123007 | Ga0496100_0123007_840_1385 | 177 |
| 432 | 3300048904 | Ga0496101_0617782 | Ga0496101_0617782_112_657 | 177 |
| 433 | 3300048907 | Ga0496104_0127565 | Ga0496104_0127565_221_766 | 177 |
| 434 | 3300048907 | Ga0496104_1116472 | Ga0496104_1116472_20_565 | 177 |
| 435 | 3300048908 | Ga0496105_0392841 | Ga0496105_0392841_70_615 | 177 |
| 436 | 3300048908 | Ga0496105_0450813 | Ga0496105_0450813_17_562 | 177 |
| 437 | 3300048909 | Ga0496106_0072734 | Ga0496106_0072734_1505_2050 | 177 |
| 438 | 3300048910 | Ga0496107_0009370 | Ga0496107_0009370_917_1462 | 177 |
| 439 | 3300048911 | Ga0496108_0243780 | Ga0496108_0243780_805_1350 | 177 |
| 440 | 3300048912 | Ga0496109_0028870 | Ga0496109_0028870_3401_3946 | 177 |
| 441 | 3300048913 | Ga0496110_0230701 | Ga0496110_0230701_811_1395 | 177 |
| 442 | 3300048913 | Ga0496110_0761969 | Ga0496110_0761969_122_667 | 177 |
| 443 | 3300048914 | Ga0496111_0152684 | Ga0496111_0152684_313_858 | 177 |
| 444 | 3300048915 | Ga0496112_0541582 | Ga0496112_0541582_442_987 | 177 |
| 445 | 3300048917 | Ga0496114_0062115 | Ga0496114_0062115_95_640 | 177 |
| 446 | 3300048917 | Ga0496114_0111742 | Ga0496114_0111742_939_1523 | 177 |
| 447 | 3300048918 | Ga0496115_0283821 | Ga0496115_0283821_339_884 | 177 |
| 448 | 3300049686 | Ga0501257_068131 | Ga0501257_068131_11_559 | 177 |
| 449 | 3300049759 | Ga0501262_039130 | Ga0501262_039130_15_605 | 177 |
| 450 | 3300050489 | nmdc:mga03683_40529_c1 | nmdc:mga03683_40529_c1_301_834 | 177 |
| 451 | 3300050493 | nmdc:mga0k408_16862_c1 | nmdc:mga0k408_16862_c1_1275_1808 | 177 |
| 452 | 3300050511 | nmdc:mga08y16_471897_c1 | nmdc:mga08y16_471897_c1_202_786 | 177 |
| 453 | 3300050512 | nmdc:mga0n895_103710_c1 | nmdc:mga0n895_103710_c1_645_1190 | 177 |
| 454 | 3300053077 | Ga0495601_0373953 | Ga0495601_0373953_282_827 | 177 |
| 455 | 3300053084 | Ga0495595_0037426 | Ga0495595_0037426_1420_1965 | 177 |
| 456 | 3300005338 | Ga0068868_100374913 | Ga0068868_1003749132 | 178 |
| 457 | 3300005356 | Ga0070674_101419264 | Ga0070674_1014192641 | 178 |
| 458 | 3300005543 | Ga0070672_100042239 | Ga0070672_1000422393 | 178 |
| 459 | 3300009176 | Ga0105242_10698144 | Ga0105242_106981441 | 178 |
| 460 | 3300025940 | Ga0207691_10183778 | Ga0207691_101837783 | 178 |
| 461 | 3300026023 | Ga0207677_10361780 | Ga0207677_103617801 | 178 |
| 462 | 3300026089 | Ga0207648_10663180 | Ga0207648_106631802 | 178 |
| 463 | 3300031731 | Ga0307405_10078963 | Ga0307405_100789632 | 178 |
| 464 | 3300031852 | Ga0307410_10026154 | Ga0307410_100261542 | 178 |
| 465 | 3300031901 | Ga0307406_10146179 | Ga0307406_101461792 | 178 |
| 466 | 3300031903 | Ga0307407_10270625 | Ga0307407_102706252 | 178 |
| 467 | 3300031911 | Ga0307412_10022329 | Ga0307412_100223292 | 178 |
| 468 | 3300032002 | Ga0307416_100181522 | Ga0307416_1001815222 | 178 |
| 469 | 3300032004 | Ga0307414_10055647 | Ga0307414_100556472 | 178 |
| 470 | 3300005331 | Ga0070670_100284617 | Ga0070670_1002846172 | 179 |
| 471 | 3300005367 | Ga0070667_100009471 | Ga0070667_1000094715 | 179 |
| 472 | 3300005548 | Ga0070665_100263121 | Ga0070665_1002631212 | 179 |
| 473 | 3300009098 | Ga0105245_10147839 | Ga0105245_101478393 | 179 |
| 474 | 3300009177 | Ga0105248_10795155 | Ga0105248_107951552 | 179 |
| 475 | 3300010375 | Ga0105239_10479709 | Ga0105239_104797092 | 179 |
| 476 | 3300017792 | Ga0163161_10589607 | Ga0163161_105896072 | 179 |
| 477 | 3300025298 | Ga0209050_1001962 | Ga0209050_100196220 | 179 |
| 478 | 3300025927 | Ga0207687_10151931 | Ga0207687_101519312 | 179 |
| 479 | 3300025986 | Ga0207658_10004115 | Ga0207658_100041153 | 179 |
| 480 | 3300028379 | Ga0268266_10092320 | Ga0268266_100923203 | 179 |
| 481 | 3300028786 | Ga0307517_10000810 | Ga0307517_1000081015 | 179 |
| 482 | 3300028794 | Ga0307515_10000381 | Ga0307515_1000038115 | 179 |
| 483 | 3300028794 | Ga0307515_10002386 | Ga0307515_1000238613 | 179 |
| 484 | 3300030522 | Ga0307512_10059161 | Ga0307512_100591614 | 179 |
| 485 | 3300030522 | Ga0307512_10263606 | Ga0307512_102636062 | 179 |
| 486 | 3300031456 | Ga0307513_10004294 | Ga0307513_100042944 | 179 |
| 487 | 3300031456 | Ga0307513_10026047 | Ga0307513_100260473 | 179 |
| 488 | 3300031456 | Ga0307513_10516057 | Ga0307513_105160572 | 179 |
| 489 | 3300031507 | Ga0307509_10050016 | Ga0307509_100500165 | 179 |
| 490 | 3300031616 | Ga0307508_10000194 | Ga0307508_1000019424 | 179 |
| 491 | 3300031649 | Ga0307514_10011053 | Ga0307514_100110536 | 179 |
| 492 | 3300031730 | Ga0307516_10118500 | Ga0307516_101185003 | 179 |
| 493 | 3300033179 | Ga0307507_10068293 | Ga0307507_100682932 | 179 |
| 494 | 3300041492 | Ga0451835_0950027 | Ga0451835_0950027_201_740 | 179 |
| 495 | 3300041496 | Ga0451839_0760707 | Ga0451839_0760707_1028_1567 | 179 |
| 496 | 3300041505 | Ga0451849_0548321 | Ga0451849_0548321_45_584 | 179 |
| 497 | 3300041512 | Ga0451853_2274432 | Ga0451853_2274432_82_621 | 179 |
| 498 | 3300046519 | Ga0495632_0175496 | Ga0495632_0175496_312_854 | 179 |
| 499 | 3300046519 | Ga0495632_0252601 | Ga0495632_0252601_105_644 | 179 |
| 500 | 3300046522 | Ga0495643_0036252 | Ga0495643_0036252_703_1242 | 179 |
| 501 | 3300046660 | Ga0495625_0006631 | Ga0495625_0006631_8601_9140 | 179 |
| 502 | 3300047472 | Ga0495686_0341365 | Ga0495686_0341365_18_557 | 179 |
| 503 | 3300048916 | Ga0496113_0572087 | Ga0496113_0572087_214_753 | 179 |
| 504 | 3300050493 | nmdc:mga0k408_243127_c1 | nmdc:mga0k408_243127_c1_206_745 | 179 |
| 505 | 3300053134 | Ga0500658_0056441 | Ga0500658_0056441_21_560 | 179 |
| 506 | 3300053739 | Ga0500587_001023 | Ga0500587_001023_1276_1815 | 179 |
| 507 | 3300002773 | JGI25152J39213_1000626 | JGI25152J39213_100062612 | 180 |
| 508 | 3300003215 | JGI25153J46596_10001224 | JGI25153J46596_100012243 | 180 |
| 509 | 3300003215 | JGI25153J46596_10005270 | JGI25153J46596_100052702 | 180 |
| 510 | 3300003215 | JGI25153J46596_10010478 | JGI25153J46596_100104785 | 180 |
| 511 | 3300003323 | rootH1_10172482 | rootH1_101724824 | 180 |
| 512 | 3300003771 | Ga0055526_1003267 | Ga0055526_10032674 | 180 |
| 513 | 3300005331 | Ga0070670_100054662 | Ga0070670_1000546625 | 180 |
| 514 | 3300005334 | Ga0068869_101100067 | Ga0068869_1011000671 | 180 |
| 515 | 3300005355 | Ga0070671_100134987 | Ga0070671_1001349872 | 180 |
| 516 | 3300005356 | Ga0070674_100016511 | Ga0070674_1000165116 | 180 |
| 517 | 3300005459 | Ga0068867_100077768 | Ga0068867_1000777683 | 180 |
| 518 | 3300005459 | Ga0068867_100099511 | Ga0068867_1000995113 | 180 |
| 519 | 3300005564 | Ga0070664_100737964 | Ga0070664_1007379642 | 180 |
| 520 | 3300005577 | Ga0068857_100298591 | Ga0068857_1002985913 | 180 |
| 521 | 3300005614 | Ga0068856_100022973 | Ga0068856_1000229736 | 180 |
| 522 | 3300005834 | Ga0068851_10147537 | Ga0068851_101475372 | 180 |
| 523 | 3300006042 | Ga0075368_10120844 | Ga0075368_101208442 | 180 |
| 524 | 3300006042 | Ga0075368_10271359 | Ga0075368_102713591 | 180 |
| 525 | 3300006048 | Ga0075363_100011747 | Ga0075363_1000117474 | 180 |
| 526 | 3300006051 | Ga0075364_10083153 | Ga0075364_100831532 | 180 |
| 527 | 3300006177 | Ga0075362_10008211 | Ga0075362_100082114 | 180 |
| 528 | 3300006178 | Ga0075367_10391512 | Ga0075367_103915122 | 180 |
| 529 | 3300006186 | Ga0075369_10261906 | Ga0075369_102619061 | 180 |
| 530 | 3300006195 | Ga0075366_10000574 | Ga0075366_100005749 | 180 |
| 531 | 3300006195 | Ga0075366_10009384 | Ga0075366_100093842 | 180 |
| 532 | 3300006195 | Ga0075366_10024978 | Ga0075366_100249783 | 180 |
| 533 | 3300006195 | Ga0075366_10063382 | Ga0075366_100633823 | 180 |
| 534 | 3300006195 | Ga0075366_10192111 | Ga0075366_101921113 | 180 |
| 535 | 3300006353 | Ga0075370_10000101 | Ga0075370_100001019 | 180 |
| 536 | 3300006353 | Ga0075370_10003489 | Ga0075370_100034899 | 180 |
| 537 | 3300006353 | Ga0075370_10013018 | Ga0075370_100130185 | 180 |
| 538 | 3300006353 | Ga0075370_10100492 | Ga0075370_101004923 | 180 |
| 539 | 3300006353 | Ga0075370_10298457 | Ga0075370_102984571 | 180 |
| 540 | 3300009148 | Ga0105243_10107881 | Ga0105243_101078812 | 180 |
| 541 | 3300010375 | Ga0105239_10050731 | Ga0105239_100507313 | 180 |
| 542 | 3300013297 | Ga0157378_10526364 | Ga0157378_105263642 | 180 |
| 543 | 3300013297 | Ga0157378_10614164 | Ga0157378_106141642 | 180 |
| 544 | 3300013306 | Ga0163162_11575847 | Ga0163162_115758471 | 180 |
| 545 | 3300025245 | Ga0207425_1001646 | Ga0207425_10016463 | 180 |
| 546 | 3300025258 | Ga0209129_1000124 | Ga0209129_100012430 | 180 |
| 547 | 3300025258 | Ga0209129_1010372 | Ga0209129_10103722 | 180 |
| 548 | 3300025273 | Ga0209673_1013941 | Ga0209673_10139415 | 180 |
| 549 | 3300025295 | Ga0209564_1000057 | Ga0209564_100005791 | 180 |
| 550 | 3300025297 | Ga0209758_1000214 | Ga0209758_100021461 | 180 |
| 551 | 3300025297 | Ga0209758_1000232 | Ga0209758_100023260 | 180 |
| 552 | 3300025321 | Ga0207656_10162776 | Ga0207656_101627762 | 180 |
| 553 | 3300025893 | Ga0207682_10212261 | Ga0207682_102122611 | 180 |
| 554 | 3300025907 | Ga0207645_10005861 | Ga0207645_100058617 | 180 |
| 555 | 3300025925 | Ga0207650_10236091 | Ga0207650_102360912 | 180 |
| 556 | 3300025931 | Ga0207644_10185223 | Ga0207644_101852233 | 180 |
| 557 | 3300025942 | Ga0207689_10015594 | Ga0207689_100155949 | 180 |
| 558 | 3300025942 | Ga0207689_10241497 | Ga0207689_102414972 | 180 |
| 559 | 3300025945 | Ga0207679_10403696 | Ga0207679_104036962 | 180 |
| 560 | 3300025981 | Ga0207640_10016633 | Ga0207640_100166332 | 180 |
| 561 | 3300026023 | Ga0207677_10630202 | Ga0207677_106302022 | 180 |
| 562 | 3300026078 | Ga0207702_10460110 | Ga0207702_104601102 | 180 |
| 563 | 3300026089 | Ga0207648_10055085 | Ga0207648_100550853 | 180 |
| 564 | 3300026089 | Ga0207648_10067687 | Ga0207648_100676873 | 180 |
| 565 | 3300026118 | Ga0207675_100835190 | Ga0207675_1008351902 | 180 |
| 566 | 3300026142 | Ga0207698_10054479 | Ga0207698_100544793 | 180 |
| 567 | 3300027866 | Ga0209813_10027757 | Ga0209813_100277572 | 180 |
| 568 | 3300027866 | Ga0209813_10092905 | Ga0209813_100929052 | 180 |
| 569 | 3300028786 | Ga0307517_10081360 | Ga0307517_100813602 | 180 |
| 570 | 3300028786 | Ga0307517_10142655 | Ga0307517_101426553 | 180 |
| 571 | 3300031456 | Ga0307513_10275714 | Ga0307513_102757143 | 180 |
| 572 | 3300031456 | Ga0307513_10485066 | Ga0307513_104850662 | 180 |
| 573 | 3300031616 | Ga0307508_10002132 | Ga0307508_100021328 | 180 |
| 574 | 3300031730 | Ga0307516_10208068 | Ga0307516_102080683 | 180 |
| 575 | 3300031730 | Ga0307516_10212500 | Ga0307516_102125001 | 180 |
| 576 | 3300031824 | Ga0307413_10093092 | Ga0307413_100930924 | 180 |
| 577 | 3300031852 | Ga0307410_11018880 | Ga0307410_110188801 | 180 |
| 578 | 3300031995 | Ga0307409_100630024 | Ga0307409_1006300241 | 180 |
| 579 | 3300032002 | Ga0307416_100070299 | Ga0307416_1000702994 | 180 |
| 580 | 3300032005 | Ga0307411_10032732 | Ga0307411_100327325 | 180 |
| 581 | 3300035118 | Ga0373954_0146455 | Ga0373954_0146455_83_625 | 180 |
| 582 | 3300035725 | Ga0373947_0800660 | Ga0373947_0800660_46_588 | 180 |
| 583 | 3300041443 | Ga0451789_1281368 | Ga0451789_1281368_257_799 | 180 |
| 584 | 3300041452 | Ga0451793_1115609 | Ga0451793_1115609_775_1317 | 180 |
| 585 | 3300041459 | Ga0451800_1406008 | Ga0451800_1406008_41_583 | 180 |
| 586 | 3300041503 | Ga0451847_0835513 | Ga0451847_0835513_11_574 | 180 |
| 587 | 3300046506 | Ga0495583_0044197 | Ga0495583_0044197_1128_1670 | 180 |
| 588 | 3300046513 | Ga0495616_0174567 | Ga0495616_0174567_14_556 | 180 |
| 589 | 3300046518 | Ga0495631_0094953 | Ga0495631_0094953_60_632 | 180 |
| 590 | 3300046519 | Ga0495632_0003621 | Ga0495632_0003621_102_644 | 180 |
| 591 | 3300046519 | Ga0495632_0011776 | Ga0495632_0011776_1464_2006 | 180 |
| 592 | 3300046519 | Ga0495632_0315781 | Ga0495632_0315781_79_621 | 180 |
| 593 | 3300046524 | Ga0495648_0170745 | Ga0495648_0170745_146_718 | 180 |
| 594 | 3300046616 | Ga0495668_0066901 | Ga0495668_0066901_1093_1665 | 180 |
| 595 | 3300046648 | Ga0495611_0043832 | Ga0495611_0043832_1326_1868 | 180 |
| 596 | 3300046660 | Ga0495625_0146920 | Ga0495625_0146920_38_583 | 180 |
| 597 | 3300046694 | Ga0495649_0013683 | Ga0495649_0013683_651_1193 | 180 |
| 598 | 3300046810 | Ga0495660_0034709 | Ga0495660_0034709_816_1358 | 180 |
| 599 | 3300047443 | Ga0495687_000196 | Ga0495687_000196_66205_66777 | 180 |
| 600 | 3300047443 | Ga0495687_022632 | Ga0495687_022632_1624_2166 | 180 |
| 601 | 3300047443 | Ga0495687_032090 | Ga0495687_032090_237_779 | 180 |
| 602 | 3300049579 | Ga0501043_0000004 | Ga0501043_0000004_21022_21585 | 180 |
| 603 | 3300049580 | Ga0501046_0000050 | Ga0501046_0000050_98338_98901 | 180 |
| 604 | 3300049581 | Ga0501047_0000012 | Ga0501047_0000012_269931_270494 | 180 |
| 605 | 3300049582 | Ga0501048_0004275 | Ga0501048_0004275_3579_4142 | 180 |
| 606 | 3300049824 | Ga0501045_0049296 | Ga0501045_0049296_2418_2981 | 180 |
| 607 | 3300050490 | nmdc:mga03n38_5373_c1 | nmdc:mga03n38_5373_c1_3232_3804 | 180 |
| 608 | 3300050493 | nmdc:mga0k408_1682_c1 | nmdc:mga0k408_1682_c1_9482_10054 | 180 |
| 609 | 3300050493 | nmdc:mga0k408_190792_c1 | nmdc:mga0k408_190792_c1_212_754 | 180 |
| 610 | 3300050493 | nmdc:mga0k408_201322_c1 | nmdc:mga0k408_201322_c1_193_744 | 180 |
| 611 | 3300050493 | nmdc:mga0k408_45759_c1 | nmdc:mga0k408_45759_c1_1039_1581 | 180 |
| 612 | 3300050493 | nmdc:mga0k408_695_c1 | nmdc:mga0k408_695_c1_12562_13128 | 180 |
| 613 | 3300050493 | nmdc:mga0k408_6998_c1 | nmdc:mga0k408_6998_c1_52_594 | 180 |
| 614 | 3300050494 | nmdc:mga06z11_104541_c1 | nmdc:mga06z11_104541_c1_627_1169 | 180 |
| 615 | 3300050494 | nmdc:mga06z11_156159_c1 | nmdc:mga06z11_156159_c1_550_1092 | 180 |
| 616 | 3300050495 | nmdc:mga04h51_38905_c1 | nmdc:mga04h51_38905_c1_977_1519 | 180 |
| 617 | 3300050496 | nmdc:mga07m45_1045_c1 | nmdc:mga07m45_1045_c1_798_1340 | 180 |
| 618 | 3300050496 | nmdc:mga07m45_185787_c1 | nmdc:mga07m45_185787_c1_230_772 | 180 |
| 619 | 3300050496 | nmdc:mga07m45_22889_c1 | nmdc:mga07m45_22889_c1_257_823 | 180 |
| 620 | 3300050496 | nmdc:mga07m45_349480_c1 | nmdc:mga07m45_349480_c1_54_620 | 180 |
| 621 | 3300050516 | nmdc:mga0sz30_123221_c1 | nmdc:mga0sz30_123221_c1_195_737 | 180 |
| 622 | 3300053087 | Ga0500643_043685 | Ga0500643_043685_494_1036 | 180 |
| 623 | 3300053093 | Ga0500651_0080479 | Ga0500651_0080479_1166_1708 | 180 |
| 624 | 3300053093 | Ga0500651_0336097 | Ga0500651_0336097_45_587 | 180 |
| 625 | 3300053093 | Ga0500651_0486450 | Ga0500651_0486450_12_554 | 180 |
| 626 | 3300053108 | Ga0500562_025890 | Ga0500562_025890_720_1262 | 180 |
| 627 | 3300053130 | Ga0500642_0002746 | Ga0500642_0002746_4626_5168 | 180 |
| 628 | 3300053130 | Ga0500642_0032574 | Ga0500642_0032574_1270_1812 | 180 |
| 629 | 3300053131 | Ga0500652_000155 | Ga0500652_000155_10932_11474 | 180 |
| 630 | 3300053134 | Ga0500658_0003329 | Ga0500658_0003329_4048_4590 | 180 |
| 631 | 3300053139 | Ga0500568_0018673 | Ga0500568_0018673_749_1291 | 180 |
| 632 | 3300053156 | Ga0500622_0000423 | Ga0500622_0000423_9283_9825 | 180 |
| 633 | 3300053158 | Ga0500627_0182952 | Ga0500627_0182952_204_746 | 180 |
| 634 | 3300053724 | Ga0500570_124659 | Ga0500570_124659_119_661 | 180 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5hmb-assembly1.cif.gz_A | crystal structure of s. sahachiroi azig | 0.9504 | 58 | 179 |
| 3nwz-assembly3.cif.gz_D | crystal structure of bh2602 protein from bacillus halodurans with coa, northeast structural genomics consortium target bhr199 | 0.9462 | 77 | 177 |
| 1zki-assembly1.cif.gz_B | structure of conserved protein pa5202 from pseudomonas aeruginosa | 0.9457 | 58 | 177 |
| 3nwz-assembly2.cif.gz_C | crystal structure of bh2602 protein from bacillus halodurans with coa, northeast structural genomics consortium target bhr199 | 0.9438 | 76 | 177 |
| 2dsl-assembly1.cif.gz_A | mutant n33d structure of phenylacetic acid degradation protein paai from thermus thermophilus hb8 | 0.9427 | 58 | 175 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1wluA00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9427 | 58 | 175 | 3.10.129.10 |
| 4m20A00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9344 | 58 | 176 | 3.10.129.10 |
| 3s4kB00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9305 | 58 | 180 | 3.10.129.10 |
| 3nwzD00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9297 | 77 | 177 | 3.10.129.10 |
| 1zkiB00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9296 | 58 | 177 | 3.10.129.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F4BJ79-F1-model_v4 | Thioesterase domain-containing protein | 0.9921 | 66 | 177 |
GO:0005829
GO:0061522 |
| AF-A0A1M3BPM1-F1-model_v4 | Phenylacetic acid degradation protein | 0.9904 | 65 | 178 |
GO:0047617
|
| AF-A0A4Q5PLE3-F1-model_v4 | PaaI family thioesterase | 0.9895 | 8 | 180 |
GO:0005829
GO:0061522 |
| AF-A0A6P1KDZ5-F1-model_v4 | Hotdog fold thioesterase | 0.9883 | 58 | 179 |
GO:0016289
|
| AF-A0A520G6K8-F1-model_v4 | PaaI family thioesterase | 0.9879 | 8 | 180 |
GO:0005829
GO:0061522 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar