F470914

General Info

Members Datasets Scaffolds Average Seq Length
631 461 335 322

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10028786|Ga0105239_100287866
Length 340
Sequence MSEMLTANPMAPRPTDGASAAAATMRAAIVTRPGSVRLARVPMPQPGAGQVRIRLEGCGVCASNLTPWAGPEWQAFPMEPGALGHEGWGIIDALGPGVTSLKTGERVAALSYAGYAEFDIADADAVVPLPPALDGMAFPGEPLGCAFNIFRRADIRPGQTVAIIGIGFLGAILTRLAADAGARVVAISRRPSSLALARRYGAAETIVMDDRGIIDQVGALTGGRLCERVIEAAGKQWPLDLAGELTAERGKLIVAGYHQDGSRQVDMQLWNWRGIDVVNAHERDLLIYAEGMRMAVEAVASGRLDPGPLCTHRYPLERLDEALDATRDKPEGFVKAIIVS

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
4 2509276019 Ensifer aridi TW10 Isolate Nodule
5 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
6 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
7 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
8 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
9 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
10 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
11 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
12 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
13 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
14 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
15 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
16 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
17 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
18 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
19 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
20 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
21 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
22 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
23 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
24 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
25 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
26 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
27 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
28 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
29 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
30 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
31 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
32 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
33 2643221558 Rhizobium sp. Root149 Isolate Unclassified
34 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
35 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
36 2718217882 Rhizobium sp. N741 Isolate Nodule
37 2718217927 Rhizobium sp. N324 Isolate Nodule
38 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
39 2718218009 Rhizobium sp. N561 Isolate Nodule
40 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
41 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
42 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
43 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
44 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
45 2718218363 Rhizobium sp. N113 Isolate Nodule
46 2718218365 Rhizobium sp. N731 Isolate Nodule
47 2718218366 Rhizobium sp. N621 Isolate Nodule
48 2718218423 Rhizobium sp. N941 Isolate Nodule
49 2721755514 Rhizobium sp. N6212 Isolate Nodule
50 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
51 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
52 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
53 2721755809 Rhizobium sp. N541 Isolate Nodule
54 2721755810 Rhizobium sp. N871 Isolate Nodule
55 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
56 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
57 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
58 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
59 2728369365 Rhizobium sp. N1341 Isolate Nodule
60 2728369397 Rhizobium sp. N1314 Isolate Nodule
61 2773857925 Microvirga vignae BR3299 Isolate Unclassified
62 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
63 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
64 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
65 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
66 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
67 2791355260 Rhizobium sp. L9 Isolate Nodule
68 2791355264 Rhizobium sp. S9 Isolate Nodule
69 2791355267 Rhizobium sp. L18 Isolate Nodule
70 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
71 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
72 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
73 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
74 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
75 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
76 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
77 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
78 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
79 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
80 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
81 2838048938 Rhizobium pisi 27/80 Isolate Nodule
82 2838061910 Rhizobium phaseoli L15 Isolate Nodule
83 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
84 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
85 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
86 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
87 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
88 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
89 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
90 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
91 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
92 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
93 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
94 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
95 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
96 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
97 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
98 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
99 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
100 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
101 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
102 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
103 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
104 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
105 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
106 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
107 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
108 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
109 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
110 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
111 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
112 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
113 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
114 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
115 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
116 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
117 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
118 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
119 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
120 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
121 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
122 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
123 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
124 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
125 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
126 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
127 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
128 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
129 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
130 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
131 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
132 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
133 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
134 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
135 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
136 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
137 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
138 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
139 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
140 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
141 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
142 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
143 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
144 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
145 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
146 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
147 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
148 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
149 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
150 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
151 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
152 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
153 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
154 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
155 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
156 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
157 2933599457 Rhizobium phaseoli M3 Isolate Nodule
158 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
159 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
160 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
161 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
162 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
163 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
164 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
165 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
166 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
167 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
168 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
169 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
170 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
171 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
172 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
173 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
174 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
175 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
176 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
177 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
178 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
179 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
180 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
181 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
182 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
183 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
184 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
185 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
186 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
187 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
188 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
189 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
190 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
191 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
192 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
193 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
194 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
195 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
196 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
197 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
198 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
199 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
200 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
201 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
202 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
203 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
204 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
205 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
206 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
207 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
208 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
209 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
210 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
211 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
212 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
213 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
214 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
215 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
216 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
217 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
218 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
219 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
220 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
221 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
222 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
223 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
224 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
225 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
226 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
227 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
228 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
229 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
230 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
231 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
232 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
233 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
234 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
235 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
236 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
237 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
238 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
239 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
240 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
241 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
242 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
243 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
244 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
245 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
246 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
247 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
248 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
249 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
250 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
251 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
252 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
253 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
254 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
255 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
256 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
257 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
258 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
259 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
260 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
261 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
262 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
263 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
264 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
265 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
266 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
267 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
268 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
269 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
270 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
271 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
272 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
273 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
274 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
275 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
276 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
277 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
278 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
279 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
280 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
281 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
282 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
283 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
284 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
285 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
286 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
287 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
288 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
289 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
290 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
291 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
292 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
293 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
294 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
295 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
296 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
297 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
298 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
299 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
300 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
301 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
302 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
303 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
304 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
305 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
306 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
307 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
308 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
309 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
310 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
311 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
312 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
313 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
314 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
315 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
316 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
317 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
318 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
319 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
320 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
321 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
322 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
323 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
324 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
325 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
326 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
327 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
328 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
329 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
330 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
331 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
332 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
333 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
334 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
335 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
354 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
355 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
357 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
358 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
360 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
361 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
362 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
363 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
364 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
365 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
366 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
367 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
368 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
369 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
370 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
371 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
372 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
373 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
374 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
375 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
376 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
377 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
378 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
379 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
380 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
381 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
382 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
383 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
384 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
385 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
386 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
387 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
388 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
389 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
390 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
391 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
392 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
393 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
394 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
395 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
396 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
397 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
398 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
399 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
400 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
401 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
402 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
403 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
404 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
405 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
406 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
407 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
408 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
409 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
410 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
411 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
412 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
413 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
414 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
415 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
416 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
417 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
418 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
419 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
420 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
421 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
422 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
423 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
424 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
425 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
426 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
427 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
428 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
429 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
430 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
431 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
432 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
433 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
434 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
435 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
436 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
437 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
438 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
439 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
440 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
441 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
442 8005275841 Rhizobium sp. N4311 Isolate Nodule
443 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
444 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
445 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
446 8005382845 Rhizobium sp. R634 Isolate Nodule
447 8005395548 Rhizobium sp. R339 Isolate Nodule
448 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
449 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
450 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
451 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
452 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
453 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
454 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
455 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
456 8018176218 Rhizobium sp. N122 Isolate Nodule
457 8024501048 Rhizobium sp. H4 Isolate Nodule
458 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
459 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
460 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
461 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 52.93
Metatranscriptomes 0.16
Isolates 46.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.65
Nodule 43.11
Rhizoplane 0.63
Rhizosphere 47.54
Stem 0
Stem Tuber 0
Unclassified 5.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1001644 3300001904 Bacteria 4060
2 JGI24740J21852_10009258 3300001979 Bacteria 3866
3 JGI24739J22299_10002644 3300001989 Bacteria 6898
4 JGI24737J22298_10000430 3300001990 Bacteria 14388
5 JGI24735J21928_10039625 3300002067 Bacteria 1377
6 JGI24735J21928_10039787 3300002067 Bacteria 1374
7 JGI24738J21930_10000568 3300002075 Bacteria 10562
8 JGI25158J39367_1000322 3300002739 Bacteria 10613
9 JGI25152J39213_1001992 3300002773 Bacteria 8064
10 JGI25159J45721_1000593 3300002987 Bacteria 16177
11 rootH1_10067800 3300003316 Bacteria 4700
12 rootL2_10015096 3300003322 Bacteria 17553
13 rootH1_10041113 3300003323 Bacteria 12024
14 rootH1_10071645 3300003323 Bacteria 15528
15 JGI25160J50197_1001174 3300003354 Bacteria 13352
16 JGI25161J50226_1000029 3300003374 Bacteria 144998
17 Ga0055524_1009224 3300003775 Bacteria 4035
18 Ga0055528_1006379 3300003790 Bacteria 5355
19 Ga0055540_1000157 3300003792 Bacteria 67204
20 Ga0055543_1000016 3300004625 Bacteria 176117
21 Ga0065165_1002037 3300005262 Bacteria 18769
22 Ga0070658_10113898 3300005327 Bacteria 2242
23 Ga0070658_10116848 3300005327 Bacteria 2214
24 Ga0070658_10135805 3300005327 Bacteria 2052
25 Ga0070683_100034412 3300005329 Bacteria 4628
26 Ga0070680_100002841 3300005336 Bacteria 12871
27 Ga0070660_100029143 3300005339 Bacteria 4134
28 Ga0070687_100016545 3300005343 Bacteria 3367
29 Ga0070661_100006689 3300005344 Bacteria 7951
30 Ga0070661_100014668 3300005344 Bacteria 5525
31 Ga0070669_100130822 3300005353 Bacteria 1925
32 Ga0070659_100247318 3300005366 Bacteria 1477
33 Ga0070714_100081911 3300005435 Bacteria 2811
34 Ga0070663_100056743 3300005455 Bacteria 2807
35 Ga0070663_100164521 3300005455 Bacteria 1710
36 Ga0070662_100029360 3300005457 Bacteria 3838
37 Ga0070681_10065889 3300005458 Bacteria 3591
38 Ga0070681_10258281 3300005458 Bacteria 1654
39 Ga0070679_100000005 3300005530 Bacteria 263201
40 Ga0068853_100008199 3300005539 Bacteria 8388
41 Ga0068853_100051709 3300005539 Bacteria 3537
42 Ga0070665_100177795 3300005548 Bacteria 2129
43 Ga0068855_100003065 3300005563 Bacteria 20440
44 Ga0068855_100162614 3300005563 Bacteria 2532
45 Ga0068857_100248102 3300005577 Bacteria 1631
46 Ga0068854_100002485 3300005578 Bacteria 11414
47 Ga0068854_100126984 3300005578 Bacteria 1943
48 Ga0068856_100012905 3300005614 Bacteria 8086
49 Ga0068856_100016719 3300005614 Bacteria 7106
50 Ga0068852_100000899 3300005616 Bacteria 19686
51 Ga0068852_100029500 3300005616 Bacteria 4508
52 Ga0068852_100043494 3300005616 Bacteria 3810
53 Ga0068852_100307570 3300005616 Bacteria 1536
54 Ga0068852_100372130 3300005616 Bacteria 1400
55 Ga0068852_100485396 3300005616 Bacteria 1228
56 Ga0079104_1002880 3300006946 Bacteria 8594
57 Ga0105240_10012918 3300009093 Bacteria 11503
58 Ga0105240_10094222 3300009093 Bacteria 3653
59 Ga0105240_10613601 3300009093 Bacteria 1196
60 Ga0105248_10015075 3300009177 Bacteria 8510
61 Ga0105238_10000013 3300009551 Bacteria 257248
62 Ga0105238_10059877 3300009551 Bacteria 3814
63 Ga0123341_1000010 3300009765 Bacteria 118450
64 Ga0123342_1012988 3300009766 Bacteria 8482
65 Ga0105239_10028786 3300010375 Bacteria 6109
66 Ga0157371_10003292 3300013102 Bacteria 14782
67 Ga0157371_10012821 3300013102 Bacteria 6389
68 Ga0157371_10139252 3300013102 Bacteria 1729
69 Ga0157371_10302521 3300013102 Bacteria 1158
70 Ga0157370_10000377 3300013104 Bacteria 56059
71 Ga0157369_10000207 3300013105 Bacteria 81678
72 Ga0157369_10013769 3300013105 Bacteria 9143
73 Ga0157369_10031443 3300013105 Bacteria 5845
74 Ga0157372_10003768 3300013307 Bacteria 16285
75 Ga0157372_10121469 3300013307 Bacteria 3001
76 Ga0157372_10248215 3300013307 Bacteria 2066
77 Ga0157372_10419993 3300013307 Bacteria 1559
78 Ga0206353_11452065 3300020082 Bacteria 2435
79 Ga0214542_1020305 3300021321 Bacteria 4917
80 Ga0214543_1000005 3300021327 Bacteria 454523
81 Ga0209436_100015 3300025208 Bacteria 126026
82 Ga0209129_1001134 3300025258 Bacteria 15421
83 Ga0209673_1012050 3300025273 Bacteria 3514
84 Ga0209130_1000051 3300025284 Bacteria 220482
85 Ga0209025_1050476 3300025294 Bacteria 1663
86 Ga0209050_1001362 3300025298 Bacteria 26749
87 Ga0209256_1002750 3300025299 Bacteria 13590
88 Ga0207426_1000043 3300025302 Bacteria 432827
89 Ga0207426_1001061 3300025302 Bacteria 26031
90 Ga0209051_1000032 3300025303 Bacteria 383445
91 Ga0209257_1003356 3300025304 Bacteria 13855
92 Ga0209257_1010651 3300025304 Bacteria 4602
93 Ga0207656_10011803 3300025321 Bacteria 3306
94 Ga0207647_10126745 3300025904 Bacteria 1502
95 Ga0207647_10147394 3300025904 Bacteria 1377
96 Ga0207705_10000033 3300025909 Bacteria 223997
97 Ga0207705_10007536 3300025909 Bacteria 7996
98 Ga0207705_10026892 3300025909 Bacteria 4100
99 Ga0207705_10052663 3300025909 Bacteria 2931
100 Ga0207705_10207479 3300025909 Bacteria 1486
101 Ga0207707_10213739 3300025912 Bacteria 1679
102 Ga0207707_10218772 3300025912 Bacteria 1658
103 Ga0207695_10009693 3300025913 Bacteria 11858
104 Ga0207695_10011979 3300025913 Bacteria 10434
105 Ga0207695_10065883 3300025913 Bacteria 3722
106 Ga0207660_10000419 3300025917 Bacteria 28025
107 Ga0207660_10000601 3300025917 Bacteria 24291
108 Ga0207660_10126048 3300025917 Bacteria 1944
109 Ga0207660_10268965 3300025917 Bacteria 1350
110 Ga0207662_10029168 3300025918 Bacteria 3195
111 Ga0207657_10008682 3300025919 Bacteria 10287
112 Ga0207657_10009020 3300025919 Bacteria 10073
113 Ga0207657_10022061 3300025919 Bacteria 5976
114 Ga0207649_10007462 3300025920 Bacteria 5945
115 Ga0207652_10000036 3300025921 Bacteria 134949
116 Ga0207694_10000026 3300025924 Bacteria 257192
117 Ga0207694_10160271 3300025924 Bacteria 1817
118 Ga0207694_10334853 3300025924 Bacteria 1251
119 Ga0207690_10005266 3300025932 Bacteria 7622
120 Ga0207690_10019474 3300025932 Bacteria 4181
121 Ga0207706_10000659 3300025933 Bacteria 36314
122 Ga0207706_10000720 3300025933 Bacteria 34554
123 Ga0207711_10006146 3300025941 Bacteria 10146
124 Ga0207661_10037932 3300025944 Bacteria 3773
125 Ga0207679_10063028 3300025945 Bacteria 2765
126 Ga0207667_10011644 3300025949 Bacteria 10210
127 Ga0207667_10047744 3300025949 Bacteria 4530
128 Ga0207667_10065435 3300025949 Bacteria 3791
129 Ga0207667_10124239 3300025949 Bacteria 2659
130 Ga0207667_10157666 3300025949 Bacteria 2335
131 Ga0207667_10168208 3300025949 Bacteria 2253
132 Ga0207667_10392420 3300025949 Bacteria 1413
133 Ga0207668_10000837 3300025972 Bacteria 18598
134 Ga0207640_10002237 3300025981 Bacteria 10416
135 Ga0207640_10070323 3300025981 Bacteria 2353
136 Ga0207640_10167394 3300025981 Bacteria 1634
137 Ga0207639_10040635 3300026041 Bacteria 3472
138 Ga0207678_10016176 3300026067 Bacteria 6549
139 Ga0207678_10019909 3300026067 Bacteria 5897
140 Ga0207678_10059355 3300026067 Bacteria 3291
141 Ga0207702_10011286 3300026078 Bacteria 7446
142 Ga0207702_10040902 3300026078 Bacteria 3886
143 Ga0207702_10043100 3300026078 Bacteria 3788
144 Ga0207702_10080491 3300026078 Bacteria 2826
145 Ga0207702_10143584 3300026078 Bacteria 2163
146 Ga0207674_10006773 3300026116 Bacteria 13445
147 Ga0207674_10015790 3300026116 Bacteria 8282
148 Ga0207674_10067019 3300026116 Bacteria 3615
149 Ga0207674_10141460 3300026116 Bacteria 2365
150 Ga0207698_10007871 3300026142 Bacteria 6708
151 Ga0207698_10021854 3300026142 Bacteria 4433
152 Ga0209281_1000185 3300027111 Bacteria 144489
153 Ga0268256_1000013 3300030500 Bacteria 752103
154 Ga0307408_100000134 3300031548 Bacteria 82703
155 Ga0307408_100011930 3300031548 Bacteria 5750
156 Ga0307408_100036845 3300031548 Bacteria 3441
157 Ga0307408_100123505 3300031548 Bacteria 2009
158 Ga0307408_100130255 3300031548 Bacteria 1961
159 Ga0307408_100144508 3300031548 Bacteria 1871
160 Ga0307408_100153070 3300031548 Bacteria 1823
161 Ga0307405_10000157 3300031731 Bacteria 26000
162 Ga0307405_10063329 3300031731 Bacteria 2345
163 Ga0307405_10195808 3300031731 Bacteria 1463
164 Ga0307405_10196490 3300031731 Bacteria 1461
165 Ga0307413_10003349 3300031824 Bacteria 6732
166 Ga0307413_10005739 3300031824 Bacteria 5579
167 Ga0307413_10042750 3300031824 Bacteria 2665
168 Ga0307413_10087539 3300031824 Bacteria 2018
169 Ga0307410_10000178 3300031852 Bacteria 23344
170 Ga0307410_10001278 3300031852 Bacteria 11192
171 Ga0307410_10053462 3300031852 Bacteria 2733
172 Ga0307410_10148379 3300031852 Bacteria 1743
173 Ga0307406_10000882 3300031901 Bacteria 16876
174 Ga0307406_10062467 3300031901 Bacteria 2410
175 Ga0307406_10175130 3300031901 Bacteria 1556
176 Ga0307407_10012789 3300031903 Bacteria 4050
177 Ga0307407_10024189 3300031903 Bacteria 3181
178 Ga0307412_10000337 3300031911 Bacteria 29485
179 Ga0307412_10041792 3300031911 Bacteria 2974
180 Ga0307412_10136910 3300031911 Bacteria 1788
181 Ga0307412_10194499 3300031911 Bacteria 1536
182 Ga0307412_10227928 3300031911 Bacteria 1433
183 Ga0307409_100000947 3300031995 Bacteria 13532
184 Ga0307409_100006934 3300031995 Bacteria 6724
185 Ga0307409_100011607 3300031995 Bacteria 5566
186 Ga0307409_100012907 3300031995 Bacteria 5347
187 Ga0307409_100014651 3300031995 Bacteria 5110
188 Ga0307409_100141935 3300031995 Bacteria 2071
189 Ga0307409_100188158 3300031995 Bacteria 1835
190 Ga0307409_100210663 3300031995 Bacteria 1746
191 Ga0307416_100000247 3300032002 Bacteria 28731
192 Ga0307416_100005613 3300032002 Bacteria 7736
193 Ga0307416_100025818 3300032002 Bacteria 4316
194 Ga0307416_100035331 3300032002 Bacteria 3815
195 Ga0307416_100111040 3300032002 Bacteria 2416
196 Ga0307414_10000469 3300032004 Bacteria 21145
197 Ga0307414_10001219 3300032004 Bacteria 13249
198 Ga0307414_10001655 3300032004 Bacteria 11591
199 Ga0307414_10005461 3300032004 Bacteria 7002
200 Ga0307414_10114201 3300032004 Bacteria 2063
201 Ga0307411_10001263 3300032005 Bacteria 10113
202 Ga0307411_10034196 3300032005 Bacteria 3160
203 Ga0307411_10170002 3300032005 Bacteria 1642
204 Ga0307415_100031268 3300032126 Bacteria 3427
205 Ga0307415_100062133 3300032126 Bacteria 2589
206 Ga0395899_0012868 3300037312 Bacteria 6407
207 Ga0395899_0061648 3300037312 Bacteria 2762
208 Ga0395899_0063881 3300037312 Bacteria 2707
209 Ga0395899_0123762 3300037312 Bacteria 1850
210 Ga0395900_0002600 3300037418 Bacteria 19734
211 Ga0395900_0009772 3300037418 Bacteria 9830
212 Ga0395900_0026359 3300037418 Bacteria 5953
213 Ga0395900_0028912 3300037418 Bacteria 5682
214 Ga0395900_0035072 3300037418 Bacteria 5167
215 Ga0395900_0067914 3300037418 Bacteria 3662
216 Ga0395900_0089288 3300037418 Bacteria 3168
217 Ga0395900_0183389 3300037418 Bacteria 2125
218 Ga0395900_0284210 3300037418 Bacteria 1645
219 Ga0395900_0291290 3300037418 Bacteria 1621
220 Ga0395900_0336097 3300037418 Bacteria 1487
221 Ga0395898_0014597 3300037466 Bacteria 8066
222 Ga0395898_0226174 3300037466 Bacteria 1784
223 Ga0395898_0259157 3300037466 Bacteria 1658
224 Ga0395898_0289157 3300037466 Bacteria 1563
225 Ga0395905_0001224 3300037471 Bacteria 31977
226 Ga0395905_0044632 3300037471 Bacteria 4159
227 Ga0395905_0046048 3300037471 Bacteria 4091
228 Ga0395905_0053425 3300037471 Bacteria 3781
229 Ga0395905_0061885 3300037471 Bacteria 3501
230 Ga0395905_0078382 3300037471 Bacteria 3096
231 Ga0395905_0091264 3300037471 Bacteria 2856
232 Ga0395905_0162746 3300037471 Bacteria 2097
233 Ga0395905_0167910 3300037471 Bacteria 2062
234 Ga0395905_0242752 3300037471 Bacteria 1683
235 Ga0395905_0644496 3300037471 Bacteria 961
236 Ga0436364_1265123 3300037853 Bacteria 88807
237 Ga0436364_1456225 3300037853 Bacteria 2438
238 Ga0395901_0000041 3300038443 Bacteria 202314
239 Ga0395901_0013801 3300038443 Bacteria 8215
240 Ga0395901_0027106 3300038443 Bacteria 5884
241 Ga0395901_0032006 3300038443 Bacteria 5427
242 Ga0395901_0088842 3300038443 Bacteria 3233
243 Ga0395901_0092622 3300038443 Bacteria 3163
244 Ga0395901_0133798 3300038443 Bacteria 2605
245 Ga0395901_0135976 3300038443 Bacteria 2583
246 Ga0395901_0305563 3300038443 Bacteria 1648
247 Ga0436365_0569979 3300039437 Bacteria 1937
248 Ga0439465_0000138 3300041413 Bacteria 17895
249 Ga0439465_0000227 3300041413 Bacteria 15183
250 Ga0451853_1278377 3300041512 Bacteria 4334
251 Ga0439449_0006116 3300042007 Bacteria 4600
252 Ga0439449_0027494 3300042007 Bacteria 2123
253 Ga0450923_033242 3300042125 Bacteria 1060
254 Ga0450896_000130 3300042133 Bacteria 5660
255 Ga0466972_0003845 3300044658 Bacteria 7473
256 Ga0466972_0035459 3300044658 Bacteria 2441
257 Ga0466973_0039606 3300044659 Bacteria 4454
258 Ga0453683_0017892 3300044673 Bacteria 4555
259 Ga0466966_0004705 3300044684 Bacteria 8983
260 Ga0466961_0017850 3300044693 Bacteria 4561
261 Ga0466961_0031051 3300044693 Bacteria 3434
262 Ga0466963_0000716 3300044694 Bacteria 16221
263 Ga0466963_0032380 3300044694 Bacteria 3385
264 Ga0466963_0054156 3300044694 Bacteria 2666
265 Ga0466963_0079095 3300044694 Bacteria 2224
266 Ga0466964_0001414 3300044706 Bacteria 8189
267 Ga0466971_0021150 3300044719 Bacteria 2894
268 Ga0466971_0029738 3300044719 Bacteria 2443
269 Ga0466971_0074308 3300044719 Bacteria 1545
270 Ga0466968_0000809 3300044735 Bacteria 10903
271 Ga0466968_0063665 3300044735 Bacteria 1594
272 Ga0466968_0084851 3300044735 Bacteria 1397
273 Ga0466970_0018867 3300044765 Bacteria 3572
274 Ga0466957_0001404 3300044842 Bacteria 12549
275 Ga0466957_0003352 3300044842 Bacteria 8782
276 Ga0466957_0019924 3300044842 Bacteria 3948
277 Ga0466957_0107159 3300044842 Bacteria 1768
278 Ga0466959_0051021 3300045049 Bacteria 3036
279 Ga0466959_0063046 3300045049 Bacteria 2693
280 Ga0466959_0311270 3300045049 Bacteria 1077
281 Ga0466958_0000406 3300045836 Bacteria 17679
282 Ga0466958_0009040 3300045836 Bacteria 5533
283 Ga0466958_0038814 3300045836 Bacteria 2858
284 Ga0466958_0135275 3300045836 Bacteria 1550
285 Ga0466967_0006921 3300045976 Bacteria 8105
286 Ga0466967_0009900 3300045976 Bacteria 7111
287 Ga0466967_0036444 3300045976 Bacteria 4199
288 Ga0466967_0057453 3300045976 Bacteria 3435
289 Ga0466967_0158898 3300045976 Bacteria 2120
290 Ga0466967_0383033 3300045976 Bacteria 1366
291 Ga0495610_0000518 3300046512 Bacteria 38760
292 Ga0495632_0001544 3300046519 Bacteria 19016
293 Ga0495643_0036913 3300046522 Bacteria 2682
294 Ga0495643_0070344 3300046522 Bacteria 1838
295 Ga0495668_0000812 3300046616 Bacteria 35793
296 Ga0495668_0012293 3300046616 Bacteria 5080
297 Ga0495668_0028691 3300046616 Bacteria 3147
298 Ga0495683_0020908 3300047323 Bacteria 3374
299 Ga0495686_0000660 3300047472 Bacteria 46840
300 Ga0495686_0132701 3300047472 Bacteria 1475
301 Ga0496109_0125399 3300048912 Bacteria 2394
302 Ga0496111_0052242 3300048914 Bacteria 2951
303 Ga0496113_0017539 3300048916 Bacteria 4971
304 Ga0496125_0023018 3300048928 Bacteria 5767
305 Ga0495678_012685 3300049459 Bacteria 3985
306 Ga0501292_000046 3300049515 Bacteria 25946
307 Ga0501294_000113 3300049517 Bacteria 9100
308 Ga0501298_015440 3300049521 Bacteria 1375
309 Ga0501300_000089 3300049523 Bacteria 13092
310 Ga0501033_0148525 3300049570 Bacteria 1692
311 Ga0501047_0075656 3300049581 Bacteria 3240
312 Ga0501048_0038457 3300049582 Bacteria 3433
313 Ga0501202_006270 3300049652 Bacteria 2124
314 Ga0501206_000042 3300049653 Bacteria 11484
315 Ga0501222_001878 3300049662 Bacteria 2916
316 Ga0501223_002369 3300049663 Bacteria 4204
317 Ga0501224_004711 3300049664 Bacteria 1942
318 Ga0501227_000739 3300049665 Bacteria 7139
319 Ga0501233_001168 3300049668 Bacteria 4466
320 Ga0501235_000332 3300049669 Bacteria 8999
321 Ga0501261_000044 3300049690 Bacteria 25231
322 Ga0501225_0001373 3300049705 Bacteria 7592
323 Ga0501080_0282636 3300049742 Bacteria 1508
324 Ga0501268_006140 3300049765 Bacteria 1753
325 Ga0501279_000046 3300049775 Bacteria 25767
326 Ga0501280_000310 3300049776 Bacteria 12295
327 Ga0501281_00076 3300049777 Bacteria 11473
328 Ga0501282_000171 3300049778 Bacteria 7894
329 Ga0501283_000710 3300049779 Bacteria 4389
330 Ga0501044_0078798 3300049823 Bacteria 3339
331 Ga0501044_0206809 3300049823 Bacteria 1919
332 nmdc:mga0qj67_281695_c1 3300050509 Bacteria 1347
333 Ga0500556_0001296 3300053104 Bacteria 11269
334 Ga0590071_007400 3300059421 Bacteria 2595
335 Ga0590077_019217 3300059426 Bacteria 1446

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003323 rootH1_10041113 rootH1_100411135 268
2 3300037471 Ga0395905_0644496 Ga0395905_0644496_47_853 268
3 3300049570 Ga0501033_0148525 Ga0501033_0148525_577_1386 268
4 3300049742 Ga0501080_0282636 Ga0501080_0282636_579_1388 268
5 3300009765 Ga0123341_1000010 Ga0123341_100001020 286
6 3300009766 Ga0123342_1012988 Ga0123342_10129884 286
7 iso_pu_bacteria 2839993093 2839996502 286
8 iso_pu_bacteria 2884298095 2884301401 289
9 3300042125 Ga0450923_033242 Ga0450923_033242_124_1029 291
10 3300044842 Ga0466957_0107159 Ga0466957_0107159_829_1749 294
11 3300025919 Ga0207657_10022061 Ga0207657_100220613 296
12 3300026067 Ga0207678_10016176 Ga0207678_100161766 296
13 3300031824 Ga0307413_10005739 Ga0307413_100057395 296
14 3300031995 Ga0307409_100012907 Ga0307409_1000129073 296
15 3300005614 Ga0068856_100016719 Ga0068856_1000167195 298
16 3300013307 Ga0157372_10419993 Ga0157372_104199932 298
17 3300026078 Ga0207702_10043100 Ga0207702_100431002 298
18 3300037471 Ga0395905_0046048 Ga0395905_0046048_2568_3521 299
19 3300045976 Ga0466967_0383033 Ga0466967_0383033_93_1064 299
20 3300005327 Ga0070658_10116848 Ga0070658_101168481 300
21 3300005616 Ga0068852_100372130 Ga0068852_1003721301 300
22 3300031548 Ga0307408_100011930 Ga0307408_1000119302 300
23 3300032002 Ga0307416_100025818 Ga0307416_1000258182 300
24 iso_pu_bacteria 2508501114 2509079043 300
25 iso_pu_bacteria 2835312727 2835317607 300
26 iso_pu_bacteria 8055909800 8055912676 300
27 3300005329 Ga0070683_100034412 Ga0070683_1000344122 301
28 3300005539 Ga0068853_100051709 Ga0068853_1000517092 301
29 3300005577 Ga0068857_100248102 Ga0068857_1002481022 301
30 3300009093 Ga0105240_10613601 Ga0105240_106136012 301
31 3300025917 Ga0207660_10268965 Ga0207660_102689652 301
32 3300025932 Ga0207690_10005266 Ga0207690_100052662 301
33 3300025944 Ga0207661_10037932 Ga0207661_100379322 301
34 3300025949 Ga0207667_10392420 Ga0207667_103924202 301
35 3300025981 Ga0207640_10167394 Ga0207640_101673942 301
36 3300026078 Ga0207702_10080491 Ga0207702_100804912 301
37 3300026116 Ga0207674_10067019 Ga0207674_100670192 301
38 3300038443 Ga0395901_0027106 Ga0395901_0027106_1957_2928 301
39 3300044693 Ga0466961_0031051 Ga0466961_0031051_2001_2969 301
40 3300045976 Ga0466967_0009900 Ga0466967_0009900_6088_7038 301
41 3300049515 Ga0501292_000046 Ga0501292_000046_5628_6596 301
42 3300049517 Ga0501294_000113 Ga0501294_000113_5380_6348 301
43 3300049523 Ga0501300_000089 Ga0501300_000089_7197_8165 301
44 3300049652 Ga0501202_006270 Ga0501202_006270_26_994 301
45 3300049653 Ga0501206_000042 Ga0501206_000042_1917_2885 301
46 3300049662 Ga0501222_001878 Ga0501222_001878_1119_2087 301
47 3300049663 Ga0501223_002369 Ga0501223_002369_1644_2612 301
48 3300049664 Ga0501224_004711 Ga0501224_004711_702_1670 301
49 3300049665 Ga0501227_000739 Ga0501227_000739_224_1192 301
50 3300049668 Ga0501233_001168 Ga0501233_001168_2972_3940 301
51 3300049669 Ga0501235_000332 Ga0501235_000332_6049_7017 301
52 3300049690 Ga0501261_000044 Ga0501261_000044_5334_6302 301
53 3300049705 Ga0501225_0001373 Ga0501225_0001373_1213_2181 301
54 3300049775 Ga0501279_000046 Ga0501279_000046_5393_6361 301
55 3300049776 Ga0501280_000310 Ga0501280_000310_6089_7057 301
56 3300049777 Ga0501281_00076 Ga0501281_00076_5159_6127 301
57 3300049778 Ga0501282_000171 Ga0501282_000171_3189_4157 301
58 3300049779 Ga0501283_000710 Ga0501283_000710_88_1056 301
59 3300049823 Ga0501044_0206809 Ga0501044_0206809_613_1623 301
60 3300005616 Ga0068852_100029500 Ga0068852_1000295002 302
61 3300013307 Ga0157372_10003768 Ga0157372_1000376811 302
62 3300021321 Ga0214542_1020305 Ga0214542_10203053 302
63 3300021327 Ga0214543_1000005 Ga0214543_1000005332 302
64 3300025945 Ga0207679_10063028 Ga0207679_100630281 302
65 3300037312 Ga0395899_0063881 Ga0395899_0063881_1676_2647 302
66 3300037312 Ga0395899_0123762 Ga0395899_0123762_297_1268 302
67 3300037418 Ga0395900_0009772 Ga0395900_0009772_2057_3028 302
68 3300037418 Ga0395900_0028912 Ga0395900_0028912_3899_4870 302
69 3300037418 Ga0395900_0336097 Ga0395900_0336097_208_1179 302
70 3300044694 Ga0466963_0032380 Ga0466963_0032380_1377_2348 302
71 3300005616 Ga0068852_100307570 Ga0068852_1003075702 303
72 3300020082 Ga0206353_11452065 Ga0206353_114520652 303
73 3300037418 Ga0395900_0035072 Ga0395900_0035072_2890_3861 303
74 3300037418 Ga0395900_0284210 Ga0395900_0284210_529_1497 303
75 3300037466 Ga0395898_0259157 Ga0395898_0259157_170_1138 303
76 3300037466 Ga0395898_0289157 Ga0395898_0289157_288_1259 303
77 3300037471 Ga0395905_0053425 Ga0395905_0053425_1764_2735 303
78 3300037471 Ga0395905_0162746 Ga0395905_0162746_242_1210 303
79 3300038443 Ga0395901_0133798 Ga0395901_0133798_1150_2118 303
80 3300044694 Ga0466963_0079095 Ga0466963_0079095_154_1125 303
81 3300044719 Ga0466971_0021150 Ga0466971_0021150_1904_2860 303
82 3300045976 Ga0466967_0006921 Ga0466967_0006921_1955_2923 303
83 3300003323 rootH1_10071645 rootH1_1007164513 304
84 3300005327 Ga0070658_10113898 Ga0070658_101138982 304
85 3300005435 Ga0070714_100081911 Ga0070714_1000819112 304
86 3300005458 Ga0070681_10258281 Ga0070681_102582812 304
87 3300005530 Ga0070679_100000005 Ga0070679_1000000059 304
88 3300005563 Ga0068855_100162614 Ga0068855_1001626142 304
89 3300009177 Ga0105248_10015075 Ga0105248_100150757 304
90 3300025909 Ga0207705_10026892 Ga0207705_100268922 304
91 3300025912 Ga0207707_10218772 Ga0207707_102187721 304
92 3300025917 Ga0207660_10000601 Ga0207660_1000060116 304
93 3300025919 Ga0207657_10008682 Ga0207657_100086825 304
94 3300025921 Ga0207652_10000036 Ga0207652_100000369 304
95 3300025941 Ga0207711_10006146 Ga0207711_100061465 304
96 3300025949 Ga0207667_10124239 Ga0207667_101242392 304
97 3300025949 Ga0207667_10157666 Ga0207667_101576662 304
98 3300031548 Ga0307408_100144508 Ga0307408_1001445082 304
99 3300031995 Ga0307409_100141935 Ga0307409_1001419353 304
100 3300037418 Ga0395900_0089288 Ga0395900_0089288_1013_1966 304
101 3300037418 Ga0395900_0291290 Ga0395900_0291290_401_1423 304
102 3300037466 Ga0395898_0226174 Ga0395898_0226174_12_965 304
103 3300037471 Ga0395905_0061885 Ga0395905_0061885_1091_2044 304
104 3300037471 Ga0395905_0167910 Ga0395905_0167910_470_1492 304
105 3300037471 Ga0395905_0242752 Ga0395905_0242752_62_1018 304
106 3300038443 Ga0395901_0013801 Ga0395901_0013801_2638_3591 304
107 3300038443 Ga0395901_0032006 Ga0395901_0032006_1027_1980 304
108 3300038443 Ga0395901_0088842 Ga0395901_0088842_1000_2022 304
109 3300044842 Ga0466957_0019924 Ga0466957_0019924_2732_3685 304
110 3300045976 Ga0466967_0036444 Ga0466967_0036444_1169_2140 304
111 3300046519 Ga0495632_0001544 Ga0495632_0001544_5224_6180 304
112 3300046522 Ga0495643_0070344 Ga0495643_0070344_61_1017 304
113 3300046616 Ga0495668_0000812 Ga0495668_0000812_9585_10541 304
114 3300046616 Ga0495668_0028691 Ga0495668_0028691_992_1948 304
115 3300047323 Ga0495683_0020908 Ga0495683_0020908_976_1932 304
116 iso_pu_bacteria 2551306093 2551743186 304
117 iso_pu_bacteria 2848297114 2848298560 304
118 iso_pu_bacteria 2929199973 2929206164 304
119 iso_pu_bacteria 2989776772 2989780784 304
120 3300005336 Ga0070680_100002841 Ga0070680_10000284110 305
121 3300005458 Ga0070681_10065889 Ga0070681_100658893 305
122 3300005548 Ga0070665_100177795 Ga0070665_1001777952 305
123 3300025909 Ga0207705_10052663 Ga0207705_100526633 305
124 3300025912 Ga0207707_10213739 Ga0207707_102137392 305
125 3300025917 Ga0207660_10126048 Ga0207660_101260482 305
126 3300025972 Ga0207668_10000837 Ga0207668_100008375 305
127 3300031731 Ga0307405_10196490 Ga0307405_101964901 305
128 3300032004 Ga0307414_10005461 Ga0307414_100054613 305
129 3300042133 Ga0450896_000130 Ga0450896_000130_45_1007 305
130 3300044659 Ga0466973_0039606 Ga0466973_0039606_1235_2206 305
131 3300044673 Ga0453683_0017892 Ga0453683_0017892_2359_3330 305
132 iso_pu_bacteria 2508501122 2509110495 305
133 iso_pu_bacteria 2509276019 2509377149 305
134 iso_pu_bacteria 2509276021 2509386367 305
135 iso_pu_bacteria 2510065019 2510135562 305
136 iso_pu_bacteria 2510065057 2510303128 305
137 iso_pu_bacteria 2511231052 2511497126 305
138 iso_pu_bacteria 2512047086 2512529598 305
139 iso_pu_bacteria 2512875026 2512968844 305
140 iso_pu_bacteria 2513237089 2513606453 305
141 iso_pu_bacteria 2513237091 2513614757 305
142 iso_pu_bacteria 2513237140 2513882273 305
143 iso_pu_bacteria 2513237143 2513901790 305
144 iso_pu_bacteria 2513237156 2513986744 305
145 iso_pu_bacteria 2513237160 2514006105 305
146 iso_pu_bacteria 2515154107 2515611720 305
147 iso_pu_bacteria 2516653046 2516895644 305
148 iso_pu_bacteria 2517287029 2517409672 305
149 iso_pu_bacteria 2517487022 2517566404 305
150 iso_pu_bacteria 2524023207 2524449378 305
151 iso_pu_bacteria 2551306084 2551678885 305
152 iso_pu_bacteria 2551306084 2551682123 305
153 iso_pu_bacteria 2551306086 2551690650 305
154 iso_pu_bacteria 2551306087 2551701586 305
155 iso_pu_bacteria 2551306089 2551712412 305
156 iso_pu_bacteria 2551306090 2551718845 305
157 iso_pu_bacteria 2551306091 2551724323 305
158 iso_pu_bacteria 2551306092 2551737212 305
159 iso_pu_bacteria 2558860100 2558862327 305
160 iso_pu_bacteria 2599185156 2599332260 305
161 iso_pu_bacteria 2615840624 2616294511 305
162 iso_pu_bacteria 2643221558 2643814179 305
163 iso_pu_bacteria 2657244999 2657685618 305
164 iso_pu_bacteria 2718217882 2719184566 305
165 iso_pu_bacteria 2718217927 2719388799 305
166 iso_pu_bacteria 2718217997 2719668579 305
167 iso_pu_bacteria 2718218009 2719728586 305
168 iso_pu_bacteria 2718218199 2720489272 305
169 iso_pu_bacteria 2718218232 2720609953 305
170 iso_pu_bacteria 2718218233 2720617377 305
171 iso_pu_bacteria 2718218235 2720628523 305
172 iso_pu_bacteria 2718218269 2720772472 305
173 iso_pu_bacteria 2718218363 2721144277 305
174 iso_pu_bacteria 2718218365 2721161070 305
175 iso_pu_bacteria 2718218366 2721161647 305
176 iso_pu_bacteria 2718218423 2721402502 305
177 iso_pu_bacteria 2721755514 2722842792 305
178 iso_pu_bacteria 2721755556 2723029908 305
179 iso_pu_bacteria 2721755684 2723564317 305
180 iso_pu_bacteria 2721755685 2723570042 305
181 iso_pu_bacteria 2721755809 2724034568 305
182 iso_pu_bacteria 2721755810 2724041611 305
183 iso_pu_bacteria 2721755819 2724092501 305
184 iso_pu_bacteria 2721755822 2724101589 305
185 iso_pu_bacteria 2721755823 2724112878 305
186 iso_pu_bacteria 2728369352 2730110441 305
187 iso_pu_bacteria 2728369365 2730160681 305
188 iso_pu_bacteria 2728369397 2730301178 305
189 iso_pu_bacteria 2791355082 2792580858 305
190 iso_pu_bacteria 2791355094 2792640636 305
191 iso_pu_bacteria 2791355253 2793282745 305
192 iso_pu_bacteria 2791355259 2793317098 305
193 iso_pu_bacteria 2791355260 2793322612 305
194 iso_pu_bacteria 2791355264 2793345456 305
195 iso_pu_bacteria 2791355267 2793370981 305
196 iso_pu_bacteria 2802428858 2802719690 305
197 iso_pu_bacteria 2802428859 2802728310 305
198 iso_pu_bacteria 2802428860 2802733520 305
199 iso_pu_bacteria 2802428861 2802738750 305
200 iso_pu_bacteria 2802428862 2802745650 305
201 iso_pu_bacteria 2802428863 2802751415 305
202 iso_pu_bacteria 2802429268 2804755138 305
203 iso_pu_bacteria 2802429605 2805928658 305
204 iso_pu_bacteria 2838016132 2838016216 305
205 iso_pu_bacteria 2838022645 2838024675 305
206 iso_pu_bacteria 2838048938 2838049694 305
207 iso_pu_bacteria 2838061910 2838061961 305
208 iso_pu_bacteria 2838068647 2838068749 305
209 iso_pu_bacteria 2838074704 2838075947 305
210 iso_pu_bacteria 2838668709 2838668811 305
211 iso_pu_bacteria 2838701080 2838701529 305
212 iso_pu_bacteria 2842146304 2842146406 305
213 iso_pu_bacteria 2842192696 2842198344 305
214 iso_pu_bacteria 2842198810 2842200220 305
215 iso_pu_bacteria 2842250916 2842251364 305
216 iso_pu_bacteria 2842264693 2842265086 305
217 iso_pu_bacteria 2842285085 2842288203 305
218 iso_pu_bacteria 2842311132 2842315705 305
219 iso_pu_bacteria 2842317721 2842319611 305
220 iso_pu_bacteria 2842402390 2842405469 305
221 iso_pu_bacteria 2842409023 2842411774 305
222 iso_pu_bacteria 2842415677 2842418699 305
223 iso_pu_bacteria 2842422224 2842422895 305
224 iso_pu_bacteria 2842428310 2842428860 305
225 iso_pu_bacteria 2842434925 2842435473 305
226 iso_pu_bacteria 2842441272 2842441664 305
227 iso_pu_bacteria 2842447887 2842448294 305
228 iso_pu_bacteria 2842462802 2842463284 305
229 iso_pu_bacteria 2842469257 2842469804 305
230 iso_pu_bacteria 2842489311 2842490484 305
231 iso_pu_bacteria 2842495871 2842501515 305
232 iso_pu_bacteria 2850079185 2850085288 305
233 iso_pu_bacteria 2855825444 2855829540 305
234 iso_pu_bacteria 2857504554 2857507680 305
235 iso_pu_bacteria 2857516855 2857521464 305
236 iso_pu_bacteria 2858800743 2858805900 305
237 iso_pu_bacteria 2913295892 2913297082 305
238 iso_pu_bacteria 2915980308 2915982100 305
239 iso_pu_bacteria 2915986958 2915988341 305
240 iso_pu_bacteria 2915993759 2916000514 305
241 iso_pu_bacteria 2916000859 2916003430 305
242 iso_pu_bacteria 2916014648 2916016005 305
243 iso_pu_bacteria 2916021584 2916021849 305
244 iso_pu_bacteria 2916028427 2916030953 305
245 iso_pu_bacteria 2916035215 2916037344 305
246 iso_pu_bacteria 2916041962 2916042200 305
247 iso_pu_bacteria 2916048683 2916048972 305
248 iso_pu_bacteria 2916055098 2916057226 305
249 iso_pu_bacteria 2916061851 2916066136 305
250 iso_pu_bacteria 2916068649 2916068651 305
251 iso_pu_bacteria 2916076590 2916079098 305
252 iso_pu_bacteria 2920760137 2920760585 305
253 iso_pu_bacteria 2921208531 2921213841 305
254 iso_pu_bacteria 2921237296 2921242129 305
255 iso_pu_bacteria 2921244191 2921246306 305
256 iso_pu_bacteria 2921250672 2921256740 305
257 iso_pu_bacteria 2921257292 2921259272 305
258 iso_pu_bacteria 2921263974 2921269797 305
259 iso_pu_bacteria 2921282425 2921286706 305
260 iso_pu_bacteria 2921296804 2921300581 305
261 iso_pu_bacteria 2924144063 2924147961 305
262 iso_pu_bacteria 2924150972 2924152846 305
263 iso_pu_bacteria 2924158325 2924161889 305
264 iso_pu_bacteria 2924165586 2924165725 305
265 iso_pu_bacteria 2924172951 2924175680 305
266 iso_pu_bacteria 2924179722 2924184254 305
267 iso_pu_bacteria 2924186466 2924186683 305
268 iso_pu_bacteria 2924193448 2924197931 305
269 iso_pu_bacteria 2924200457 2924200718 305
270 iso_pu_bacteria 2924207177 2924207341 305
271 iso_pu_bacteria 2924214083 2924214135 305
272 iso_pu_bacteria 2924221636 2924222490 305
273 iso_pu_bacteria 2924228884 2924229058 305
274 iso_pu_bacteria 2933016740 2933019161 305
275 iso_pu_bacteria 2933599457 2933600367 305
276 iso_pu_bacteria 2936996657 2936997127 305
277 iso_pu_bacteria 2937002841 2937003182 305
278 iso_pu_bacteria 2937009748 2937010030 305
279 iso_pu_bacteria 2937016420 2937020468 305
280 iso_pu_bacteria 2937023124 2937025350 305
281 iso_pu_bacteria 2937029754 2937034136 305
282 iso_pu_bacteria 2937036028 2937040258 305
283 iso_pu_bacteria 2937042894 2937045272 305
284 iso_pu_bacteria 2937056579 2937060354 305
285 iso_pu_bacteria 2937063883 2937064108 305
286 iso_pu_bacteria 2937071275 2937071843 305
287 iso_pu_bacteria 2937078374 2937084617 305
288 iso_pu_bacteria 2937084907 2937087917 305
289 iso_pu_bacteria 2937091812 2937096296 305
290 iso_pu_bacteria 2937098957 2937100962 305
291 iso_pu_bacteria 2937113482 2937115612 305
292 iso_pu_bacteria 2937119839 2937119908 305
293 iso_pu_bacteria 2937126314 2937132492 305
294 iso_pu_bacteria 2957375807 2957381135 305
295 iso_pu_bacteria 2957382221 2957382457 305
296 iso_pu_bacteria 2957395598 2957400129 305
297 iso_pu_bacteria 2957402308 2957404097 305
298 iso_pu_bacteria 2957408893 2957411483 305
299 iso_pu_bacteria 2957415311 2957416400 305
300 iso_pu_bacteria 2957422303 2957429581 305
301 iso_pu_bacteria 2957430029 2957432771 305
302 iso_pu_bacteria 2957437181 2957440732 305
303 iso_pu_bacteria 2957443900 2957445823 305
304 iso_pu_bacteria 2957450854 2957450926 305
305 iso_pu_bacteria 2957457609 2957460253 305
306 iso_pu_bacteria 2957464669 2957465394 305
307 iso_pu_bacteria 2957471148 2957474409 305
308 iso_pu_bacteria 2957478035 2957478830 305
309 iso_pu_bacteria 2957484790 2957485322 305
310 iso_pu_bacteria 2957491536 2957493371 305
311 iso_pu_bacteria 2957498199 2957498538 305
312 iso_pu_bacteria 2957505466 2957508892 305
313 iso_pu_bacteria 2960584000 2960588034 305
314 iso_pu_bacteria 2960591022 2960597029 305
315 iso_pu_bacteria 2960597568 2960600098 305
316 iso_pu_bacteria 2960603979 2960607320 305
317 iso_pu_bacteria 2960610863 2960611131 305
318 iso_pu_bacteria 2960617483 2960622490 305
319 iso_pu_bacteria 2960624210 2960625201 305
320 iso_pu_bacteria 2960631154 2960631470 305
321 iso_pu_bacteria 2960637947 2960644279 305
322 iso_pu_bacteria 2960645483 2960647320 305
323 iso_pu_bacteria 2960652885 2960657804 305
324 iso_pu_bacteria 2960660292 2960663877 305
325 iso_pu_bacteria 2960667422 2960667689 305
326 iso_pu_bacteria 2960674078 2960679203 305
327 iso_pu_bacteria 2960680706 2960682233 305
328 iso_pu_bacteria 2960687367 2960691860 305
329 iso_pu_bacteria 2960693952 2960699234 305
330 iso_pu_bacteria 2964607997 2964615044 305
331 iso_pu_bacteria 2964621998 2964626706 305
332 iso_pu_bacteria 2964628898 2964629141 305
333 iso_pu_bacteria 2964636051 2964636252 305
334 iso_pu_bacteria 2964643177 2964643246 305
335 iso_pu_bacteria 2964656573 2964662106 305
336 iso_pu_bacteria 2964663802 2964663873 305
337 iso_pu_bacteria 2964670856 2964677732 305
338 iso_pu_bacteria 2964678106 2964678221 305
339 iso_pu_bacteria 2964685014 2964685198 305
340 iso_pu_bacteria 2964691889 2964694199 305
341 iso_pu_bacteria 2964698721 2964699042 305
342 iso_pu_bacteria 2964705432 2964710850 305
343 iso_pu_bacteria 2964712639 2964716628 305
344 iso_pu_bacteria 2964719344 2964722672 305
345 iso_pu_bacteria 2967671571 2967671641 305
346 iso_pu_bacteria 2967678726 2967685584 305
347 iso_pu_bacteria 2967686174 2967689539 305
348 iso_pu_bacteria 2967699805 2967706140 305
349 iso_pu_bacteria 2967706974 2967708125 305
350 iso_pu_bacteria 2967721400 2967721539 305
351 iso_pu_bacteria 2967728569 2967730310 305
352 iso_pu_bacteria 2967735183 2967737277 305
353 iso_pu_bacteria 2967742019 2967748795 305
354 iso_pu_bacteria 2967748971 2967749042 305
355 iso_pu_bacteria 2967755722 2967755792 305
356 iso_pu_bacteria 2967769361 2967769582 305
357 iso_pu_bacteria 2967775926 2967781740 305
358 iso_pu_bacteria 2970019648 2970025943 305
359 iso_pu_bacteria 2970033650 2970033721 305
360 iso_pu_bacteria 2970047711 2970050118 305
361 iso_pu_bacteria 2970061556 2970062839 305
362 iso_pu_bacteria 2970068827 2970068897 305
363 iso_pu_bacteria 2970076120 2970078146 305
364 iso_pu_bacteria 2970082768 2970084329 305
365 iso_pu_bacteria 2970088815 2970092035 305
366 iso_pu_bacteria 2970095765 2970095836 305
367 iso_pu_bacteria 2970102677 2970102747 305
368 iso_pu_bacteria 2970109326 2970111209 305
369 iso_pu_bacteria 2970122695 2970125703 305
370 iso_pu_bacteria 2970136068 2970136188 305
371 iso_pu_bacteria 2970143518 2970149432 305
372 iso_pu_bacteria 2970149975 2970151997 305
373 iso_pu_bacteria 2970156795 2970160018 305
374 iso_pu_bacteria 2970164137 2970168984 305
375 iso_pu_bacteria 2970170962 2970171033 305
376 iso_pu_bacteria 2970177841 2970183782 305
377 iso_pu_bacteria 2970184632 2970189530 305
378 iso_pu_bacteria 2970191845 2970191989 305
379 iso_pu_bacteria 2977516862 2977518388 305
380 iso_pu_bacteria 2977523885 2977526399 305
381 iso_pu_bacteria 2977530762 2977535591 305
382 iso_pu_bacteria 2977537788 2977539701 305
383 iso_pu_bacteria 2977544691 2977548927 305
384 iso_pu_bacteria 2977551784 2977556021 305
385 iso_pu_bacteria 2977558990 2977560547 305
386 iso_pu_bacteria 2977565890 2977566215 305
387 iso_pu_bacteria 3005409236 3005413775 305
388 iso_pu_bacteria 3005409236 3005416555 305
389 iso_pu_bacteria 648276728 648735650 305
390 iso_pu_bacteria 8003992118 8003997164 305
391 iso_pu_bacteria 8003999396 8004004875 305
392 iso_pu_bacteria 8005275841 8005276210 305
393 iso_pu_bacteria 8005282627 8005288591 305
394 iso_pu_bacteria 8005289223 8005292291 305
395 iso_pu_bacteria 8005301065 8005301574 305
396 iso_pu_bacteria 8005382845 8005384275 305
397 iso_pu_bacteria 8005395548 8005401626 305
398 iso_pu_bacteria 8005430974 8005431510 305
399 iso_pu_bacteria 8005497431 8005502828 305
400 iso_pu_bacteria 8005542996 8005548845 305
401 iso_pu_bacteria 8005619151 8005623976 305
402 iso_pu_bacteria 8005626139 8005629241 305
403 iso_pu_bacteria 8005668836 8005674258 305
404 iso_pu_bacteria 8005688590 8005693333 305
405 iso_pu_bacteria 8018127388 8018129087 305
406 iso_pu_bacteria 8018176218 8018179349 305
407 iso_pu_bacteria 8024501048 8024501965 305
408 iso_pu_bacteria 8049293176 8049298176 305
409 iso_pu_bacteria 8055431914 8055432539 305
410 iso_pu_bacteria 8056875544 8056877712 305
411 3300044658 Ga0466972_0003845 Ga0466972_0003845_1160_2167 306
412 3300044706 Ga0466964_0001414 Ga0466964_0001414_1747_2754 306
413 3300044735 Ga0466968_0063665 Ga0466968_0063665_570_1577 306
414 3300002739 JGI25158J39367_1000322 JGI25158J39367_10003225 307
415 3300002773 JGI25152J39213_1001992 JGI25152J39213_10019925 307
416 3300002987 JGI25159J45721_1000593 JGI25159J45721_100059314 307
417 3300003316 rootH1_10067800 rootH1_100678005 307
418 3300003322 rootL2_10015096 rootL2_100150964 307
419 3300003354 JGI25160J50197_1001174 JGI25160J50197_100117411 307
420 3300003374 JGI25161J50226_1000029 JGI25161J50226_1000029160 307
421 3300003775 Ga0055524_1009224 Ga0055524_10092244 307
422 3300003790 Ga0055528_1006379 Ga0055528_10063793 307
423 3300003792 Ga0055540_1000157 Ga0055540_100015744 307
424 3300004625 Ga0055543_1000016 Ga0055543_100001687 307
425 3300005262 Ga0065165_1002037 Ga0065165_10020375 307
426 3300005343 Ga0070687_100016545 Ga0070687_1000165451 307
427 3300005457 Ga0070662_100029360 Ga0070662_1000293603 307
428 3300005614 Ga0068856_100012905 Ga0068856_1000129056 307
429 3300006946 Ga0079104_1002880 Ga0079104_10028807 307
430 3300009551 Ga0105238_10000013 Ga0105238_1000001356 307
431 3300013102 Ga0157371_10302521 Ga0157371_103025211 307
432 3300025208 Ga0209436_100015 Ga0209436_100015143 307
433 3300025258 Ga0209129_1001134 Ga0209129_10011344 307
434 3300025273 Ga0209673_1012050 Ga0209673_10120504 307
435 3300025284 Ga0209130_1000051 Ga0209130_1000051110 307
436 3300025294 Ga0209025_1050476 Ga0209025_10504762 307
437 3300025298 Ga0209050_1001362 Ga0209050_10013627 307
438 3300025299 Ga0209256_1002750 Ga0209256_10027504 307
439 3300025302 Ga0207426_1000043 Ga0207426_1000043328 307
440 3300025302 Ga0207426_1001061 Ga0207426_10010615 307
441 3300025303 Ga0209051_1000032 Ga0209051_1000032108 307
442 3300025304 Ga0209257_1003356 Ga0209257_10033567 307
443 3300025304 Ga0209257_1010651 Ga0209257_10106514 307
444 3300025917 Ga0207660_10000419 Ga0207660_1000041922 307
445 3300025918 Ga0207662_10029168 Ga0207662_100291683 307
446 3300025924 Ga0207694_10000026 Ga0207694_10000026189 307
447 3300025933 Ga0207706_10000659 Ga0207706_1000065934 307
448 3300026078 Ga0207702_10040902 Ga0207702_100409022 307
449 3300027111 Ga0209281_1000185 Ga0209281_100018581 307
450 3300030500 Ga0268256_1000013 Ga0268256_1000013570 307
451 3300031548 Ga0307408_100036845 Ga0307408_1000368453 307
452 3300031548 Ga0307408_100123505 Ga0307408_1001235052 307
453 3300031548 Ga0307408_100153070 Ga0307408_1001530702 307
454 3300031731 Ga0307405_10195808 Ga0307405_101958082 307
455 3300031901 Ga0307406_10175130 Ga0307406_101751302 307
456 3300031911 Ga0307412_10136910 Ga0307412_101369102 307
457 3300031911 Ga0307412_10194499 Ga0307412_101944992 307
458 3300031995 Ga0307409_100210663 Ga0307409_1002106632 307
459 3300032002 Ga0307416_100035331 Ga0307416_1000353314 307
460 3300032126 Ga0307415_100062133 Ga0307415_1000621332 307
461 3300037471 Ga0395905_0001224 Ga0395905_0001224_18427_19416 307
462 3300039437 Ga0436365_0569979 Ga0436365_0569979_668_1651 307
463 3300041413 Ga0439465_0000138 Ga0439465_0000138_2988_4205 307
464 3300041413 Ga0439465_0000227 Ga0439465_0000227_2308_3294 307
465 3300041512 Ga0451853_1278377 Ga0451853_1278377_887_1873 307
466 3300042007 Ga0439449_0006116 Ga0439449_0006116_3301_4518 307
467 3300042007 Ga0439449_0027494 Ga0439449_0027494_765_1757 307
468 3300044658 Ga0466972_0035459 Ga0466972_0035459_528_1499 307
469 3300046512 Ga0495610_0000518 Ga0495610_0000518_10831_11820 307
470 3300046522 Ga0495643_0036913 Ga0495643_0036913_1087_2076 307
471 3300046616 Ga0495668_0012293 Ga0495668_0012293_3150_4133 307
472 3300049459 Ga0495678_012685 Ga0495678_012685_1513_2502 307
473 3300049521 Ga0501298_015440 Ga0501298_015440_45_1028 307
474 3300049582 Ga0501048_0038457 Ga0501048_0038457_135_1124 307
475 3300049765 Ga0501268_006140 Ga0501268_006140_675_1670 307
476 3300059421 Ga0590071_007400 Ga0590071_007400_1282_2265 307
477 3300059426 Ga0590077_019217 Ga0590077_019217_332_1315 307
478 iso_pu_bacteria 2910245624 2910248543 307
479 iso_pu_bacteria 2970026789 2970028943 307
480 3300002075 JGI24738J21930_10000568 JGI24738J21930_100005688 308
481 3300009093 Ga0105240_10094222 Ga0105240_100942223 308
482 3300026041 Ga0207639_10040635 Ga0207639_100406353 308
483 3300037312 Ga0395899_0061648 Ga0395899_0061648_304_1275 308
484 3300044684 Ga0466966_0004705 Ga0466966_0004705_6195_7211 308
485 3300044719 Ga0466971_0074308 Ga0466971_0074308_501_1469 308
486 3300044842 Ga0466957_0001404 Ga0466957_0001404_8426_9397 308
487 3300045049 Ga0466959_0063046 Ga0466959_0063046_1529_2545 308
488 3300045049 Ga0466959_0311270 Ga0466959_0311270_10_978 308
489 3300045836 Ga0466958_0000406 Ga0466958_0000406_11306_12277 308
490 3300045976 Ga0466967_0158898 Ga0466967_0158898_521_1489 308
491 iso_pu_bacteria 2508501050 2508734103 308
492 iso_pu_bacteria 2894232714 2894233550 308
493 3300005353 Ga0070669_100130822 Ga0070669_1001308222 309
494 3300013102 Ga0157371_10012821 Ga0157371_100128215 309
495 3300013102 Ga0157371_10139252 Ga0157371_101392522 309
496 3300013307 Ga0157372_10121469 Ga0157372_101214693 309
497 3300026116 Ga0207674_10015790 Ga0207674_100157906 309
498 3300031901 Ga0307406_10062467 Ga0307406_100624672 309
499 3300031903 Ga0307407_10024189 Ga0307407_100241892 309
500 3300032002 Ga0307416_100005613 Ga0307416_1000056134 309
501 3300032126 Ga0307415_100031268 Ga0307415_1000312682 309
502 3300037418 Ga0395900_0002600 Ga0395900_0002600_7895_8866 309
503 3300037418 Ga0395900_0026359 Ga0395900_0026359_3160_4128 309
504 3300037471 Ga0395905_0078382 Ga0395905_0078382_1814_2782 309
505 3300037853 Ga0436364_1456225 Ga0436364_1456225_291_1274 309
506 3300038443 Ga0395901_0000041 Ga0395901_0000041_174659_175630 309
507 3300038443 Ga0395901_0092622 Ga0395901_0092622_437_1408 309
508 3300044694 Ga0466963_0054156 Ga0466963_0054156_192_1163 309
509 3300044735 Ga0466968_0000809 Ga0466968_0000809_4599_5567 309
510 3300045049 Ga0466959_0051021 Ga0466959_0051021_64_1032 309
511 3300045836 Ga0466958_0038814 Ga0466958_0038814_53_1021 309
512 3300045836 Ga0466958_0135275 Ga0466958_0135275_342_1313 309
513 3300045976 Ga0466967_0057453 Ga0466967_0057453_388_1356 309
514 3300049581 Ga0501047_0075656 Ga0501047_0075656_1229_2221 309
515 3300049823 Ga0501044_0078798 Ga0501044_0078798_1743_2735 309
516 3300044735 Ga0466968_0084851 Ga0466968_0084851_148_1128 310
517 3300025909 Ga0207705_10207479 Ga0207705_102074791 311
518 3300031852 Ga0307410_10148379 Ga0307410_101483792 311
519 3300032004 Ga0307414_10114201 Ga0307414_101142012 311
520 iso_pu_bacteria 2775507255 2778123470 311
521 3300050509 nmdc:mga0qj67_281695_c1 nmdc:mga0qj67_281695_c1_301_1287 312
522 3300053104 Ga0500556_0001296 Ga0500556_0001296_7793_8815 313
523 3300001989 JGI24739J22299_10002644 JGI24739J22299_100026447 314
524 3300002067 JGI24735J21928_10039787 JGI24735J21928_100397872 314
525 3300005616 Ga0068852_100485396 Ga0068852_1004853961 314
526 3300010375 Ga0105239_10028786 Ga0105239_100287866 314
527 3300013104 Ga0157370_10000377 Ga0157370_1000037726 314
528 3300013105 Ga0157369_10000207 Ga0157369_1000020763 314
529 3300013105 Ga0157369_10031443 Ga0157369_100314436 314
530 3300025321 Ga0207656_10011803 Ga0207656_100118032 314
531 3300025904 Ga0207647_10147394 Ga0207647_101473942 314
532 3300025924 Ga0207694_10334853 Ga0207694_103348532 314
533 3300031548 Ga0307408_100000134 Ga0307408_10000013450 314
534 3300031731 Ga0307405_10000157 Ga0307405_1000015712 314
535 3300031824 Ga0307413_10003349 Ga0307413_100033492 314
536 3300031852 Ga0307410_10001278 Ga0307410_100012787 314
537 3300031901 Ga0307406_10000882 Ga0307406_100008822 314
538 3300031903 Ga0307407_10012789 Ga0307407_100127892 314
539 3300031911 Ga0307412_10000337 Ga0307412_1000033729 314
540 3300031995 Ga0307409_100006934 Ga0307409_1000069342 314
541 3300032002 Ga0307416_100000247 Ga0307416_1000002475 314
542 3300032004 Ga0307414_10000469 Ga0307414_100004698 314
543 3300032005 Ga0307411_10001263 Ga0307411_100012637 314
544 3300037471 Ga0395905_0044632 Ga0395905_0044632_1562_2611 314
545 iso_pu_bacteria 2671180139 2671693812 314
546 iso_pu_bacteria 2773857925 2774868997 314
547 iso_pu_bacteria 2882456835 2882457435 314
548 3300001990 JGI24737J22298_10000430 JGI24737J22298_100004307 315
549 3300002067 JGI24735J21928_10039625 JGI24735J21928_100396252 315
550 3300005344 Ga0070661_100006689 Ga0070661_1000066897 315
551 3300005366 Ga0070659_100247318 Ga0070659_1002473182 315
552 3300005455 Ga0070663_100164521 Ga0070663_1001645212 315
553 3300005539 Ga0068853_100008199 Ga0068853_1000081995 315
554 3300005563 Ga0068855_100003065 Ga0068855_10000306516 315
555 3300005578 Ga0068854_100002485 Ga0068854_1000024854 315
556 3300005616 Ga0068852_100000899 Ga0068852_10000089920 315
557 3300009093 Ga0105240_10012918 Ga0105240_100129186 315
558 3300025904 Ga0207647_10126745 Ga0207647_101267452 315
559 3300025913 Ga0207695_10009693 Ga0207695_100096936 315
560 3300025913 Ga0207695_10065883 Ga0207695_100658834 315
561 3300025924 Ga0207694_10160271 Ga0207694_101602712 315
562 3300025933 Ga0207706_10000720 Ga0207706_1000072034 315
563 3300025949 Ga0207667_10011644 Ga0207667_1001164410 315
564 3300025949 Ga0207667_10168208 Ga0207667_101682082 315
565 3300025981 Ga0207640_10002237 Ga0207640_1000223710 315
566 3300025981 Ga0207640_10070323 Ga0207640_100703232 315
567 3300026067 Ga0207678_10059355 Ga0207678_100593553 315
568 3300026078 Ga0207702_10011286 Ga0207702_100112867 315
569 3300026116 Ga0207674_10006773 Ga0207674_1000677310 315
570 3300026142 Ga0207698_10007871 Ga0207698_100078712 315
571 3300031852 Ga0307410_10000178 Ga0307410_1000017810 315
572 3300031911 Ga0307412_10041792 Ga0307412_100417923 315
573 3300031995 Ga0307409_100000947 Ga0307409_1000009479 315
574 3300032004 Ga0307414_10001219 Ga0307414_1000121910 315
575 3300032005 Ga0307411_10034196 Ga0307411_100341963 315
576 3300001904 JGI24736J21556_1001644 JGI24736J21556_10016442 316
577 3300001979 JGI24740J21852_10009258 JGI24740J21852_100092583 316
578 3300005327 Ga0070658_10135805 Ga0070658_101358052 316
579 3300005339 Ga0070660_100029143 Ga0070660_1000291435 316
580 3300005344 Ga0070661_100014668 Ga0070661_1000146682 316
581 3300005455 Ga0070663_100056743 Ga0070663_1000567432 316
582 3300005578 Ga0068854_100126984 Ga0068854_1001269842 316
583 3300005616 Ga0068852_100043494 Ga0068852_1000434943 316
584 3300009551 Ga0105238_10059877 Ga0105238_100598772 316
585 3300013102 Ga0157371_10003292 Ga0157371_100032922 316
586 3300013105 Ga0157369_10013769 Ga0157369_1001376911 316
587 3300013307 Ga0157372_10248215 Ga0157372_102482152 316
588 3300025909 Ga0207705_10000033 Ga0207705_100000339 316
589 3300025909 Ga0207705_10007536 Ga0207705_100075366 316
590 3300025913 Ga0207695_10011979 Ga0207695_100119796 316
591 3300025919 Ga0207657_10009020 Ga0207657_100090207 316
592 3300025920 Ga0207649_10007462 Ga0207649_100074623 316
593 3300025932 Ga0207690_10019474 Ga0207690_100194745 316
594 3300025949 Ga0207667_10047744 Ga0207667_100477444 316
595 3300025949 Ga0207667_10065435 Ga0207667_100654353 316
596 3300026067 Ga0207678_10019909 Ga0207678_100199092 316
597 3300026078 Ga0207702_10143584 Ga0207702_101435842 316
598 3300026116 Ga0207674_10141460 Ga0207674_101414602 316
599 3300026142 Ga0207698_10021854 Ga0207698_100218542 316
600 3300031548 Ga0307408_100130255 Ga0307408_1001302552 316
601 3300031731 Ga0307405_10063329 Ga0307405_100633292 316
602 3300031824 Ga0307413_10042750 Ga0307413_100427502 316
603 3300031824 Ga0307413_10087539 Ga0307413_100875392 316
604 3300031852 Ga0307410_10053462 Ga0307410_100534622 316
605 3300031911 Ga0307412_10227928 Ga0307412_102279282 316
606 3300031995 Ga0307409_100011607 Ga0307409_1000116074 316
607 3300031995 Ga0307409_100014651 Ga0307409_1000146515 316
608 3300031995 Ga0307409_100188158 Ga0307409_1001881582 316
609 3300032002 Ga0307416_100111040 Ga0307416_1001110402 316
610 3300032004 Ga0307414_10001655 Ga0307414_100016552 316
611 3300032005 Ga0307411_10170002 Ga0307411_101700022 316
612 3300037312 Ga0395899_0012868 Ga0395899_0012868_747_1736 316
613 3300037418 Ga0395900_0067914 Ga0395900_0067914_1719_2708 316
614 3300037418 Ga0395900_0183389 Ga0395900_0183389_755_1744 316
615 3300037466 Ga0395898_0014597 Ga0395898_0014597_1687_2676 316
616 3300037471 Ga0395905_0091264 Ga0395905_0091264_255_1244 316
617 3300037853 Ga0436364_1265123 Ga0436364_1265123_38851_40017 316
618 3300038443 Ga0395901_0135976 Ga0395901_0135976_882_1871 316
619 3300038443 Ga0395901_0305563 Ga0395901_0305563_566_1555 316
620 3300044693 Ga0466961_0017850 Ga0466961_0017850_18_1007 316
621 3300044694 Ga0466963_0000716 Ga0466963_0000716_11626_12615 316
622 3300044719 Ga0466971_0029738 Ga0466971_0029738_482_1471 316
623 3300044765 Ga0466970_0018867 Ga0466970_0018867_2340_3329 316
624 3300044842 Ga0466957_0003352 Ga0466957_0003352_3555_4544 316
625 3300045836 Ga0466958_0009040 Ga0466958_0009040_4205_5194 316
626 3300047472 Ga0495686_0000660 Ga0495686_0000660_2684_3706 316
627 3300047472 Ga0495686_0132701 Ga0495686_0132701_351_1373 316
628 3300048912 Ga0496109_0125399 Ga0496109_0125399_1054_2085 316
629 3300048914 Ga0496111_0052242 Ga0496111_0052242_1515_2546 316
630 3300048916 Ga0496113_0017539 Ga0496113_0017539_345_1376 316
631 3300048928 Ga0496125_0023018 Ga0496125_0023018_3825_4856 316

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

169

298

0.86

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

47

131

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gsm-assembly1.cif.gz_G crystal structure of vibmo1 0.9145 134 166
4hsu-assembly1.cif.gz_A crystal structure of lsd2-npac with h3(1-26)in space group p21 0.9069 132 166
1e3j-assembly1.cif.gz_A ketose reductase (sorbitol dehydrogenase) from silverleaf whitefly 0.8601 13 314
5yln-assembly2.cif.gz_D zinc dependent alcohol dehydrogenase 2 from streptococcus pneumonia - apo form 0.8588 11 314
5vm2-assembly1.cif.gz_A crystal structure of eck1772, an oxidoreductase/dehydrogenase of unknown specificity involved in membrane biogenesis from escherichia coli 0.8584 12 315
ID Description Score Start End Superfamily
af_A0A1D6MLW1_1_166_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9543 144 182 3.20.20.70
af_P39400_150_283_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9372 121 253 3.40.50.720
af_O15229_1_369_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9329 134 167 3.50.50.60
1vj0A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9325 120 253 3.40.50.720
af_O07737_155_282_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9272 124 252 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2K9MJA0-F1-model_v4 L-iditol 2-dehydrogenase 0.9785 13 316 GO:0008270
GO:0016616
AF-A0A2T4JML7-F1-model_v4 L-iditol 2-dehydrogenase 0.9601 13 257 GO:0016491
AF-T0Z246-F1-model_v4 Alcohol dehydrogenase GroES domain protein 0.9327 130 254
AF-A0A537I7X8-F1-model_v4 Zinc-binding dehydrogenase 0.9323 115 316 GO:0016491
AF-A0A7W0KE89-F1-model_v4 Zinc-binding dehydrogenase 0.9299 193 315

Feature Viewer

pLDDT pTM Quality
88.62 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map