F470860

General Info

Members Datasets Scaffolds Average Seq Length
630 234 1260 221

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0098223|Ga0466967_0098223_1621_2436
Length 271
Sequence VGKGESFPNPSGAIRMGFSFSGNSSETSPSRRRSKFYEEKIMSTATLDPATSSVPRINDVAPDFTAETTQGTIHFHDWIGNGWAVLFSHPKDFTPVCTTELGSMAKLQPEFAKRNTKILALSVDPVADHTKWQADIEETQGAKVNYPMIGDPQLKIAKLYGMLPAAAGDSSQGRTPNDNATVRTVFVIGPDKKIKMQLSYPMSTGRNFDEILRVIDSLQLTAKHQVSTPANWKVGEDVIISGSVTNEQAKEKYPGGWKTPKPYMRIVPQPK

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
100 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
106 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
107 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
156 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
157 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
158 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
159 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
160 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
161 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
162 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
163 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
166 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
167 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
168 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
169 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
170 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
171 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
172 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
180 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
181 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
182 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
183 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
184 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
185 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
186 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
187 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
188 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
189 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
190 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
191 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
192 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
193 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
194 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
195 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
196 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
197 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
198 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
199 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
200 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
201 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
202 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
203 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
204 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
205 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
206 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
207 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
208 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
209 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
210 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
211 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
212 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
213 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
214 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
215 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
224 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
227 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
228 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
229 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
230 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
231 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
232 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
233 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
234 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.78
Metatranscriptomes 2.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.43
Rhizosphere 98.41
Stem 0
Stem Tuber 0
Unclassified 0.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0098223 3300045976 Bacteria 2673
2 Ga0058863_10022191 3300004799 Bacteria 980
3 Ga0058861_11523593 3300004800 Bacteria 1400
4 Ga0058861_11941984 3300004800 Bacteria 736
5 Ga0058862_12068421 3300004803 Unclassified 793
6 Ga0058862_12713580 3300004803 Bacteria 990
7 Ga0065707_10470053 3300005295 Bacteria 783
8 Ga0070658_10024162 3300005327 Bacteria 4877
9 Ga0070658_10402407 3300005327 Bacteria 1176
10 Ga0070683_100018053 3300005329 Bacteria 6241
11 Ga0070683_100023254 3300005329 Bacteria 5542
12 Ga0070683_100082180 3300005329 Bacteria 3016
13 Ga0070683_100180819 3300005329 Bacteria 2002
14 Ga0070683_100211426 3300005329 Bacteria 1843
15 Ga0070683_100341865 3300005329 Bacteria 1425
16 Ga0070690_100268775 3300005330 Bacteria 1212
17 Ga0068869_100851338 3300005334 Bacteria 786
18 Ga0070666_10054786 3300005335 Bacteria 2690
19 Ga0070666_10092237 3300005335 Bacteria 2082
20 Ga0070680_100000783 3300005336 Bacteria 22328
21 Ga0070680_100029498 3300005336 Bacteria 4407
22 Ga0070680_100135047 3300005336 Bacteria 2066
23 Ga0070680_100420918 3300005336 Bacteria 1139
24 Ga0068868_100014999 3300005338 Bacteria 5722
25 Ga0068868_100610950 3300005338 Bacteria 967
26 Ga0070660_100005911 3300005339 Bacteria 8463
27 Ga0070660_100085386 3300005339 Bacteria 2482
28 Ga0070660_100213260 3300005339 Bacteria 1568
29 Ga0070691_10002999 3300005341 Bacteria 7562
30 Ga0070691_10127410 3300005341 Bacteria 1287
31 Ga0070661_100006661 3300005344 Bacteria 7964
32 Ga0070661_100192508 3300005344 Bacteria 1556
33 Ga0070668_100128329 3300005347 Bacteria 2033
34 Ga0070673_100945677 3300005364 Bacteria 800
35 Ga0070688_100307948 3300005365 Bacteria 1147
36 Ga0070659_100012657 3300005366 Bacteria 6259
37 Ga0070667_100034390 3300005367 Bacteria 4240
38 Ga0070703_10009010 3300005406 Bacteria 2814
39 Ga0070709_10005332 3300005434 Bacteria 6964
40 Ga0070709_10023437 3300005434 Bacteria 3624
41 Ga0070709_10064132 3300005434 Bacteria 2348
42 Ga0070709_10437819 3300005434 Bacteria 983
43 Ga0070714_100000123 3300005435 Bacteria 61492
44 Ga0070714_100363563 3300005435 Bacteria 1361
45 Ga0070714_100550811 3300005435 Bacteria 1104
46 Ga0070714_100554250 3300005435 Bacteria 1101
47 Ga0070714_100636919 3300005435 Bacteria 1025
48 Ga0070713_100000525 3300005436 Bacteria 24290
49 Ga0070713_100004714 3300005436 Bacteria 9214
50 Ga0070713_100005082 3300005436 Bacteria 8953
51 Ga0070713_100009046 3300005436 Bacteria 7103
52 Ga0070713_100009335 3300005436 Bacteria 7015
53 Ga0070713_100016633 3300005436 Bacteria 5533
54 Ga0070713_100046983 3300005436 Bacteria 3546
55 Ga0070713_100054724 3300005436 Bacteria 3312
56 Ga0070713_100085534 3300005436 Bacteria 2702
57 Ga0070713_100151586 3300005436 Bacteria 2063
58 Ga0070713_100411440 3300005436 Bacteria 1265
59 Ga0070710_10001574 3300005437 Bacteria 10772
60 Ga0070710_10006435 3300005437 Bacteria 5643
61 Ga0070710_10048297 3300005437 Bacteria 2377
62 Ga0070710_10091982 3300005437 Bacteria 1791
63 Ga0070710_10136974 3300005437 Bacteria 1498
64 Ga0070710_10141322 3300005437 Bacteria 1477
65 Ga0070710_10164583 3300005437 Bacteria 1378
66 Ga0070711_100001301 3300005439 Bacteria 13577
67 Ga0070711_100039108 3300005439 Bacteria 3193
68 Ga0070711_100115856 3300005439 Bacteria 1974
69 Ga0070711_100263287 3300005439 Bacteria 1357
70 Ga0070705_100000929 3300005440 Bacteria 16406
71 Ga0070694_100001219 3300005444 Bacteria 14859
72 Ga0070708_100001593 3300005445 Bacteria 17388
73 Ga0070708_100049551 3300005445 Bacteria 3716
74 Ga0070663_100080015 3300005455 Bacteria 2399
75 Ga0070663_100085042 3300005455 Bacteria 2333
76 Ga0070663_100642658 3300005455 Bacteria 896
77 Ga0070681_10000423 3300005458 Bacteria 34363
78 Ga0070681_10044927 3300005458 Bacteria 4421
79 Ga0070681_10111327 3300005458 Bacteria 2677
80 Ga0070681_10127977 3300005458 Bacteria 2472
81 Ga0070681_10265859 3300005458 Bacteria 1627
82 Ga0068867_100262137 3300005459 Bacteria 1409
83 Ga0070706_100009306 3300005467 Bacteria 9154
84 Ga0070706_100065588 3300005467 Bacteria 3358
85 Ga0070706_100077545 3300005467 Bacteria 3075
86 Ga0070707_100002202 3300005468 Bacteria 18603
87 Ga0070698_100018870 3300005471 Bacteria 7257
88 Ga0070698_100034372 3300005471 Bacteria 5247
89 Ga0070699_100017250 3300005518 Bacteria 6199
90 Ga0070699_100203773 3300005518 Bacteria 1760
91 Ga0070699_100324572 3300005518 Bacteria 1384
92 Ga0070699_100330054 3300005518 Bacteria 1372
93 Ga0070679_100003399 3300005530 Bacteria 14577
94 Ga0070679_100136740 3300005530 Bacteria 2431
95 Ga0070679_100300618 3300005530 Bacteria 1555
96 Ga0070684_100001413 3300005535 Bacteria 17268
97 Ga0070684_100017208 3300005535 Bacteria 5926
98 Ga0070684_100042835 3300005535 Bacteria 3909
99 Ga0070684_100292091 3300005535 Bacteria 1495
100 Ga0070684_100384314 3300005535 Bacteria 1293
101 Ga0070684_100415343 3300005535 Bacteria 1242
102 Ga0070684_100751045 3300005535 Bacteria 911
103 Ga0070684_101011717 3300005535 Bacteria 780
104 Ga0070697_100000661 3300005536 Bacteria 25959
105 Ga0070697_100000964 3300005536 Bacteria 21717
106 Ga0070697_100087508 3300005536 Bacteria 2572
107 Ga0070697_100424809 3300005536 Bacteria 1155
108 Ga0068853_100072614 3300005539 Bacteria 2999
109 Ga0068853_100184337 3300005539 Bacteria 1894
110 Ga0068853_100277670 3300005539 Bacteria 1544
111 Ga0070695_100000974 3300005545 Bacteria 15560
112 Ga0070695_100254401 3300005545 Bacteria 1280
113 Ga0070696_100003593 3300005546 Bacteria 10329
114 Ga0070696_100174344 3300005546 Bacteria 1592
115 Ga0070696_100543485 3300005546 Bacteria 930
116 Ga0070693_100000001 3300005547 Bacteria 99999
117 Ga0070665_100014733 3300005548 Bacteria 7845
118 Ga0070665_100113312 3300005548 Bacteria 2714
119 Ga0070665_100338568 3300005548 Bacteria 1509
120 Ga0070665_100348250 3300005548 Bacteria 1487
121 Ga0070704_100026154 3300005549 Bacteria 3852
122 Ga0068855_100002803 3300005563 Bacteria 21449
123 Ga0068855_100007175 3300005563 Bacteria 13522
124 Ga0068855_100065274 3300005563 Bacteria 4244
125 Ga0068855_100099372 3300005563 Bacteria 3352
126 Ga0068855_100150073 3300005563 Bacteria 2650
127 Ga0068855_100152403 3300005563 Bacteria 2628
128 Ga0068855_100165500 3300005563 Bacteria 2507
129 Ga0070664_100149970 3300005564 Bacteria 2058
130 Ga0068857_100005447 3300005577 Bacteria 10854
131 Ga0068857_100007263 3300005577 Bacteria 9542
132 Ga0068854_100032676 3300005578 Bacteria 3622
133 Ga0068854_100243179 3300005578 Bacteria 1434
134 Ga0068854_100257817 3300005578 Bacteria 1395
135 Ga0068856_100004213 3300005614 Bacteria 14356
136 Ga0068856_100093738 3300005614 Bacteria 2988
137 Ga0068856_100102672 3300005614 Bacteria 2853
138 Ga0068852_100097185 3300005616 Bacteria 2649
139 Ga0068852_100380822 3300005616 Bacteria 1384
140 Ga0068859_100040888 3300005617 Bacteria 4657
141 Ga0068859_100297875 3300005617 Bacteria 1706
142 Ga0068864_100132415 3300005618 Bacteria 2241
143 Ga0068866_10019342 3300005718 Bacteria 3098
144 Ga0068866_10165633 3300005718 Bacteria 1293
145 Ga0068863_100148373 3300005841 Bacteria 2244
146 Ga0068863_100460577 3300005841 Bacteria 1249
147 Ga0068858_100141656 3300005842 Bacteria 2257
148 Ga0068858_100153275 3300005842 Bacteria 2167
149 Ga0068860_100005546 3300005843 Bacteria 12774
150 Ga0068860_100005816 3300005843 Bacteria 12415
151 Ga0081540_1088807 3300005983 Bacteria 1365
152 Ga0070717_10000567 3300006028 Bacteria 23595
153 Ga0070717_10005528 3300006028 Bacteria 9220
154 Ga0070717_10005564 3300006028 Bacteria 9194
155 Ga0070717_10140220 3300006028 Bacteria 2085
156 Ga0070717_10156113 3300006028 Bacteria 1977
157 Ga0070717_10499711 3300006028 Bacteria 1099
158 Ga0070716_100005895 3300006173 Bacteria 5961
159 Ga0070716_100030020 3300006173 Bacteria 2945
160 Ga0070716_100039391 3300006173 Bacteria 2623
161 Ga0070716_100040643 3300006173 Bacteria 2588
162 Ga0070716_100253269 3300006173 Bacteria 1201
163 Ga0070712_100000116 3300006175 Bacteria 41529
164 Ga0070712_100009620 3300006175 Bacteria 6094
165 Ga0070712_100224208 3300006175 Bacteria 1489
166 Ga0070712_100279099 3300006175 Bacteria 1345
167 Ga0070712_100551753 3300006175 Bacteria 971
168 Ga0097621_100008175 3300006237 Bacteria 7523
169 Ga0097621_100050868 3300006237 Bacteria 3370
170 Ga0097621_100051890 3300006237 Bacteria 3339
171 Ga0097621_100154707 3300006237 Bacteria 1967
172 Ga0097621_100240787 3300006237 Bacteria 1581
173 Ga0097621_100563701 3300006237 Bacteria 1038
174 Ga0068871_100006928 3300006358 Bacteria 8076
175 Ga0068871_100016935 3300006358 Bacteria 5503
176 Ga0068871_100017818 3300006358 Bacteria 5384
177 Ga0068871_100063002 3300006358 Bacteria 3032
178 Ga0068871_100075660 3300006358 Bacteria 2780
179 Ga0068871_100137205 3300006358 Bacteria 2078
180 Ga0068871_100324237 3300006358 Bacteria 1357
181 Ga0068871_100445274 3300006358 Bacteria 1160
182 Ga0068871_100499936 3300006358 Bacteria 1096
183 Ga0075430_100035179 3300006846 Bacteria 4251
184 Ga0075431_100016669 3300006847 Bacteria 7459
185 Ga0075431_100252863 3300006847 Bacteria 1790
186 Ga0075434_100055597 3300006871 Bacteria 3933
187 Ga0075434_100430128 3300006871 Bacteria 1341
188 Ga0075434_100639842 3300006871 Bacteria 1082
189 Ga0075429_100007717 3300006880 Bacteria 9339
190 Ga0068865_100018274 3300006881 Bacteria 4523
191 Ga0075436_100000204 3300006914 Bacteria 36655
192 Ga0075436_100005553 3300006914 Bacteria 8666
193 Ga0097620_100040888 3300006931 Bacteria 4657
194 Ga0097620_100297855 3300006931 Bacteria 1706
195 Ga0075435_100015310 3300007076 Bacteria 5763
196 Ga0075435_100048210 3300007076 Bacteria 3422
197 Ga0075435_100549291 3300007076 Bacteria 1000
198 Ga0099794_10126546 3300007265 Bacteria 1288
199 Ga0099795_10000972 3300007788 Bacteria 5837
200 Ga0105240_10000682 3300009093 Bacteria 62492
201 Ga0105240_10037341 3300009093 Bacteria 6244
202 Ga0105240_10037451 3300009093 Bacteria 6234
203 Ga0105240_10040537 3300009093 Bacteria 5954
204 Ga0105240_10074606 3300009093 Bacteria 4186
205 Ga0105240_10285641 3300009093 Bacteria 1894
206 Ga0105240_10332472 3300009093 Bacteria 1728
207 Ga0105240_10335844 3300009093 Bacteria 1718
208 Ga0105240_10403599 3300009093 Bacteria 1539
209 Ga0105240_10437035 3300009093 Bacteria 1467
210 Ga0105240_10629697 3300009093 Bacteria 1178
211 Ga0105240_10684312 3300009093 Bacteria 1121
212 Ga0105245_10001767 3300009098 Bacteria 19697
213 Ga0105245_10005601 3300009098 Bacteria 11034
214 Ga0105245_10023489 3300009098 Bacteria 5412
215 Ga0105245_10023809 3300009098 Bacteria 5376
216 Ga0105245_10075744 3300009098 Bacteria 3064
217 Ga0105245_10099570 3300009098 Bacteria 2687
218 Ga0105245_10909164 3300009098 Bacteria 922
219 Ga0105247_10069502 3300009101 Bacteria 2198
220 Ga0105247_10482150 3300009101 Bacteria 900
221 Ga0114129_10364600 3300009147 Bacteria 1911
222 Ga0105241_10001328 3300009174 Bacteria 18791
223 Ga0105241_10068032 3300009174 Bacteria 2758
224 Ga0105241_10388069 3300009174 Bacteria 1222
225 Ga0105241_10660723 3300009174 Bacteria 950
226 Ga0105242_10023095 3300009176 Bacteria 4902
227 Ga0105242_10023679 3300009176 Bacteria 4841
228 Ga0105242_10052640 3300009176 Bacteria 3322
229 Ga0105242_10682578 3300009176 Bacteria 1003
230 Ga0105242_10727321 3300009176 Bacteria 974
231 Ga0105248_10013163 3300009177 Bacteria 9108
232 Ga0105248_10069439 3300009177 Bacteria 3956
233 Ga0105248_11693919 3300009177 Bacteria 717
234 Ga0105237_10005019 3300009545 Bacteria 15062
235 Ga0105237_10016937 3300009545 Bacteria 7561
236 Ga0105237_10072776 3300009545 Bacteria 3431
237 Ga0105237_10224664 3300009545 Bacteria 1878
238 Ga0105237_10312595 3300009545 Bacteria 1574
239 Ga0105238_10003725 3300009551 Bacteria 15163
240 Ga0105238_10017631 3300009551 Bacteria 7258
241 Ga0105238_10017691 3300009551 Bacteria 7246
242 Ga0105238_10092541 3300009551 Bacteria 3011
243 Ga0105238_10133503 3300009551 Bacteria 2460
244 Ga0105238_10137840 3300009551 Bacteria 2418
245 Ga0105238_10413303 3300009551 Bacteria 1343
246 Ga0105249_10108238 3300009553 Bacteria 2624
247 Ga0099796_10015021 3300010159 Bacteria 2252
248 Ga0099796_10085238 3300010159 Bacteria 1165
249 Ga0105239_10026440 3300010375 Bacteria 6387
250 Ga0105239_10080762 3300010375 Bacteria 3578
251 Ga0105239_10086842 3300010375 Bacteria 3448
252 Ga0105239_10188623 3300010375 Bacteria 2308
253 Ga0105239_10362227 3300010375 Bacteria 1638
254 Ga0105239_10403546 3300010375 Bacteria 1547
255 Ga0105246_10089959 3300011119 Bacteria 2210
256 Ga0105246_10128512 3300011119 Bacteria 1889
257 Ga0157373_10464612 3300013100 Bacteria 912
258 Ga0157371_10201524 3300013102 Bacteria 1427
259 Ga0157370_10012275 3300013104 Bacteria 8893
260 Ga0157370_10013293 3300013104 Bacteria 8480
261 Ga0157370_10013691 3300013104 Bacteria 8337
262 Ga0157370_10046482 3300013104 Bacteria 4162
263 Ga0157370_10117246 3300013104 Bacteria 2487
264 Ga0157370_10125083 3300013104 Bacteria 2400
265 Ga0157370_10311025 3300013104 Bacteria 1454
266 Ga0157369_10002996 3300013105 Bacteria 20214
267 Ga0157369_10029890 3300013105 Bacteria 6016
268 Ga0157369_10091725 3300013105 Bacteria 3242
269 Ga0157369_10103632 3300013105 Bacteria 3031
270 Ga0157369_10133580 3300013105 Bacteria 2628
271 Ga0157369_10153010 3300013105 Bacteria 2438
272 Ga0157369_10342122 3300013105 Bacteria 1554
273 Ga0157374_10022573 3300013296 Bacteria 5615
274 Ga0157374_10082195 3300013296 Bacteria 3058
275 Ga0157374_10125212 3300013296 Bacteria 2484
276 Ga0157374_10326770 3300013296 Bacteria 1521
277 Ga0157378_10000088 3300013297 Bacteria 86642
278 Ga0157378_10006683 3300013297 Bacteria 10077
279 Ga0157378_10009861 3300013297 Bacteria 8324
280 Ga0157378_10080162 3300013297 Bacteria 2949
281 Ga0157378_10098513 3300013297 Bacteria 2666
282 Ga0157378_10203429 3300013297 Bacteria 1874
283 Ga0157378_10388016 3300013297 Bacteria 1373
284 Ga0163162_10014187 3300013306 Bacteria 7788
285 Ga0163162_10053423 3300013306 Bacteria 4061
286 Ga0163162_10090529 3300013306 Bacteria 3141
287 Ga0157372_10005567 3300013307 Bacteria 13390
288 Ga0157372_10012814 3300013307 Bacteria 8936
289 Ga0157372_10084376 3300013307 Bacteria 3600
290 Ga0157372_10121965 3300013307 Bacteria 2995
291 Ga0157372_10131232 3300013307 Bacteria 2883
292 Ga0157372_10139193 3300013307 Bacteria 2795
293 Ga0157372_10271823 3300013307 Bacteria 1970
294 Ga0157372_10617881 3300013307 Bacteria 1263
295 Ga0157375_10014114 3300013308 Bacteria 7125
296 Ga0157375_10020377 3300013308 Bacteria 6057
297 Ga0157375_10099201 3300013308 Bacteria 2991
298 Ga0157375_10182368 3300013308 Bacteria 2251
299 Ga0157375_10811289 3300013308 Bacteria 1084
300 Ga0163163_10008172 3300014325 Bacteria 9281
301 Ga0163163_10115900 3300014325 Bacteria 2710
302 Ga0163163_10258872 3300014325 Bacteria 1791
303 Ga0163163_10484432 3300014325 Bacteria 1298
304 Ga0163163_10702828 3300014325 Bacteria 1075
305 Ga0157376_10012918 3300014969 Bacteria 6214
306 Ga0157376_10207298 3300014969 Bacteria 1808
307 Ga0157376_10304553 3300014969 Bacteria 1510
308 Ga0157376_10315050 3300014969 Bacteria 1486
309 Ga0157376_10592205 3300014969 Bacteria 1103
310 Ga0206356_10494985 3300020070 Bacteria 1480
311 Ga0206355_1707479 3300020076 Bacteria 1048
312 Ga0206351_10177380 3300020077 Bacteria 1034
313 Ga0206352_10065225 3300020078 Bacteria 1048
314 Ga0206350_10140900 3300020080 Bacteria 734
315 Ga0206354_11675773 3300020081 Bacteria 1026
316 Ga0224712_10151762 3300022467 Bacteria 1027
317 Ga0224569_100012 3300022732 Bacteria 11213
318 Ga0228598_1000233 3300024227 Bacteria 10596
319 Ga0207653_10069164 3300025885 Bacteria 1204
320 Ga0207692_10001609 3300025898 Bacteria 8506
321 Ga0207692_10027525 3300025898 Bacteria 2679
322 Ga0207692_10038413 3300025898 Bacteria 2348
323 Ga0207692_10085439 3300025898 Bacteria 1698
324 Ga0207680_10003223 3300025903 Bacteria 7678
325 Ga0207680_10062402 3300025903 Bacteria 2277
326 Ga0207647_10064304 3300025904 Bacteria 2230
327 Ga0207699_10042611 3300025906 Bacteria 2631
328 Ga0207699_10046439 3300025906 Bacteria 2540
329 Ga0207699_10057352 3300025906 Bacteria 2325
330 Ga0207699_10436731 3300025906 Bacteria 937
331 Ga0207645_10421260 3300025907 Bacteria 899
332 Ga0207705_10000012 3300025909 Bacteria 472336
333 Ga0207705_10001515 3300025909 Bacteria 18437
334 Ga0207684_10033606 3300025910 Bacteria 4362
335 Ga0207654_10001890 3300025911 Bacteria 10859
336 Ga0207654_10038682 3300025911 Bacteria 2678
337 Ga0207654_10043662 3300025911 Bacteria 2542
338 Ga0207654_10126485 3300025911 Bacteria 1612
339 Ga0207707_10000636 3300025912 Bacteria 34756
340 Ga0207707_10109562 3300025912 Bacteria 2414
341 Ga0207707_10146114 3300025912 Bacteria 2067
342 Ga0207707_10861349 3300025912 Bacteria 751
343 Ga0207695_10019243 3300025913 Bacteria 7863
344 Ga0207695_10020572 3300025913 Bacteria 7555
345 Ga0207695_10049635 3300025913 Bacteria 4421
346 Ga0207695_10050566 3300025913 Bacteria 4371
347 Ga0207695_10077419 3300025913 Bacteria 3378
348 Ga0207695_10133763 3300025913 Bacteria 2435
349 Ga0207695_10305257 3300025913 Bacteria 1482
350 Ga0207695_10658583 3300025913 Bacteria 928
351 Ga0207671_10025462 3300025914 Bacteria 4444
352 Ga0207671_10283425 3300025914 Bacteria 1307
353 Ga0207671_10330871 3300025914 Bacteria 1206
354 Ga0207693_10000225 3300025915 Bacteria 51527
355 Ga0207693_10003603 3300025915 Bacteria 13225
356 Ga0207693_10076264 3300025915 Bacteria 2625
357 Ga0207693_10162436 3300025915 Bacteria 1757
358 Ga0207693_10531805 3300025915 Bacteria 917
359 Ga0207663_10030297 3300025916 Bacteria 3190
360 Ga0207663_10040946 3300025916 Bacteria 2820
361 Ga0207663_10089377 3300025916 Bacteria 2039
362 Ga0207663_10145065 3300025916 Bacteria 1658
363 Ga0207660_10076882 3300025917 Bacteria 2442
364 Ga0207660_10271521 3300025917 Bacteria 1343
365 Ga0207660_10375367 3300025917 Bacteria 1142
366 Ga0207657_10001710 3300025919 Bacteria 23651
367 Ga0207657_10005028 3300025919 Bacteria 13873
368 Ga0207657_10200137 3300025919 Bacteria 1607
369 Ga0207657_10246352 3300025919 Bacteria 1426
370 Ga0207649_10017002 3300025920 Bacteria 4115
371 Ga0207649_10110544 3300025920 Bacteria 1835
372 Ga0207652_10001333 3300025921 Bacteria 21932
373 Ga0207652_10014025 3300025921 Bacteria 6487
374 Ga0207652_10123370 3300025921 Bacteria 2306
375 Ga0207646_10017080 3300025922 Bacteria 6798
376 Ga0207646_10621113 3300025922 Bacteria 969
377 Ga0207694_10002281 3300025924 Bacteria 15697
378 Ga0207694_10012857 3300025924 Bacteria 6303
379 Ga0207694_10016793 3300025924 Bacteria 5531
380 Ga0207694_10083381 3300025924 Bacteria 2513
381 Ga0207694_10158241 3300025924 Bacteria 1828
382 Ga0207687_10004313 3300025927 Bacteria 9496
383 Ga0207687_10007587 3300025927 Bacteria 7133
384 Ga0207687_10021591 3300025927 Bacteria 4278
385 Ga0207687_10024766 3300025927 Bacteria 4012
386 Ga0207687_10037704 3300025927 Bacteria 3300
387 Ga0207687_10049066 3300025927 Bacteria 2934
388 Ga0207687_10153756 3300025927 Bacteria 1758
389 Ga0207700_10000936 3300025928 Bacteria 16790
390 Ga0207700_10004505 3300025928 Bacteria 8229
391 Ga0207700_10029917 3300025928 Bacteria 3850
392 Ga0207700_10077000 3300025928 Bacteria 2590
393 Ga0207700_10116647 3300025928 Bacteria 2158
394 Ga0207700_10188909 3300025928 Bacteria 1730
395 Ga0207700_10846624 3300025928 Bacteria 818
396 Ga0207664_10003891 3300025929 Bacteria 10033
397 Ga0207664_10244789 3300025929 Bacteria 1563
398 Ga0207664_10483254 3300025929 Bacteria 1108
399 Ga0207664_10951789 3300025929 Bacteria 770
400 Ga0207686_10011210 3300025934 Bacteria 4902
401 Ga0207686_10707350 3300025934 Bacteria 801
402 Ga0207704_10185810 3300025938 Bacteria 1506
403 Ga0207665_10000679 3300025939 Bacteria 22942
404 Ga0207665_10008128 3300025939 Bacteria 6925
405 Ga0207665_10044477 3300025939 Bacteria 2971
406 Ga0207665_10069506 3300025939 Bacteria 2402
407 Ga0207665_10171201 3300025939 Bacteria 1568
408 Ga0207711_10001865 3300025941 Bacteria 19211
409 Ga0207711_10015922 3300025941 Bacteria 6237
410 Ga0207711_10061201 3300025941 Bacteria 3246
411 Ga0207689_10232631 3300025942 Bacteria 1523
412 Ga0207661_10002941 3300025944 Bacteria 11785
413 Ga0207661_10017478 3300025944 Bacteria 5310
414 Ga0207661_10118280 3300025944 Bacteria 2252
415 Ga0207661_10157141 3300025944 Bacteria 1970
416 Ga0207679_10271200 3300025945 Bacteria 1451
417 Ga0207667_10000189 3300025949 Bacteria 90535
418 Ga0207667_10007887 3300025949 Bacteria 12712
419 Ga0207667_10019512 3300025949 Bacteria 7565
420 Ga0207667_10032013 3300025949 Bacteria 5671
421 Ga0207667_10066539 3300025949 Bacteria 3756
422 Ga0207667_10076338 3300025949 Bacteria 3477
423 Ga0207667_10106513 3300025949 Bacteria 2892
424 Ga0207651_10510495 3300025960 Bacteria 1040
425 Ga0207640_10030092 3300025981 Bacteria 3341
426 Ga0207640_10210760 3300025981 Bacteria 1480
427 Ga0207658_10026219 3300025986 Bacteria 4085
428 Ga0207677_10019901 3300026023 Bacteria 4063
429 Ga0207677_10093116 3300026023 Bacteria 2196
430 Ga0207677_10352323 3300026023 Bacteria 1234
431 Ga0207703_10007661 3300026035 Bacteria 8555
432 Ga0207703_10151660 3300026035 Bacteria 2022
433 Ga0207703_10258936 3300026035 Bacteria 1572
434 Ga0207639_10077756 3300026041 Bacteria 2617
435 Ga0207639_10144375 3300026041 Bacteria 1986
436 Ga0207639_10144890 3300026041 Bacteria 1983
437 Ga0207678_10001524 3300026067 Bacteria 21244
438 Ga0207678_10008334 3300026067 Bacteria 9137
439 Ga0207678_10387159 3300026067 Bacteria 1209
440 Ga0207702_10003685 3300026078 Bacteria 13864
441 Ga0207702_10129440 3300026078 Bacteria 2270
442 Ga0207702_10272568 3300026078 Bacteria 1597
443 Ga0207702_10330978 3300026078 Bacteria 1453
444 Ga0207702_10482600 3300026078 Bacteria 1206
445 Ga0207702_10602928 3300026078 Bacteria 1078
446 Ga0207641_10115754 3300026088 Bacteria 2384
447 Ga0207641_10384297 3300026088 Bacteria 1345
448 Ga0207648_10015732 3300026089 Bacteria 6940
449 Ga0207676_10105757 3300026095 Bacteria 2344
450 Ga0207676_10134255 3300026095 Bacteria 2109
451 Ga0207674_10001357 3300026116 Bacteria 31674
452 Ga0207698_10040605 3300026142 Bacteria 3460
453 Ga0207698_10103916 3300026142 Bacteria 2362
454 Ga0207698_10192154 3300026142 Bacteria 1820
455 Ga0265355_1007168 3300028036 Bacteria 879
456 Ga0268266_10005917 3300028379 Bacteria 11312
457 Ga0268266_10091906 3300028379 Bacteria 2662
458 Ga0268266_10774618 3300028379 Bacteria 926
459 Ga0268264_10035259 3300028381 Bacteria 4118
460 Ga0268264_10056228 3300028381 Bacteria 3289
461 Ga0265760_10004471 3300031090 Bacteria 4014
462 Ga0265325_10017069 3300031241 Bacteria 4040
463 Ga0265313_10021772 3300031595 Bacteria 3497
464 Ga0265314_10005761 3300031711 Bacteria 11116
465 Ga0265314_10023467 3300031711 Bacteria 4702
466 Ga0316212_1001738 3300033547 Bacteria 3012
467 Ga0373926_0000776 3300035083 Bacteria 8963
468 Ga0373926_0005010 3300035083 Bacteria 4353
469 Ga0373926_0131107 3300035083 Bacteria 949
470 Ga0373934_0015757 3300035086 Bacteria 2870
471 Ga0373934_0024188 3300035086 Bacteria 2349
472 Ga0373934_0170632 3300035086 Bacteria 893
473 Ga0373940_0020065 3300035088 Bacteria 1695
474 Ga0373944_0006363 3300035089 Bacteria 3134
475 Ga0373923_0023347 3300035111 Bacteria 2432
476 Ga0373923_0339330 3300035111 Bacteria 716
477 Ga0373936_0010658 3300035113 Bacteria 3470
478 Ga0373936_0189200 3300035113 Unclassified 905
479 Ga0373953_0067309 3300035117 Bacteria 1473
480 Ga0373953_0212383 3300035117 Bacteria 838
481 Ga0373954_0123135 3300035118 Bacteria 1260
482 Ga0373956_0072199 3300035119 Bacteria 1576
483 Ga0373957_0156545 3300035120 Bacteria 937
484 Ga0373943_0003190 3300035170 Bacteria 7446
485 Ga0373943_0003689 3300035170 Bacteria 6964
486 Ga0373943_0083591 3300035170 Bacteria 1641
487 Ga0373946_0005536 3300035171 Bacteria 4557
488 Ga0373955_0072653 3300035172 Bacteria 1927
489 Ga0373955_0089753 3300035172 Bacteria 1750
490 Ga0373924_0014930 3300035410 Bacteria 2941
491 Ga0373935_0020707 3300035692 Bacteria 4020
492 Ga0373935_0023891 3300035692 Bacteria 3756
493 Ga0373935_0088626 3300035692 Bacteria 2022
494 Ga0373927_0000183 3300035695 Bacteria 49509
495 Ga0373927_0000272 3300035695 Bacteria 40698
496 Ga0373927_0017906 3300035695 Bacteria 4659
497 Ga0373927_0061134 3300035695 Bacteria 2437
498 Ga0373927_0173551 3300035695 Bacteria 1414
499 Ga0373927_0223404 3300035695 Bacteria 1237
500 Ga0373933_0068706 3300035724 Bacteria 2152
501 Ga0373947_0001203 3300035725 Bacteria 15915
502 Ga0373947_0043596 3300035725 Bacteria 2680
503 Ga0373947_0055658 3300035725 Bacteria 2389
504 Ga0373947_0076794 3300035725 Bacteria 2059
505 Ga0373947_0130474 3300035725 Bacteria 1604
506 Ga0373947_0371571 3300035725 Bacteria 962
507 Ga0373937_0010532 3300036401 Bacteria 8074
508 Ga0373937_0063583 3300036401 Bacteria 3395
509 Ga0373937_0088123 3300036401 Bacteria 2873
510 Ga0373937_0162891 3300036401 Bacteria 2091
511 Ga0373937_0198188 3300036401 Bacteria 1887
512 Ga0373925_0000359 3300037068 Bacteria 47371
513 Ga0373925_0000968 3300037068 Bacteria 26095
514 Ga0373925_0002537 3300037068 Bacteria 14547
515 Ga0373925_0003537 3300037068 Bacteria 12050
516 Ga0373925_0022114 3300037068 Bacteria 4635
517 Ga0373925_0225832 3300037068 Bacteria 1496
518 Ga0439448_0126822 3300042005 Bacteria 878
519 Ga0466959_0185928 3300045049 Bacteria 1451
520 Ga0466967_0085833 3300045976 Bacteria 2851
521 Ga0495592_0224236 3300046454 Bacteria 1255
522 Ga0495592_0237535 3300046454 Bacteria 1211
523 Ga0495651_0000360 3300046462 Bacteria 35051
524 Ga0495651_0056052 3300046462 Bacteria 3027
525 Ga0495651_0138376 3300046462 Bacteria 1769
526 Ga0495653_0053356 3300046463 Bacteria 3094
527 Ga0495653_0102234 3300046463 Bacteria 2074
528 Ga0495653_0303430 3300046463 Bacteria 1041
529 Ga0495580_0014448 3300046472 Bacteria 5988
530 Ga0495580_0018800 3300046472 Bacteria 5142
531 Ga0495580_0019561 3300046472 Bacteria 5031
532 Ga0495580_0050734 3300046472 Bacteria 2933
533 Ga0495580_0070341 3300046472 Bacteria 2444
534 Ga0495580_0078475 3300046472 Bacteria 2303
535 Ga0495580_0102186 3300046472 Bacteria 1993
536 Ga0495580_0102503 3300046472 Bacteria 1990
537 Ga0495580_0364667 3300046472 Bacteria 977
538 Ga0495582_0001167 3300046473 Bacteria 14787
539 Ga0495582_0135491 3300046473 Bacteria 1393
540 Ga0495664_0004934 3300046477 Bacteria 7302
541 Ga0495664_0016372 3300046477 Bacteria 4222
542 Ga0495664_0309099 3300046477 Bacteria 954
543 Ga0495594_0269566 3300046499 Bacteria 970
544 Ga0495608_0016069 3300046511 Bacteria 5179
545 Ga0495608_0136869 3300046511 Bacteria 1565
546 Ga0495628_0260001 3300046516 Bacteria 1294
547 Ga0495630_0048942 3300046517 Bacteria 3164
548 Ga0495630_0067930 3300046517 Bacteria 2679
549 Ga0495630_0313291 3300046517 Bacteria 1199
550 Ga0495652_0021202 3300046529 Bacteria 5776
551 Ga0495652_0231864 3300046529 Bacteria 1380
552 Ga0495665_0022529 3300046531 Bacteria 3386
553 Ga0495665_0038206 3300046531 Bacteria 2560
554 Ga0495640_0409481 3300046533 Bacteria 832
555 Ga0495586_0019338 3300046535 Bacteria 3624
556 Ga0495586_0049756 3300046535 Bacteria 2266
557 Ga0495587_0082076 3300046536 Bacteria 1868
558 Ga0495645_0025481 3300046543 Bacteria 4293
559 Ga0495645_0208042 3300046543 Bacteria 1323
560 Ga0495667_0005929 3300046559 Bacteria 8271
561 Ga0495667_0026085 3300046559 Bacteria 3936
562 Ga0495667_0101996 3300046559 Bacteria 1856
563 Ga0495667_0113635 3300046559 Bacteria 1750
564 Ga0495667_0379279 3300046559 Bacteria 892
565 Ga0495634_0120443 3300046642 Bacteria 1681
566 Ga0495635_0184541 3300046663 Bacteria 1417
567 Ga0495659_0190018 3300046664 Bacteria 839
568 Ga0495657_0031436 3300046675 Bacteria 3711
569 Ga0495623_0072457 3300046679 Bacteria 2142
570 Ga0495658_0064515 3300046683 Bacteria 2110
571 Ga0495658_0139188 3300046683 Bacteria 1483
572 Ga0495613_0022803 3300046689 Bacteria 4665
573 Ga0495613_0156396 3300046689 Bacteria 1624
574 Ga0495613_0236571 3300046689 Bacteria 1278
575 Ga0495624_0016669 3300046690 Bacteria 4945
576 Ga0495624_0153918 3300046690 Bacteria 1406
577 Ga0495600_0085024 3300046809 Bacteria 2064
578 Ga0495600_0328548 3300046809 Bacteria 961
579 Ga0495581_0036568 3300047315 Bacteria 2841
580 Ga0495604_0005042 3300047317 Bacteria 10450
581 Ga0495674_0233494 3300047319 Bacteria 1517
582 Ga0495674_0585603 3300047319 Bacteria 885
583 Ga0495676_0230974 3300047321 Bacteria 1271
584 Ga0495680_0000230 3300047322 Bacteria 61249
585 Ga0495680_0066957 3300047322 Bacteria 2747
586 Ga0495675_0002717 3300047444 Bacteria 10603
587 Ga0495675_0008008 3300047444 Bacteria 6536
588 Ga0495684_0007594 3300047471 Bacteria 8390
589 Ga0495684_0015266 3300047471 Bacteria 5916
590 Ga0495684_0030699 3300047471 Bacteria 4126
591 Ga0495684_0055988 3300047471 Bacteria 3007
592 Ga0495684_0113137 3300047471 Bacteria 2046
593 Ga0495684_0234904 3300047471 Bacteria 1340
594 Ga0495684_0568026 3300047471 Bacteria 770
595 Ga0495593_0012711 3300047673 Bacteria 4806
596 Ga0495602_0175155 3300048088 Bacteria 1660
597 Ga0495602_0254694 3300048088 Bacteria 1306
598 Ga0495602_0417831 3300048088 Bacteria 953
599 Ga0496102_0173433 3300048905 Bacteria 2030
600 Ga0496102_0722416 3300048905 Bacteria 919
601 Ga0496104_0133815 3300048907 Bacteria 2382
602 Ga0496106_0084176 3300048909 Bacteria 2447
603 Ga0496108_0248280 3300048911 Bacteria 1548
604 Ga0496112_0111259 3300048915 Bacteria 2709
605 Ga0496112_0111687 3300048915 Bacteria 2703
606 Ga0496115_0063171 3300048918 Bacteria 2987
607 Ga0496115_0307282 3300048918 Bacteria 1299
608 Ga0501047_0018578 3300049581 Bacteria 6665
609 Ga0501047_0049004 3300049581 Bacteria 4079
610 Ga0501047_0152602 3300049581 Bacteria 2185
611 Ga0501070_0027208 3300049586 Bacteria 4797
612 Ga0501070_0105392 3300049586 Bacteria 2331
613 Ga0501044_0001227 3300049823 Bacteria 30468
614 Ga0501044_0001368 3300049823 Bacteria 28602
615 nmdc:mga05p37_877250_c1 3300050507 Bacteria 971
616 nmdc:mga09592_30943_c1 3300050508 Bacteria 4457
617 nmdc:mga0qj67_789898_c1 3300050509 Bacteria 752
618 nmdc:mga06r32_245199_c1 3300050510 Bacteria 1779
619 nmdc:mga0n895_167442_c1 3300050512 Bacteria 2229
620 nmdc:mga0n895_419869_c1 3300050512 Bacteria 1352
621 nmdc:mga0n895_53575_c1 3300050512 Bacteria 3964
622 nmdc:mga0rr50_26684_c1 3300050513 Bacteria 4034
623 nmdc:mga0rr50_5863_c1 3300050513 Bacteria 7388
624 nmdc:mga08x19_2067_c1 3300050514 Bacteria 12294
625 nmdc:mga08x19_234744_c1 3300050514 Bacteria 1263
626 nmdc:mga08x19_618_c1 3300050514 Bacteria 22930
627 Ga0495612_0013687 3300053078 Bacteria 3267
628 Ga0495612_0080221 3300053078 Bacteria 1371
629 Ga0495619_0143755 3300053085 Bacteria 1644
630 Ga0587114_011265 3300059655 Bacteria 1111
631 Ga0466967_0098223
632 Ga0058863_10022191
633 Ga0058861_11523593
634 Ga0058861_11941984
635 Ga0058862_12068421
636 Ga0058862_12713580
637 Ga0065707_10470053
638 Ga0070658_10024162
639 Ga0070658_10402407
640 Ga0070683_100018053
641 Ga0070683_100023254
642 Ga0070683_100082180
643 Ga0070683_100180819
644 Ga0070683_100211426
645 Ga0070683_100341865
646 Ga0070690_100268775
647 Ga0068869_100851338
648 Ga0070666_10054786
649 Ga0070666_10092237
650 Ga0070680_100000783
651 Ga0070680_100029498
652 Ga0070680_100135047
653 Ga0070680_100420918
654 Ga0068868_100014999
655 Ga0068868_100610950
656 Ga0070660_100005911
657 Ga0070660_100085386
658 Ga0070660_100213260
659 Ga0070691_10002999
660 Ga0070691_10127410
661 Ga0070661_100006661
662 Ga0070661_100192508
663 Ga0070668_100128329
664 Ga0070673_100945677
665 Ga0070688_100307948
666 Ga0070659_100012657
667 Ga0070667_100034390
668 Ga0070703_10009010
669 Ga0070709_10005332
670 Ga0070709_10023437
671 Ga0070709_10064132
672 Ga0070709_10437819
673 Ga0070714_100000123
674 Ga0070714_100363563
675 Ga0070714_100550811
676 Ga0070714_100554250
677 Ga0070714_100636919
678 Ga0070713_100000525
679 Ga0070713_100004714
680 Ga0070713_100005082
681 Ga0070713_100009046
682 Ga0070713_100009335
683 Ga0070713_100016633
684 Ga0070713_100046983
685 Ga0070713_100054724
686 Ga0070713_100085534
687 Ga0070713_100151586
688 Ga0070713_100411440
689 Ga0070710_10001574
690 Ga0070710_10006435
691 Ga0070710_10048297
692 Ga0070710_10091982
693 Ga0070710_10136974
694 Ga0070710_10141322
695 Ga0070710_10164583
696 Ga0070711_100001301
697 Ga0070711_100039108
698 Ga0070711_100115856
699 Ga0070711_100263287
700 Ga0070705_100000929
701 Ga0070694_100001219
702 Ga0070708_100001593
703 Ga0070708_100049551
704 Ga0070663_100080015
705 Ga0070663_100085042
706 Ga0070663_100642658
707 Ga0070681_10000423
708 Ga0070681_10044927
709 Ga0070681_10111327
710 Ga0070681_10127977
711 Ga0070681_10265859
712 Ga0068867_100262137
713 Ga0070706_100009306
714 Ga0070706_100065588
715 Ga0070706_100077545
716 Ga0070707_100002202
717 Ga0070698_100018870
718 Ga0070698_100034372
719 Ga0070699_100017250
720 Ga0070699_100203773
721 Ga0070699_100324572
722 Ga0070699_100330054
723 Ga0070679_100003399
724 Ga0070679_100136740
725 Ga0070679_100300618
726 Ga0070684_100001413
727 Ga0070684_100017208
728 Ga0070684_100042835
729 Ga0070684_100292091
730 Ga0070684_100384314
731 Ga0070684_100415343
732 Ga0070684_100751045
733 Ga0070684_101011717
734 Ga0070697_100000661
735 Ga0070697_100000964
736 Ga0070697_100087508
737 Ga0070697_100424809
738 Ga0068853_100072614
739 Ga0068853_100184337
740 Ga0068853_100277670
741 Ga0070695_100000974
742 Ga0070695_100254401
743 Ga0070696_100003593
744 Ga0070696_100174344
745 Ga0070696_100543485
746 Ga0070693_100000001
747 Ga0070665_100014733
748 Ga0070665_100113312
749 Ga0070665_100338568
750 Ga0070665_100348250
751 Ga0070704_100026154
752 Ga0068855_100002803
753 Ga0068855_100007175
754 Ga0068855_100065274
755 Ga0068855_100099372
756 Ga0068855_100150073
757 Ga0068855_100152403
758 Ga0068855_100165500
759 Ga0070664_100149970
760 Ga0068857_100005447
761 Ga0068857_100007263
762 Ga0068854_100032676
763 Ga0068854_100243179
764 Ga0068854_100257817
765 Ga0068856_100004213
766 Ga0068856_100093738
767 Ga0068856_100102672
768 Ga0068852_100097185
769 Ga0068852_100380822
770 Ga0068859_100040888
771 Ga0068859_100297875
772 Ga0068864_100132415
773 Ga0068866_10019342
774 Ga0068866_10165633
775 Ga0068863_100148373
776 Ga0068863_100460577
777 Ga0068858_100141656
778 Ga0068858_100153275
779 Ga0068860_100005546
780 Ga0068860_100005816
781 Ga0081540_1088807
782 Ga0070717_10000567
783 Ga0070717_10005528
784 Ga0070717_10005564
785 Ga0070717_10140220
786 Ga0070717_10156113
787 Ga0070717_10499711
788 Ga0070716_100005895
789 Ga0070716_100030020
790 Ga0070716_100039391
791 Ga0070716_100040643
792 Ga0070716_100253269
793 Ga0070712_100000116
794 Ga0070712_100009620
795 Ga0070712_100224208
796 Ga0070712_100279099
797 Ga0070712_100551753
798 Ga0097621_100008175
799 Ga0097621_100050868
800 Ga0097621_100051890
801 Ga0097621_100154707
802 Ga0097621_100240787
803 Ga0097621_100563701
804 Ga0068871_100006928
805 Ga0068871_100016935
806 Ga0068871_100017818
807 Ga0068871_100063002
808 Ga0068871_100075660
809 Ga0068871_100137205
810 Ga0068871_100324237
811 Ga0068871_100445274
812 Ga0068871_100499936
813 Ga0075430_100035179
814 Ga0075431_100016669
815 Ga0075431_100252863
816 Ga0075434_100055597
817 Ga0075434_100430128
818 Ga0075434_100639842
819 Ga0075429_100007717
820 Ga0068865_100018274
821 Ga0075436_100000204
822 Ga0075436_100005553
823 Ga0097620_100040888
824 Ga0097620_100297855
825 Ga0075435_100015310
826 Ga0075435_100048210
827 Ga0075435_100549291
828 Ga0099794_10126546
829 Ga0099795_10000972
830 Ga0105240_10000682
831 Ga0105240_10037341
832 Ga0105240_10037451
833 Ga0105240_10040537
834 Ga0105240_10074606
835 Ga0105240_10285641
836 Ga0105240_10332472
837 Ga0105240_10335844
838 Ga0105240_10403599
839 Ga0105240_10437035
840 Ga0105240_10629697
841 Ga0105240_10684312
842 Ga0105245_10001767
843 Ga0105245_10005601
844 Ga0105245_10023489
845 Ga0105245_10023809
846 Ga0105245_10075744
847 Ga0105245_10099570
848 Ga0105245_10909164
849 Ga0105247_10069502
850 Ga0105247_10482150
851 Ga0114129_10364600
852 Ga0105241_10001328
853 Ga0105241_10068032
854 Ga0105241_10388069
855 Ga0105241_10660723
856 Ga0105242_10023095
857 Ga0105242_10023679
858 Ga0105242_10052640
859 Ga0105242_10682578
860 Ga0105242_10727321
861 Ga0105248_10013163
862 Ga0105248_10069439
863 Ga0105248_11693919
864 Ga0105237_10005019
865 Ga0105237_10016937
866 Ga0105237_10072776
867 Ga0105237_10224664
868 Ga0105237_10312595
869 Ga0105238_10003725
870 Ga0105238_10017631
871 Ga0105238_10017691
872 Ga0105238_10092541
873 Ga0105238_10133503
874 Ga0105238_10137840
875 Ga0105238_10413303
876 Ga0105249_10108238
877 Ga0099796_10015021
878 Ga0099796_10085238
879 Ga0105239_10026440
880 Ga0105239_10080762
881 Ga0105239_10086842
882 Ga0105239_10188623
883 Ga0105239_10362227
884 Ga0105239_10403546
885 Ga0105246_10089959
886 Ga0105246_10128512
887 Ga0157373_10464612
888 Ga0157371_10201524
889 Ga0157370_10012275
890 Ga0157370_10013293
891 Ga0157370_10013691
892 Ga0157370_10046482
893 Ga0157370_10117246
894 Ga0157370_10125083
895 Ga0157370_10311025
896 Ga0157369_10002996
897 Ga0157369_10029890
898 Ga0157369_10091725
899 Ga0157369_10103632
900 Ga0157369_10133580
901 Ga0157369_10153010
902 Ga0157369_10342122
903 Ga0157374_10022573
904 Ga0157374_10082195
905 Ga0157374_10125212
906 Ga0157374_10326770
907 Ga0157378_10000088
908 Ga0157378_10006683
909 Ga0157378_10009861
910 Ga0157378_10080162
911 Ga0157378_10098513
912 Ga0157378_10203429
913 Ga0157378_10388016
914 Ga0163162_10014187
915 Ga0163162_10053423
916 Ga0163162_10090529
917 Ga0157372_10005567
918 Ga0157372_10012814
919 Ga0157372_10084376
920 Ga0157372_10121965
921 Ga0157372_10131232
922 Ga0157372_10139193
923 Ga0157372_10271823
924 Ga0157372_10617881
925 Ga0157375_10014114
926 Ga0157375_10020377
927 Ga0157375_10099201
928 Ga0157375_10182368
929 Ga0157375_10811289
930 Ga0163163_10008172
931 Ga0163163_10115900
932 Ga0163163_10258872
933 Ga0163163_10484432
934 Ga0163163_10702828
935 Ga0157376_10012918
936 Ga0157376_10207298
937 Ga0157376_10304553
938 Ga0157376_10315050
939 Ga0157376_10592205
940 Ga0206356_10494985
941 Ga0206355_1707479
942 Ga0206351_10177380
943 Ga0206352_10065225
944 Ga0206350_10140900
945 Ga0206354_11675773
946 Ga0224712_10151762
947 Ga0224569_100012
948 Ga0228598_1000233
949 Ga0207653_10069164
950 Ga0207692_10001609
951 Ga0207692_10027525
952 Ga0207692_10038413
953 Ga0207692_10085439
954 Ga0207680_10003223
955 Ga0207680_10062402
956 Ga0207647_10064304
957 Ga0207699_10042611
958 Ga0207699_10046439
959 Ga0207699_10057352
960 Ga0207699_10436731
961 Ga0207645_10421260
962 Ga0207705_10000012
963 Ga0207705_10001515
964 Ga0207684_10033606
965 Ga0207654_10001890
966 Ga0207654_10038682
967 Ga0207654_10043662
968 Ga0207654_10126485
969 Ga0207707_10000636
970 Ga0207707_10109562
971 Ga0207707_10146114
972 Ga0207707_10861349
973 Ga0207695_10019243
974 Ga0207695_10020572
975 Ga0207695_10049635
976 Ga0207695_10050566
977 Ga0207695_10077419
978 Ga0207695_10133763
979 Ga0207695_10305257
980 Ga0207695_10658583
981 Ga0207671_10025462
982 Ga0207671_10283425
983 Ga0207671_10330871
984 Ga0207693_10000225
985 Ga0207693_10003603
986 Ga0207693_10076264
987 Ga0207693_10162436
988 Ga0207693_10531805
989 Ga0207663_10030297
990 Ga0207663_10040946
991 Ga0207663_10089377
992 Ga0207663_10145065
993 Ga0207660_10076882
994 Ga0207660_10271521
995 Ga0207660_10375367
996 Ga0207657_10001710
997 Ga0207657_10005028
998 Ga0207657_10200137
999 Ga0207657_10246352
1000 Ga0207649_10017002
1001 Ga0207649_10110544
1002 Ga0207652_10001333
1003 Ga0207652_10014025
1004 Ga0207652_10123370
1005 Ga0207646_10017080
1006 Ga0207646_10621113
1007 Ga0207694_10002281
1008 Ga0207694_10012857
1009 Ga0207694_10016793
1010 Ga0207694_10083381
1011 Ga0207694_10158241
1012 Ga0207687_10004313
1013 Ga0207687_10007587
1014 Ga0207687_10021591
1015 Ga0207687_10024766
1016 Ga0207687_10037704
1017 Ga0207687_10049066
1018 Ga0207687_10153756
1019 Ga0207700_10000936
1020 Ga0207700_10004505
1021 Ga0207700_10029917
1022 Ga0207700_10077000
1023 Ga0207700_10116647
1024 Ga0207700_10188909
1025 Ga0207700_10846624
1026 Ga0207664_10003891
1027 Ga0207664_10244789
1028 Ga0207664_10483254
1029 Ga0207664_10951789
1030 Ga0207686_10011210
1031 Ga0207686_10707350
1032 Ga0207704_10185810
1033 Ga0207665_10000679
1034 Ga0207665_10008128
1035 Ga0207665_10044477
1036 Ga0207665_10069506
1037 Ga0207665_10171201
1038 Ga0207711_10001865
1039 Ga0207711_10015922
1040 Ga0207711_10061201
1041 Ga0207689_10232631
1042 Ga0207661_10002941
1043 Ga0207661_10017478
1044 Ga0207661_10118280
1045 Ga0207661_10157141
1046 Ga0207679_10271200
1047 Ga0207667_10000189
1048 Ga0207667_10007887
1049 Ga0207667_10019512
1050 Ga0207667_10032013
1051 Ga0207667_10066539
1052 Ga0207667_10076338
1053 Ga0207667_10106513
1054 Ga0207651_10510495
1055 Ga0207640_10030092
1056 Ga0207640_10210760
1057 Ga0207658_10026219
1058 Ga0207677_10019901
1059 Ga0207677_10093116
1060 Ga0207677_10352323
1061 Ga0207703_10007661
1062 Ga0207703_10151660
1063 Ga0207703_10258936
1064 Ga0207639_10077756
1065 Ga0207639_10144375
1066 Ga0207639_10144890
1067 Ga0207678_10001524
1068 Ga0207678_10008334
1069 Ga0207678_10387159
1070 Ga0207702_10003685
1071 Ga0207702_10129440
1072 Ga0207702_10272568
1073 Ga0207702_10330978
1074 Ga0207702_10482600
1075 Ga0207702_10602928
1076 Ga0207641_10115754
1077 Ga0207641_10384297
1078 Ga0207648_10015732
1079 Ga0207676_10105757
1080 Ga0207676_10134255
1081 Ga0207674_10001357
1082 Ga0207698_10040605
1083 Ga0207698_10103916
1084 Ga0207698_10192154
1085 Ga0265355_1007168
1086 Ga0268266_10005917
1087 Ga0268266_10091906
1088 Ga0268266_10774618
1089 Ga0268264_10035259
1090 Ga0268264_10056228
1091 Ga0265760_10004471
1092 Ga0265325_10017069
1093 Ga0265313_10021772
1094 Ga0265314_10005761
1095 Ga0265314_10023467
1096 Ga0316212_1001738
1097 Ga0373926_0000776
1098 Ga0373926_0005010
1099 Ga0373926_0131107
1100 Ga0373934_0015757
1101 Ga0373934_0024188
1102 Ga0373934_0170632
1103 Ga0373940_0020065
1104 Ga0373944_0006363
1105 Ga0373923_0023347
1106 Ga0373923_0339330
1107 Ga0373936_0010658
1108 Ga0373936_0189200
1109 Ga0373953_0067309
1110 Ga0373953_0212383
1111 Ga0373954_0123135
1112 Ga0373956_0072199
1113 Ga0373957_0156545
1114 Ga0373943_0003190
1115 Ga0373943_0003689
1116 Ga0373943_0083591
1117 Ga0373946_0005536
1118 Ga0373955_0072653
1119 Ga0373955_0089753
1120 Ga0373924_0014930
1121 Ga0373935_0020707
1122 Ga0373935_0023891
1123 Ga0373935_0088626
1124 Ga0373927_0000183
1125 Ga0373927_0000272
1126 Ga0373927_0017906
1127 Ga0373927_0061134
1128 Ga0373927_0173551
1129 Ga0373927_0223404
1130 Ga0373933_0068706
1131 Ga0373947_0001203
1132 Ga0373947_0043596
1133 Ga0373947_0055658
1134 Ga0373947_0076794
1135 Ga0373947_0130474
1136 Ga0373947_0371571
1137 Ga0373937_0010532
1138 Ga0373937_0063583
1139 Ga0373937_0088123
1140 Ga0373937_0162891
1141 Ga0373937_0198188
1142 Ga0373925_0000359
1143 Ga0373925_0000968
1144 Ga0373925_0002537
1145 Ga0373925_0003537
1146 Ga0373925_0022114
1147 Ga0373925_0225832
1148 Ga0439448_0126822
1149 Ga0466959_0185928
1150 Ga0466967_0085833
1151 Ga0495592_0224236
1152 Ga0495592_0237535
1153 Ga0495651_0000360
1154 Ga0495651_0056052
1155 Ga0495651_0138376
1156 Ga0495653_0053356
1157 Ga0495653_0102234
1158 Ga0495653_0303430
1159 Ga0495580_0014448
1160 Ga0495580_0018800
1161 Ga0495580_0019561
1162 Ga0495580_0050734
1163 Ga0495580_0070341
1164 Ga0495580_0078475
1165 Ga0495580_0102186
1166 Ga0495580_0102503
1167 Ga0495580_0364667
1168 Ga0495582_0001167
1169 Ga0495582_0135491
1170 Ga0495664_0004934
1171 Ga0495664_0016372
1172 Ga0495664_0309099
1173 Ga0495594_0269566
1174 Ga0495608_0016069
1175 Ga0495608_0136869
1176 Ga0495628_0260001
1177 Ga0495630_0048942
1178 Ga0495630_0067930
1179 Ga0495630_0313291
1180 Ga0495652_0021202
1181 Ga0495652_0231864
1182 Ga0495665_0022529
1183 Ga0495665_0038206
1184 Ga0495640_0409481
1185 Ga0495586_0019338
1186 Ga0495586_0049756
1187 Ga0495587_0082076
1188 Ga0495645_0025481
1189 Ga0495645_0208042
1190 Ga0495667_0005929
1191 Ga0495667_0026085
1192 Ga0495667_0101996
1193 Ga0495667_0113635
1194 Ga0495667_0379279
1195 Ga0495634_0120443
1196 Ga0495635_0184541
1197 Ga0495659_0190018
1198 Ga0495657_0031436
1199 Ga0495623_0072457
1200 Ga0495658_0064515
1201 Ga0495658_0139188
1202 Ga0495613_0022803
1203 Ga0495613_0156396
1204 Ga0495613_0236571
1205 Ga0495624_0016669
1206 Ga0495624_0153918
1207 Ga0495600_0085024
1208 Ga0495600_0328548
1209 Ga0495581_0036568
1210 Ga0495604_0005042
1211 Ga0495674_0233494
1212 Ga0495674_0585603
1213 Ga0495676_0230974
1214 Ga0495680_0000230
1215 Ga0495680_0066957
1216 Ga0495675_0002717
1217 Ga0495675_0008008
1218 Ga0495684_0007594
1219 Ga0495684_0015266
1220 Ga0495684_0030699
1221 Ga0495684_0055988
1222 Ga0495684_0113137
1223 Ga0495684_0234904
1224 Ga0495684_0568026
1225 Ga0495593_0012711
1226 Ga0495602_0175155
1227 Ga0495602_0254694
1228 Ga0495602_0417831
1229 Ga0496102_0173433
1230 Ga0496102_0722416
1231 Ga0496104_0133815
1232 Ga0496106_0084176
1233 Ga0496108_0248280
1234 Ga0496112_0111259
1235 Ga0496112_0111687
1236 Ga0496115_0063171
1237 Ga0496115_0307282
1238 Ga0501047_0018578
1239 Ga0501047_0049004
1240 Ga0501047_0152602
1241 Ga0501070_0027208
1242 Ga0501070_0105392
1243 Ga0501044_0001227
1244 Ga0501044_0001368
1245 nmdc:mga05p37_877250_c1
1246 nmdc:mga09592_30943_c1
1247 nmdc:mga0qj67_789898_c1
1248 nmdc:mga06r32_245199_c1
1249 nmdc:mga0n895_167442_c1
1250 nmdc:mga0n895_419869_c1
1251 nmdc:mga0n895_53575_c1
1252 nmdc:mga0rr50_26684_c1
1253 nmdc:mga0rr50_5863_c1
1254 nmdc:mga08x19_2067_c1
1255 nmdc:mga08x19_234744_c1
1256 nmdc:mga08x19_618_c1
1257 Ga0495612_0013687
1258 Ga0495612_0080221
1259 Ga0495619_0143755
1260 Ga0587114_011265

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

57

197

0.96

PF10417

1-cysPrx_C

C-terminal domain of 1-Cys peroxiredoxin

217

256

0.96

PF08534

Redoxin

Redoxin

56

215

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kuu-assembly1.cif.gz_B lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form 0.9604 3 219
6p0w-assembly1.cif.gz_A-2 lsfa from p. aeruginosa, a 1-cys prx in reduced form 0.9594 3 219
7kuu-assembly1.cif.gz_B lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form 0.9558 3 219
6p0w-assembly1.cif.gz_A-2 lsfa from p. aeruginosa, a 1-cys prx in reduced form 0.9502 3 219
5ykj-assembly1.cif.gz_A structural basis of the thiol resolving mechanism in yeast mitochondrial 1-cys peroxiredoxin via glutathione/thioredoxin systems 0.9462 3 216
ID Description Score Start End Superfamily
af_A0A0R0K508_6_109_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9585 5 106 3.40.30.10
af_P34227_199_260_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9394 155 216 3.30.1020.10
af_Q54SE2_176_239_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9388 155 218 3.30.1020.10
af_A0A0R0K508_6_109_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.932 5 106 3.40.30.10
af_Q54SE2_176_239_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9251 155 218 3.30.1020.10
ID Description Score Start End GO Terms
AF-A0A7C7WM65-F1-model_v4 Redoxin domain-containing protein 0.9937 1 169 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-C3KLK5-F1-model_v4 Peroxiredoxin 6 (EC 1.11.1.-) 0.9891 1 219 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A3D3B379-F1-model_v4 Peroxidase 0.9852 140 219 GO:0051920
AF-A0A534YD48-F1-model_v4 Peroxiredoxin 0.985 1 184 GO:0005829
GO:0045454
GO:0051920
AF-A0A3D2S068-F1-model_v4 Peroxidase 0.983 1 106 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454

Map