F470788

General Info

Members Datasets Scaffolds Average Seq Length
629 450 1256 103

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2842509118|2842511752
Length 118
Sequence WQAFADHVRLSIRLTPNGGRDAIDGFETGADGEAYLKARVSAVPEKGKANKALIALIAKSFGTSKSSVSLISGETARKKILRIDGDPEDLIRPDHFAFLARSIASRMSSPASFEPFQP

Samples

Sample ID Description Type Environment
1 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
2 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
9 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
10 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
18 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
47 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
48 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
49 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
66 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
67 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
68 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
69 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
70 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
71 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
73 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
74 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
76 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
81 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
84 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
104 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
106 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
109 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
110 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
111 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
112 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
113 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
114 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
115 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
116 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
122 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
123 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
124 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
125 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
126 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
127 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
128 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
129 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
130 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
131 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
132 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
133 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
134 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
135 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
136 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
137 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
138 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
139 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
140 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
141 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
142 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
143 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
144 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
145 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
146 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
147 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
148 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
149 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
150 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
151 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
152 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
153 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
154 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
155 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
156 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
157 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
158 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
159 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
160 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
161 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
162 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
163 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
164 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
165 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
166 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
167 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
168 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
169 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
170 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
171 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
172 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
181 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
182 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
183 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
184 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
185 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
186 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
187 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
188 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
189 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
190 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
191 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
192 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
201 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
202 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
203 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
204 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
206 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
207 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
208 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
209 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
210 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
211 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
212 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
213 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
214 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
215 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
216 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
217 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
218 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
219 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
220 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
221 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
222 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
223 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
224 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
225 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
226 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
227 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
228 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
229 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
230 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
231 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
232 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
233 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
234 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
235 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
236 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
238 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
239 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
240 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
241 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
242 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
243 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
244 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
245 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
246 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
247 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
248 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
249 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
250 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
251 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
252 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
253 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
254 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
255 2519899620 Rhizobium sp. Pop5 Isolate Nodule
256 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
257 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
258 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
259 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
260 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
261 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
262 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
263 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
264 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
265 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
266 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
267 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
268 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
269 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
270 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
271 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
272 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
273 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
274 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
275 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
276 2643221582 Rhizobium sp. Root651 Isolate Unclassified
277 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
278 2643221693 Rhizobium sp. Root491 Isolate Unclassified
279 2718217882 Rhizobium sp. N741 Isolate Nodule
280 2718217927 Rhizobium sp. N324 Isolate Nodule
281 2718218009 Rhizobium sp. N561 Isolate Nodule
282 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
283 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
284 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
285 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
286 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
287 2718218363 Rhizobium sp. N113 Isolate Nodule
288 2718218365 Rhizobium sp. N731 Isolate Nodule
289 2718218366 Rhizobium sp. N621 Isolate Nodule
290 2718218423 Rhizobium sp. N941 Isolate Nodule
291 2721755514 Rhizobium sp. N6212 Isolate Nodule
292 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
293 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
294 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
295 2721755809 Rhizobium sp. N541 Isolate Nodule
296 2721755810 Rhizobium sp. N871 Isolate Nodule
297 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
298 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
299 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
300 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
301 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
302 2728369365 Rhizobium sp. N1341 Isolate Nodule
303 2728369397 Rhizobium sp. N1314 Isolate Nodule
304 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
305 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
306 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
307 2791355256 Rhizobium sp. M10 Isolate Nodule
308 2791355260 Rhizobium sp. L9 Isolate Nodule
309 2791355261 Rhizobium sp. J15 Isolate Nodule
310 2791355262 Rhizobium sp. M1 Isolate Nodule
311 2791355263 Rhizobium chutanense C5 Isolate Nodule
312 2791355264 Rhizobium sp. S9 Isolate Nodule
313 2791355265 Rhizobium sp. H4 Isolate Nodule
314 2791355267 Rhizobium sp. L18 Isolate Nodule
315 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
316 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
317 2802429633 Rhizobium anhuiense J3 Isolate Nodule
318 2802429634 Rhizobium anhuiense S10 Isolate Nodule
319 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
320 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
321 2802429637 Rhizobium anhuiense C15 Isolate Nodule
322 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
323 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
324 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
325 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
326 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
327 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
328 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
329 2838048938 Rhizobium pisi 27/80 Isolate Nodule
330 2838061910 Rhizobium phaseoli L15 Isolate Nodule
331 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
332 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
333 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
334 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
335 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
336 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
337 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
338 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
339 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
340 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
341 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
342 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
343 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
344 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
345 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
346 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
347 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
348 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
349 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
350 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
351 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
352 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
353 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
354 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
355 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
356 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
357 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
358 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
359 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
360 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
361 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
362 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
363 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
364 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
365 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
366 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
367 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
368 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
369 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
370 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
371 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
372 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
373 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
374 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
375 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
376 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
377 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
378 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
379 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
380 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
381 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
382 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
383 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
384 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
385 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
386 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
387 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
388 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
389 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
390 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
391 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
392 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
393 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
394 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
395 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
396 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
397 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
398 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
399 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
400 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
401 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
402 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
403 2933599457 Rhizobium phaseoli M3 Isolate Nodule
404 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
405 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
406 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
407 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
408 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
409 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
410 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
411 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
412 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
413 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
414 2996887358 Rhizobium sp. R711 Isolate Nodule
415 2996893221 Rhizobium sp. R635 Isolate Nodule
416 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
417 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
418 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
419 8005258706 Rhizobium sp. R693 Isolate Nodule
420 8005275841 Rhizobium sp. N4311 Isolate Nodule
421 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
422 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
423 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
424 8005321885 Rhizobium sp. R72 Isolate Nodule
425 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
426 8005382845 Rhizobium sp. R634 Isolate Nodule
427 8005395548 Rhizobium sp. R339 Isolate Nodule
428 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
429 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
430 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
431 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
432 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
433 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
434 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
435 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
436 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
437 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
438 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
439 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
440 8018176218 Rhizobium sp. N122 Isolate Nodule
441 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
442 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
443 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
444 8024501048 Rhizobium sp. H4 Isolate Nodule
445 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
446 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
447 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
448 8056382006 Rhizobium croatiense 13T Isolate Nodule
449 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
450 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 65.66
Metatranscriptomes 0.48
Isolates 33.86

Biome Distribution

Category Percentage (%)
Aerial Root 0.64
Bulb 0
Endosphere 26.39
Nodule 26.07
Rhizoplane 2.54
Rhizosphere 30.21
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1009976 3300002773 Bacteria 2209
2 JGI25152J39213_1030364 3300002773 Bacteria 841
3 JGI25150J39212_1001433 3300002774 Bacteria 6676
4 JGI25150J39212_1002937 3300002774 Bacteria 4112
5 JGI25159J45721_1000630 3300002987 Bacteria 15627
6 JGI25151J46595_10001525 3300003187 Bacteria 15499
7 JGI25151J46595_10021165 3300003187 Bacteria 2725
8 JGI25153J46596_10015449 3300003215 Bacteria 3110
9 JGI25153J46596_10023972 3300003215 Bacteria 2209
10 rootH2_10126896 3300003320 Bacteria 2012
11 JGI25160J50197_1000235 3300003354 Bacteria 43030
12 JGI25160J50197_1005793 3300003354 Bacteria 5093
13 JGI25161J50226_1000175 3300003374 Bacteria 43039
14 JGI25161J50226_1004453 3300003374 Bacteria 2929
15 Ga0006562J51391_1015707 3300003578 Bacteria 2190
16 Ga0006562J51391_1015709 3300003578 Bacteria 740
17 Ga0055539_1010114 3300003752 Bacteria 1169
18 Ga0055526_1002690 3300003771 Bacteria 11842
19 Ga0055526_1005212 3300003771 Bacteria 7549
20 Ga0055526_1010438 3300003771 Bacteria 4320
21 Ga0055526_1022293 3300003771 Bacteria 2160
22 Ga0055524_1003888 3300003775 Bacteria 7083
23 Ga0055524_1009518 3300003775 Bacteria 3944
24 Ga0055524_1009776 3300003775 Bacteria 3871
25 Ga0055524_1013934 3300003775 Bacteria 3004
26 Ga0055528_1000369 3300003790 Bacteria 36582
27 Ga0055528_1003480 3300003790 Bacteria 7865
28 Ga0055528_1008072 3300003790 Bacteria 4566
29 Ga0055528_1028376 3300003790 Bacteria 1545
30 Ga0055528_1039666 3300003790 Bacteria 1072
31 Ga0055530_10006212 3300003791 Bacteria 5398
32 Ga0055540_1008906 3300003792 Bacteria 3544
33 Ga0055531_10005569 3300003794 Bacteria 7345
34 Ga0058692_1002165 3300003856 Bacteria 6711
35 Ga0058692_1004402 3300003856 Bacteria 4181
36 Ga0055543_1000226 3300004625 Bacteria 44983
37 Ga0055543_1001434 3300004625 Bacteria 9473
38 Ga0065165_1002250 3300005262 Bacteria 17103
39 Ga0065165_1015860 3300005262 Bacteria 2852
40 Ga0070666_11088232 3300005335 Bacteria 594
41 Ga0070668_100192252 3300005347 Bacteria 1672
42 Ga0070669_100094996 3300005353 Bacteria 2241
43 Ga0070669_100342429 3300005353 Bacteria 1212
44 Ga0070671_100028595 3300005355 Bacteria 4591
45 Ga0070663_100828388 3300005455 Bacteria 795
46 Ga0070662_100097966 3300005457 Bacteria 2214
47 Ga0068853_101359334 3300005539 Bacteria 687
48 Ga0070665_100002573 3300005548 Bacteria 19886
49 Ga0070665_100109045 3300005548 Bacteria 2771
50 Ga0070665_100125150 3300005548 Bacteria 2573
51 Ga0070665_100244265 3300005548 Bacteria 1796
52 Ga0068855_100240121 3300005563 Bacteria 2025
53 Ga0068857_102558000 3300005577 Bacteria 501
54 Ga0068854_100366725 3300005578 Bacteria 1183
55 Ga0068856_101257913 3300005614 Bacteria 756
56 Ga0068852_100318409 3300005616 Bacteria 1510
57 Ga0068864_101665126 3300005618 Bacteria 642
58 Ga0068863_101769377 3300005841 Bacteria 628
59 Ga0068860_100564612 3300005843 Bacteria 1141
60 Ga0081540_1208097 3300005983 Bacteria 705
61 Ga0075365_10026899 3300006038 Bacteria 3655
62 Ga0075368_10020011 3300006042 Bacteria 2531
63 Ga0075368_10078315 3300006042 Bacteria 1343
64 Ga0075368_10315064 3300006042 Bacteria 677
65 Ga0075363_100042750 3300006048 Bacteria 2395
66 Ga0075363_100116454 3300006048 Bacteria 1488
67 Ga0075363_100135123 3300006048 Bacteria 1385
68 Ga0075363_100338229 3300006048 Bacteria 877
69 Ga0075364_10020214 3300006051 Bacteria 4187
70 Ga0075364_10633203 3300006051 Bacteria 730
71 Ga0075362_10037244 3300006177 Bacteria 2131
72 Ga0075362_10670485 3300006177 Bacteria 539
73 Ga0075362_10691781 3300006177 Bacteria 531
74 Ga0075367_10027670 3300006178 Bacteria 3227
75 Ga0075367_10061706 3300006178 Bacteria 2238
76 Ga0075367_10080200 3300006178 Bacteria 1973
77 Ga0075367_10111202 3300006178 Bacteria 1681
78 Ga0075367_11107067 3300006178 Bacteria 506
79 Ga0075369_10042434 3300006186 Bacteria 1950
80 Ga0075369_10134652 3300006186 Bacteria 1124
81 Ga0075366_10004886 3300006195 Bacteria 7233
82 Ga0075366_10701331 3300006195 Bacteria 628
83 Ga0075366_10703447 3300006195 Bacteria 627
84 Ga0075370_10021925 3300006353 Bacteria 3502
85 Ga0075370_10144461 3300006353 Bacteria 1392
86 Ga0075370_10847662 3300006353 Bacteria 558
87 Ga0079104_1000195 3300006946 Bacteria 85244
88 Ga0099826_10000939 3300006948 Bacteria 16125
89 Ga0099826_10038824 3300006948 Bacteria 3339
90 Ga0105251_10021847 3300009011 Bacteria 3333
91 Ga0105244_10052824 3300009036 Bacteria 2067
92 Ga0105244_10392409 3300009036 Bacteria 639
93 Ga0105240_10000013 3300009093 Bacteria 483458
94 Ga0105243_10002616 3300009148 Bacteria 14997
95 Ga0105248_10042688 3300009177 Bacteria 5086
96 Ga0105237_10002248 3300009545 Bacteria 24031
97 Ga0105238_11141288 3300009551 Bacteria 803
98 Ga0105249_10071286 3300009553 Bacteria 3210
99 Ga0105239_10000820 3300010375 Bacteria 44190
100 Ga0105239_10105894 3300010375 Bacteria 3115
101 Ga0105239_11174728 3300010375 Bacteria 884
102 Ga0105239_11599400 3300010375 Bacteria 754
103 Ga0157314_1054330 3300012500 Bacteria 520
104 Ga0157373_10007036 3300013100 Bacteria 8384
105 Ga0157371_10149503 3300013102 Bacteria 1665
106 Ga0157370_10000720 3300013104 Bacteria 41451
107 Ga0157370_10217065 3300013104 Bacteria 1772
108 Ga0157369_10686811 3300013105 Bacteria 1055
109 Ga0157374_10561430 3300013296 Bacteria 1150
110 Ga0163162_10641764 3300013306 Bacteria 1186
111 Ga0163163_10487423 3300014325 Bacteria 1294
112 Ga0182008_10004588 3300014497 Bacteria 8043
113 Ga0182007_10024529 3300015262 Bacteria 2110
114 Ga0182005_1030396 3300015265 Bacteria 1472
115 Ga0209436_107060 3300025208 Bacteria 2395
116 Ga0209437_107795 3300025233 Bacteria 1728
117 Ga0207425_1003332 3300025245 Bacteria 5191
118 Ga0207425_1009047 3300025245 Bacteria 2505
119 Ga0207425_1009636 3300025245 Bacteria 2392
120 Ga0209677_100199 3300025253 Bacteria 48030
121 Ga0209129_1000118 3300025258 Bacteria 139972
122 Ga0209129_1002212 3300025258 Bacteria 9761
123 Ga0209129_1004318 3300025258 Bacteria 5635
124 Ga0209129_1006453 3300025258 Bacteria 3780
125 Ga0209129_1012542 3300025258 Bacteria 1936
126 Ga0209129_1032083 3300025258 Bacteria 871
127 Ga0209129_1034693 3300025258 Bacteria 824
128 Ga0209233_1000331 3300025261 Bacteria 48397
129 Ga0209673_1000033 3300025273 Bacteria 335369
130 Ga0209673_1000052 3300025273 Bacteria 279795
131 Ga0209673_1000975 3300025273 Bacteria 35311
132 Ga0209673_1003997 3300025273 Bacteria 8197
133 Ga0209673_1012018 3300025273 Bacteria 3522
134 Ga0209673_1050768 3300025273 Bacteria 1099
135 Ga0209130_1000132 3300025284 Bacteria 119765
136 Ga0209130_1055437 3300025284 Bacteria 705
137 Ga0209675_1025466 3300025291 Bacteria 1490
138 Ga0209676_1001884 3300025292 Bacteria 17124
139 Ga0209676_1012256 3300025292 Bacteria 3387
140 Ga0209676_1042744 3300025292 Bacteria 1256
141 Ga0209676_1043489 3300025292 Bacteria 1239
142 Ga0209025_1001035 3300025294 Bacteria 40774
143 Ga0209025_1007921 3300025294 Bacteria 7778
144 Ga0209025_1017761 3300025294 Bacteria 4083
145 Ga0209025_1026749 3300025294 Bacteria 2884
146 Ga0209025_1051563 3300025294 Bacteria 1633
147 Ga0209564_1001043 3300025295 Bacteria 33899
148 Ga0209564_1002864 3300025295 Bacteria 12661
149 Ga0209564_1008504 3300025295 Bacteria 5052
150 Ga0209564_1014648 3300025295 Bacteria 3243
151 Ga0209564_1031667 3300025295 Bacteria 1610
152 Ga0209758_1000570 3300025297 Bacteria 57866
153 Ga0209758_1006484 3300025297 Bacteria 8378
154 Ga0209758_1007025 3300025297 Bacteria 7823
155 Ga0209758_1016409 3300025297 Bacteria 3765
156 Ga0209758_1019452 3300025297 Bacteria 3272
157 Ga0209758_1064411 3300025297 Bacteria 1188
158 Ga0209050_1003271 3300025298 Bacteria 12167
159 Ga0209256_1000510 3300025299 Bacteria 57080
160 Ga0209256_1002448 3300025299 Bacteria 15134
161 Ga0209256_1002711 3300025299 Bacteria 13805
162 Ga0209256_1018454 3300025299 Bacteria 2265
163 Ga0207426_1000246 3300025302 Bacteria 119765
164 Ga0207426_1000348 3300025302 Bacteria 85294
165 Ga0207426_1000595 3300025302 Bacteria 47697
166 Ga0209051_1001505 3300025303 Bacteria 19474
167 Ga0209051_1007759 3300025303 Bacteria 5807
168 Ga0209051_1052047 3300025303 Bacteria 1356
169 Ga0209257_1000989 3300025304 Bacteria 38561
170 Ga0207655_1141951 3300025728 Bacteria 770
171 Ga0207647_10101120 3300025904 Bacteria 1710
172 Ga0207647_10116537 3300025904 Bacteria 1577
173 Ga0207695_10000044 3300025913 Bacteria 440819
174 Ga0207671_10000226 3300025914 Bacteria 84886
175 Ga0207681_10189983 3300025923 Bacteria 1571
176 Ga0207644_10302939 3300025931 Bacteria 1288
177 Ga0207709_10100753 3300025935 Bacteria 1909
178 Ga0207711_10059397 3300025941 Bacteria 3293
179 Ga0207711_11699863 3300025941 Bacteria 574
180 Ga0207667_10286231 3300025949 Bacteria 1684
181 Ga0207712_10078997 3300025961 Bacteria 2389
182 Ga0207668_10019406 3300025972 Bacteria 4298
183 Ga0207668_10323406 3300025972 Bacteria 1281
184 Ga0207640_10398768 3300025981 Bacteria 1120
185 Ga0207658_10718232 3300025986 Bacteria 904
186 Ga0207639_11261164 3300026041 Bacteria 694
187 Ga0207678_10686569 3300026067 Bacteria 901
188 Ga0207676_10505069 3300026095 Bacteria 1149
189 Ga0207698_10263735 3300026142 Bacteria 1584
190 Ga0209281_1000028 3300027111 Bacteria 440027
191 Ga0209371_1000037 3300027312 Bacteria 367074
192 Ga0209371_1001349 3300027312 Bacteria 17013
193 Ga0209282_1004745 3300027666 Bacteria 8243
194 Ga0209813_10001984 3300027866 Bacteria 4630
195 Ga0209813_10038445 3300027866 Bacteria 1446
196 Ga0209813_10058282 3300027866 Bacteria 1227
197 Ga0268266_10002167 3300028379 Bacteria 21541
198 Ga0268266_10025844 3300028379 Bacteria 4996
199 Ga0268266_10112804 3300028379 Bacteria 2410
200 Ga0268266_10151336 3300028379 Bacteria 2092
201 Ga0268256_1000039 3300030500 Bacteria 354969
202 Ga0268256_1002379 3300030500 Bacteria 9678
203 Ga0316181_1149997 3300030744 Bacteria 2550
204 Ga0265328_10000031 3300031239 Bacteria 104251
205 Ga0265316_10282486 3300031344 Bacteria 1213
206 Ga0307513_10030299 3300031456 Bacteria 6147
207 Ga0307413_10314936 3300031824 Bacteria 1193
208 Ga0307409_100825934 3300031995 Bacteria 936
209 Ga0373946_0385991 3300035171 Bacteria 705
210 Ga0373935_0034213 3300035692 Bacteria 3167
211 Ga0373927_0000135 3300035695 Bacteria 56787
212 Ga0373925_0001153 3300037068 Bacteria 23450
213 Ga0395905_0244747 3300037471 Bacteria 1675
214 Ga0395901_0333882 3300038443 Bacteria 1567
215 Ga0451787_136136 3300041441 Bacteria 727
216 Ga0451791_1908955 3300041451 Bacteria 928
217 Ga0451800_0570848 3300041459 Bacteria 758
218 Ga0451835_0077690 3300041492 Bacteria 1245
219 Ga0451835_0079194 3300041492 Bacteria 1412
220 Ga0451837_1731566 3300041494 Bacteria 560
221 Ga0451839_1454183 3300041496 Bacteria 2673
222 Ga0451839_1536402 3300041496 Bacteria 638
223 Ga0451841_0383686 3300041498 Bacteria 975
224 Ga0451845_0073473 3300041501 Bacteria 1531
225 Ga0451847_0361612 3300041503 Bacteria 2729
226 Ga0451849_0905216 3300041505 Bacteria 2907
227 Ga0451851_0756758 3300041507 Bacteria 1660
228 Ga0451843_1300582 3300041509 Bacteria 917
229 Ga0451855_0546513 3300041511 Bacteria 1591
230 Ga0451855_1129947 3300041511 Bacteria 909
231 Ga0451853_1938628 3300041512 Bacteria 1391
232 Ga0450908_092008 3300042184 Bacteria 550
233 Ga0466970_0464581 3300044765 Bacteria 726
234 Ga0466957_0028365 3300044842 Bacteria 3333
235 Ga0495617_173022 3300046452 Bacteria 681
236 Ga0495638_0001266 3300046460 Bacteria 23584
237 Ga0495638_0064120 3300046460 Bacteria 2264
238 Ga0495650_0126521 3300046471 Bacteria 936
239 Ga0495605_0001289 3300046474 Bacteria 16636
240 Ga0495605_0445372 3300046474 Bacteria 534
241 Ga0495584_0234090 3300046491 Bacteria 934
242 Ga0495585_0003047 3300046492 Bacteria 11546
243 Ga0495585_0038007 3300046492 Bacteria 2710
244 Ga0495607_0131607 3300046501 Bacteria 1301
245 Ga0495607_0413435 3300046501 Bacteria 611
246 Ga0495583_0041751 3300046506 Bacteria 2146
247 Ga0495583_0110732 3300046506 Bacteria 1164
248 Ga0495583_0366528 3300046506 Bacteria 567
249 Ga0495606_0002374 3300046507 Bacteria 22109
250 Ga0495606_0067795 3300046507 Bacteria 2258
251 Ga0495606_0165310 3300046507 Bacteria 1288
252 Ga0495606_0349389 3300046507 Bacteria 785
253 Ga0495610_0110516 3300046512 Bacteria 1218
254 Ga0495616_0002338 3300046513 Bacteria 12653
255 Ga0495616_0457342 3300046513 Bacteria 516
256 Ga0495620_0033384 3300046515 Bacteria 2337
257 Ga0495620_0253058 3300046515 Bacteria 671
258 Ga0495631_0010452 3300046518 Bacteria 4590
259 Ga0495631_0291382 3300046518 Bacteria 695
260 Ga0495631_0503520 3300046518 Bacteria 516
261 Ga0495632_0005370 3300046519 Bacteria 8484
262 Ga0495632_0038801 3300046519 Bacteria 2409
263 Ga0495637_0314748 3300046520 Bacteria 553
264 Ga0495637_0331479 3300046520 Bacteria 536
265 Ga0495643_0004293 3300046522 Bacteria 10044
266 Ga0495643_0130492 3300046522 Bacteria 1262
267 Ga0495643_0293927 3300046522 Bacteria 743
268 Ga0495654_0351361 3300046530 Bacteria 593
269 Ga0495609_0031791 3300046538 Bacteria 2398
270 Ga0495609_0108353 3300046538 Bacteria 1200
271 Ga0495597_0026461 3300046542 Bacteria 2665
272 Ga0495633_0023921 3300046558 Bacteria 3022
273 Ga0495633_0030028 3300046558 Bacteria 2642
274 Ga0495656_0174590 3300046615 Bacteria 1053
275 Ga0495611_0025215 3300046648 Bacteria 2590
276 Ga0495611_0474489 3300046648 Bacteria 569
277 Ga0495625_0006348 3300046660 Bacteria 10560
278 Ga0495625_0763429 3300046660 Bacteria 565
279 Ga0495661_0077789 3300046665 Bacteria 1921
280 Ga0495661_0269611 3300046665 Bacteria 862
281 Ga0495588_0000643 3300046674 Bacteria 16231
282 Ga0495588_0342229 3300046674 Bacteria 786
283 Ga0495671_0409918 3300046692 Bacteria 648
284 Ga0495649_0455530 3300046694 Bacteria 639
285 Ga0495660_0073135 3300046810 Bacteria 1814
286 Ga0495660_0287067 3300046810 Bacteria 750
287 Ga0495636_0515730 3300047318 Bacteria 579
288 Ga0495672_0005051 3300047320 Bacteria 10549
289 Ga0495677_0117824 3300047445 Bacteria 1012
290 Ga0495673_0334799 3300047469 Bacteria 537
291 Ga0495681_0068794 3300047470 Bacteria 1610
292 Ga0495681_0078383 3300047470 Bacteria 1480
293 Ga0495686_0002454 3300047472 Bacteria 17478
294 Ga0495686_0020483 3300047472 Bacteria 4409
295 Ga0495686_0127075 3300047472 Bacteria 1515
296 Ga0495615_0023372 3300048090 Bacteria 1416
297 Ga0496102_0055407 3300048905 Bacteria 3616
298 Ga0496103_0017929 3300048906 Bacteria 4242
299 Ga0496104_1159250 3300048907 Bacteria 676
300 Ga0496105_0329330 3300048908 Bacteria 1223
301 Ga0496106_0070383 3300048909 Bacteria 2672
302 Ga0496106_1468227 3300048909 Bacteria 525
303 Ga0496112_0691312 3300048915 Bacteria 948
304 Ga0496113_0124914 3300048916 Bacteria 2014
305 Ga0496113_0203924 3300048916 Bacteria 1572
306 Ga0496116_0007780 3300048919 Bacteria 9425
307 Ga0496116_0018079 3300048919 Bacteria 5448
308 Ga0496116_0044467 3300048919 Bacteria 3016
309 Ga0496116_0245130 3300048919 Bacteria 897
310 Ga0496117_0000031 3300048920 Bacteria 381048
311 Ga0496117_0088284 3300048920 Bacteria 2006
312 Ga0496117_0316560 3300048920 Bacteria 819
313 Ga0496118_0001884 3300048921 Bacteria 29940
314 Ga0496118_0004259 3300048921 Bacteria 17116
315 Ga0496118_0075819 3300048921 Bacteria 2396
316 Ga0496118_0091414 3300048921 Bacteria 2093
317 Ga0496119_0006784 3300048922 Bacteria 10496
318 Ga0496120_0001817 3300048923 Bacteria 23874
319 Ga0496120_0006387 3300048923 Bacteria 9061
320 Ga0496120_0010675 3300048923 Bacteria 6379
321 Ga0496120_0115401 3300048923 Bacteria 1396
322 Ga0496121_0000034 3300048924 Bacteria 377095
323 Ga0496121_0005856 3300048924 Bacteria 15572
324 Ga0496121_0009335 3300048924 Bacteria 11309
325 Ga0496121_0060592 3300048924 Bacteria 3112
326 Ga0496121_0110757 3300048924 Bacteria 2094
327 Ga0496121_0286878 3300048924 Bacteria 1123
328 Ga0496121_0548778 3300048924 Bacteria 723
329 Ga0496121_0675936 3300048924 Bacteria 625
330 Ga0496121_0727660 3300048924 Bacteria 593
331 Ga0496122_0000023 3300048925 Bacteria 381035
332 Ga0496122_0043012 3300048925 Bacteria 3544
333 Ga0496122_0111527 3300048925 Bacteria 1793
334 Ga0496123_0000027 3300048926 Bacteria 306773
335 Ga0496123_0044540 3300048926 Bacteria 3033
336 Ga0496123_0142055 3300048926 Bacteria 1310
337 Ga0496124_0048776 3300048927 Bacteria 3615
338 Ga0496124_0050758 3300048927 Bacteria 3532
339 Ga0496124_0084209 3300048927 Bacteria 2608
340 Ga0496124_0222435 3300048927 Bacteria 1418
341 Ga0496124_0469570 3300048927 Bacteria 852
342 Ga0496125_0000030 3300048928 Bacteria 375023
343 Ga0496125_0029644 3300048928 Bacteria 4913
344 Ga0496125_0039838 3300048928 Bacteria 4039
345 Ga0496125_0046495 3300048928 Bacteria 3640
346 Ga0496126_0165011 3300048929 Bacteria 1890
347 Ga0496126_0179292 3300048929 Bacteria 1800
348 Ga0496126_0777725 3300048929 Bacteria 736
349 Ga0496126_1347516 3300048929 Bacteria 517
350 Ga0495682_0341973 3300049460 Bacteria 527
351 Ga0501032_0712091 3300049569 Bacteria 636
352 Ga0501033_0318985 3300049570 Bacteria 1092
353 Ga0501036_0189357 3300049572 Bacteria 1731
354 Ga0501037_0218036 3300049573 Bacteria 1343
355 Ga0501038_0057586 3300049574 Bacteria 3336
356 Ga0501039_0049919 3300049575 Bacteria 3236
357 Ga0501047_0702695 3300049581 Bacteria 828
358 Ga0501048_0930197 3300049582 Bacteria 625
359 Ga0501068_0404956 3300049584 Bacteria 880
360 Ga0501073_0071672 3300049589 Bacteria 2414
361 Ga0501238_004053 3300049671 Bacteria 1817
362 Ga0501083_0045788 3300049744 Bacteria 2959
363 Ga0501035_0000316 3300049822 Bacteria 55833
364 Ga0501035_0521627 3300049822 Bacteria 976
365 Ga0501044_0073462 3300049823 Bacteria 3476
366 nmdc:mga03683_110939_c1 3300050489 Bacteria 1213
367 nmdc:mga03683_9220_c1 3300050489 Bacteria 3501
368 nmdc:mga03n38_111503_c1 3300050490 Bacteria 1333
369 nmdc:mga03n38_126866_c1 3300050490 Bacteria 1260
370 nmdc:mga03n38_559789_c1 3300050490 Bacteria 648
371 nmdc:mga03n38_634325_c1 3300050490 Bacteria 611
372 nmdc:mga00v17_27918_c1 3300050491 Bacteria 3300
373 nmdc:mga00v17_3198_c2 3300050491 Bacteria 4822
374 nmdc:mga00v17_406685_c1 3300050491 Bacteria 884
375 nmdc:mga00v17_516391_c1 3300050491 Bacteria 774
376 nmdc:mga00v17_52201_c1 3300050491 Bacteria 2487
377 nmdc:mga0yw44_8555_c1 3300050492 Bacteria 3047
378 nmdc:mga0k408_13981_c1 3300050493 Bacteria 4411
379 nmdc:mga06z11_4609_c1 3300050494 Bacteria 5437
380 nmdc:mga06z11_501464_c1 3300050494 Bacteria 735
381 nmdc:mga06z11_84663_c1 3300050494 Bacteria 1709
382 nmdc:mga07m45_31424_c1 3300050496 Bacteria 2943
383 nmdc:mga07m45_541309_c1 3300050496 Bacteria 674
384 nmdc:mga07m45_790593_c1 3300050496 Bacteria 544
385 nmdc:mga0sz30_139877_c1 3300050516 Bacteria 1069
386 nmdc:mga0sz30_40405_c1 3300050516 Bacteria 1961
387 Ga0500610_0056659 3300053079 Bacteria 2045
388 Ga0500578_0232135 3300053086 Bacteria 1117
389 Ga0500651_0429715 3300053093 Bacteria 738
390 Ga0500651_0524398 3300053093 Bacteria 651
391 Ga0500651_0779548 3300053093 Bacteria 506
392 Ga0500650_0097631 3300053098 Bacteria 1376
393 Ga0500557_123611 3300053105 Bacteria 858
394 Ga0500560_104057 3300053107 Bacteria 951
395 Ga0500569_078712 3300053109 Bacteria 1050
396 Ga0500608_308954 3300053122 Bacteria 582
397 Ga0500618_000862 3300053125 Bacteria 16226
398 Ga0500618_001516 3300053125 Bacteria 10229
399 Ga0500618_092790 3300053125 Bacteria 678
400 Ga0500628_015372 3300053129 Bacteria 1463
401 Ga0500642_0274272 3300053130 Bacteria 768
402 Ga0500658_0000281 3300053134 Bacteria 23165
403 Ga0500559_0549247 3300053136 Bacteria 527
404 Ga0500561_0000530 3300053137 Bacteria 6169
405 Ga0500568_0001609 3300053139 Bacteria 14286
406 Ga0500577_0050226 3300053142 Bacteria 1563
407 Ga0500616_0002690 3300053153 Bacteria 14450
408 Ga0500616_0033085 3300053153 Bacteria 2822
409 Ga0500624_000401 3300053157 Bacteria 13438
410 Ga0500627_0076335 3300053158 Bacteria 1490
411 Ga0500636_0367780 3300053177 Bacteria 679
412 Ga0500645_097303 3300053730 Bacteria 832
413 Ga0500609_054734 3300053731 Bacteria 556
414 Ga0587068_016060 3300059641 Bacteria 1184
415 Ga0501082_0466143 3300060353 Bacteria 1104
416 2842511752 2842509118 Bacteria 6850950
417 2509389461 2509276021 Bacteria 7634384
418 2510135197 2510065019 Bacteria 6903379
419 2511133829 2510917022 Bacteria 6504556
420 2513571574 2513237084 Bacteria 7231967
421 2513578614 2513237085 Bacteria 7695351
422 2513598154 2513237088 Bacteria 6927906
423 2513630203 2513237093 Bacteria 7545552
424 2513711299 2513237103 Bacteria 7647401
425 2514019344 2513237162 Bacteria 7468464
426 2515114352 2515075009 Bacteria 7288508
427 2515636271 2515154113 Bacteria 7807172
428 2515643235 2515154114 Bacteria 7848616
429 2515741540 2515154134 Bacteria 7220242
430 2517037995 2516653077 Bacteria 7555578
431 2517078263 2516653085 Bacteria 7346596
432 2517408587 2517287029 Bacteria 6905599
433 2520379658 2519899620 Bacteria 6499161
434 2530647397 2529292951 Bacteria 6916614
435 2537876633 2537561587 Bacteria 5425293
436 2554248822 2554235003 Bacteria 5877155
437 2559295910 2558860242 Bacteria 5568029
438 2585271618 2582581307 Bacteria 6597605
439 2585280681 2582581308 Bacteria 7413247
440 2585531615 2585427527 Bacteria 7273426
441 2585540731 2585427528 Bacteria 6842387
442 2585551438 2585427530 Bacteria 7383882
443 2585563142 2585427531 Bacteria 6992870
444 2585820787 2585427590 Bacteria 6824633
445 2585839000 2585427593 Bacteria 7141551
446 2585902807 2585427608 Bacteria 6544331
447 2585907361 2585427609 Bacteria 6667127
448 2587982645 2585428125 Bacteria 6662905
449 2599603298 2599185210 Bacteria 5624189
450 2599720285 2599185236 Bacteria 6875203
451 2601610796 2600255279 Bacteria 5605316
452 2601747570 2600255308 Bacteria 5611129
453 2616296361 2615840624 Bacteria 6557588
454 2643921435 2643221582 Bacteria 5804683
455 2644240552 2643221643 Bacteria 5749658
456 2644521488 2643221693 Bacteria 5513853
457 2719182915 2718217882 Bacteria 6556348
458 2719387622 2718217927 Bacteria 6972593
459 2719733632 2718218009 Bacteria 6478651
460 2720493678 2718218199 Bacteria 6740745
461 2720615133 2718218232 Bacteria 6720332
462 2720621926 2718218233 Bacteria 6662049
463 2720633276 2718218235 Bacteria 6630699
464 2720776975 2718218269 Bacteria 6906114
465 2721149027 2718218363 Bacteria 6524337
466 2721160425 2718218365 Bacteria 6274507
467 2721165840 2718218366 Bacteria 6425255
468 2721401256 2718218423 Bacteria 6438183
469 2722842010 2721755514 Bacteria 6424414
470 2723028574 2721755556 Bacteria 6745503
471 2723562176 2721755684 Bacteria 6859907
472 2723568879 2721755685 Bacteria 6704835
473 2724040070 2721755809 Bacteria 6438790
474 2724046388 2721755810 Bacteria 6479005
475 2724091582 2721755819 Bacteria 6906405
476 2724106144 2721755822 Bacteria 6726041
477 2724111949 2721755823 Bacteria 6752556
478 2725947485 2724679232 Bacteria 7646494
479 2730109510 2728369352 Bacteria 6745171
480 2730166150 2728369365 Bacteria 6555560
481 2730300057 2728369397 Bacteria 6274511
482 2739037227 2738541333 Bacteria 7106503
483 2766064324 2765235942 Bacteria 7445910
484 2776915432 2775507049 Bacteria 6284736
485 2793295682 2791355256 Bacteria 6798008
486 2793320665 2791355260 Bacteria 6598818
487 2793327231 2791355261 Bacteria 6661293
488 2793332182 2791355262 Bacteria 6774204
489 2793338761 2791355263 Bacteria 6872478
490 2793346552 2791355264 Bacteria 6429314
491 2793353913 2791355265 Bacteria 6539969
492 2793365853 2791355267 Bacteria 7222458
493 2805926160 2802429605 Bacteria 6875453
494 2805937187 2802429606 Bacteria 6346811
495 2806047318 2802429633 Bacteria 7341974
496 2806054173 2802429634 Bacteria 7083200
497 2806060243 2802429635 Bacteria 7650140
498 2806068854 2802429636 Bacteria 7597525
499 2806077203 2802429637 Bacteria 7067217
500 2808988266 2808606387 Bacteria 5697198
501 2819560920 2818991439 Bacteria 6907412
502 2819638868 2818991453 Bacteria 7181617
503 2821128673 2821123053 Bacteria 7836056
504 2838018383 2838016132 Bacteria 6577831
505 2838024067 2838022645 Bacteria 6494267
506 2838048421 2838042994 Bacteria 6046894
507 2838050755 2838048938 Bacteria 6044578
508 2838062520 2838061910 Bacteria 6794874
509 2838072072 2838068647 Bacteria 6208656
510 2838672869 2838668709 Bacteria 6671819
511 2838678717 2838675328 Bacteria 4909118
512 2838690227 2838686498 Bacteria 7807632
513 2838705653 2838701080 Bacteria 6669771
514 2838718194 2838714209 Bacteria 5525906
515 2838723014 2838719591 Bacteria 5523910
516 2838728261 2838724970 Bacteria 4908691
517 2838732002 2838729681 Bacteria 7400765
518 2838741690 2838736955 Bacteria 5760694
519 2838744898 2838742623 Bacteria 7396178
520 2841845476 2841840854 Bacteria 5761912
521 2841850570 2841846520 Bacteria 5345850
522 2841855955 2841851746 Bacteria 7532261
523 2841867810 2841864319 Bacteria 6742987
524 2842116912 2842110456 Bacteria 7656360
525 2842128920 2842124991 Bacteria 5346824
526 2842133609 2842130223 Bacteria 4909145
527 2842145179 2842140634 Bacteria 5759631
528 2842149983 2842146304 Bacteria 5957337
529 2842155479 2842152218 Bacteria 4908957
530 2842161125 2842156927 Bacteria 6894975
531 2842166643 2842163707 Bacteria 6916235
532 2842174564 2842170452 Bacteria 5525737
533 2842179223 2842175837 Bacteria 4908771
534 2842184741 2842180545 Bacteria 6888678
535 2842190618 2842187318 Bacteria 5524014
536 2842194938 2842192696 Bacteria 6147454
537 2842201661 2842198810 Bacteria 6608673
538 2842207366 2842205361 Bacteria 6340321
539 2842215058 2842211629 Bacteria 5523832
540 2842221727 2842217011 Bacteria 7497767
541 2842227779 2842224351 Bacteria 5524473
542 2842232324 2842229732 Bacteria 7475766
543 2842246739 2842243621 Bacteria 7421798
544 2842255333 2842250916 Bacteria 6579627
545 2842261159 2842257432 Bacteria 7401195
546 2842269586 2842264693 Bacteria 6472963
547 2842274247 2842271015 Bacteria 7807131
548 2842280923 2842278818 Bacteria 6340002
549 2842288461 2842285085 Bacteria 6011953
550 2842305906 2842304105 Bacteria 7023636
551 2842311359 2842311132 Bacteria 6616990
552 2842321055 2842317721 Bacteria 6793725
553 2842346634 2842341865 Bacteria 7003929
554 2842366324 2842363717 Bacteria 6844742
555 2842406193 2842402390 Bacteria 6681310
556 2842412778 2842409023 Bacteria 6687331
557 2842419343 2842415677 Bacteria 6596907
558 2842425704 2842422224 Bacteria 6239196
559 2842433544 2842428310 Bacteria 6767288
560 2842439872 2842434925 Bacteria 6502746
561 2842446501 2842441272 Bacteria 6769273
562 2842448832 2842447887 Bacteria 6754142
563 2842467825 2842462802 Bacteria 6588055
564 2842474481 2842469257 Bacteria 6752936
565 2842491108 2842489311 Bacteria 6620893
566 2842498445 2842495871 Bacteria 6820686
567 2844457075 2844454524 Bacteria 7952546
568 2852391652 2852387548 Bacteria 8025568
569 2857534174 2857531043 Bacteria 6754041
570 2899795276 2899792073 Bacteria 4926588
571 2899808083 2899803654 Bacteria 5577784
572 2899849257 2899845264 Bacteria 5672268
573 2919118548 2919114240 Bacteria 5700270
574 2926755078 2926754445 Bacteria 5964435
575 2929141820 2929138655 Bacteria 5810547
576 2933010671 2933006813 Bacteria 4912075
577 2933015655 2933011516 Bacteria 5439334
578 2933572411 2933570622 Bacteria 7023390
579 2933593084 2933586486 Bacteria 7667493
580 2933597604 2933594066 Bacteria 5594265
581 2933603074 2933599457 Bacteria 5858799
582 2935903685 2935901341 Bacteria 7341747
583 2936369835 2936367885 Bacteria 7324495
584 2936379022 2936375103 Bacteria 6652732
585 2979092492 2979089926 Bacteria 5670289
586 2979100117 2979095461 Bacteria 5669583
587 2979104463 2979100975 Bacteria 5423623
588 2984513741 2984509177 Bacteria 5274802
589 2984522681 2984518228 Bacteria 5277463
590 2984541987 2984537506 Bacteria 5277481
591 2984601417 2984601300 Bacteria 5455244
592 2996890190 2996887358 Bacteria 5795980
593 2996895231 2996893221 Bacteria 5823108
594 639650382 639633055 Bacteria 7751309
595 650741124 650716007 Bacteria 5573770
596 8003573817 8003570095 Bacteria 5747666
597 8005262374 8005258706 Bacteria 6184835
598 8005282376 8005275841 Bacteria 6929066
599 8005286800 8005282627 Bacteria 6675747
600 8005295033 8005289223 Bacteria 6634003
601 8005313648 8005307578 Bacteria 7395396
602 8005324717 8005321885 Bacteria 5795980
603 8005381620 8005376324 Bacteria 6590079
604 8005387825 8005382845 Bacteria 6732062
605 8005400861 8005395548 Bacteria 6806915
606 8005431053 8005430974 Bacteria 6689030
607 8005465043 8005460587 Bacteria 7157962
608 8005497622 8005497431 Bacteria 6477605
609 8005561116 8005556819 Bacteria 6908598
610 8005565742 8005563573 Bacteria 7153261
611 8005571794 8005570704 Bacteria 6957481
612 8005623356 8005619151 Bacteria 7030230
613 8005631064 8005626139 Bacteria 6534237
614 8005669027 8005668836 Bacteria 6953162
615 8005694391 8005688590 Bacteria 6610080
616 8018128862 8018127388 Bacteria 7351159
617 8018155024 8018150411 Bacteria 5549903
618 8018177094 8018176218 Bacteria 6896178
619 8023686486 8023680758 Bacteria 7729763
620 8024484314 8024479707 Bacteria 6954785
621 8024490805 8024486573 Bacteria 6540512
622 8024502381 8024501048 Bacteria 6427847
623 8046768072 8046767195 Bacteria 7547379
624 8055435645 8055431914 Bacteria 4551896
625 8056380362 8056375014 Bacteria 7006639
626 8056385192 8056382006 Bacteria 6408074
627 8057581569 8057575449 Bacteria 7367519
628 8057879234 8057874678 Bacteria 7494653
629 JGI25152J39213_1009976
630 JGI25152J39213_1030364
631 JGI25150J39212_1001433
632 JGI25150J39212_1002937
633 JGI25159J45721_1000630
634 JGI25151J46595_10001525
635 JGI25151J46595_10021165
636 JGI25153J46596_10015449
637 JGI25153J46596_10023972
638 rootH2_10126896
639 JGI25160J50197_1000235
640 JGI25160J50197_1005793
641 JGI25161J50226_1000175
642 JGI25161J50226_1004453
643 Ga0006562J51391_1015707
644 Ga0006562J51391_1015709
645 Ga0055539_1010114
646 Ga0055526_1002690
647 Ga0055526_1005212
648 Ga0055526_1010438
649 Ga0055526_1022293
650 Ga0055524_1003888
651 Ga0055524_1009518
652 Ga0055524_1009776
653 Ga0055524_1013934
654 Ga0055528_1000369
655 Ga0055528_1003480
656 Ga0055528_1008072
657 Ga0055528_1028376
658 Ga0055528_1039666
659 Ga0055530_10006212
660 Ga0055540_1008906
661 Ga0055531_10005569
662 Ga0058692_1002165
663 Ga0058692_1004402
664 Ga0055543_1000226
665 Ga0055543_1001434
666 Ga0065165_1002250
667 Ga0065165_1015860
668 Ga0070666_11088232
669 Ga0070668_100192252
670 Ga0070669_100094996
671 Ga0070669_100342429
672 Ga0070671_100028595
673 Ga0070663_100828388
674 Ga0070662_100097966
675 Ga0068853_101359334
676 Ga0070665_100002573
677 Ga0070665_100109045
678 Ga0070665_100125150
679 Ga0070665_100244265
680 Ga0068855_100240121
681 Ga0068857_102558000
682 Ga0068854_100366725
683 Ga0068856_101257913
684 Ga0068852_100318409
685 Ga0068864_101665126
686 Ga0068863_101769377
687 Ga0068860_100564612
688 Ga0081540_1208097
689 Ga0075365_10026899
690 Ga0075368_10020011
691 Ga0075368_10078315
692 Ga0075368_10315064
693 Ga0075363_100042750
694 Ga0075363_100116454
695 Ga0075363_100135123
696 Ga0075363_100338229
697 Ga0075364_10020214
698 Ga0075364_10633203
699 Ga0075362_10037244
700 Ga0075362_10670485
701 Ga0075362_10691781
702 Ga0075367_10027670
703 Ga0075367_10061706
704 Ga0075367_10080200
705 Ga0075367_10111202
706 Ga0075367_11107067
707 Ga0075369_10042434
708 Ga0075369_10134652
709 Ga0075366_10004886
710 Ga0075366_10701331
711 Ga0075366_10703447
712 Ga0075370_10021925
713 Ga0075370_10144461
714 Ga0075370_10847662
715 Ga0079104_1000195
716 Ga0099826_10000939
717 Ga0099826_10038824
718 Ga0105251_10021847
719 Ga0105244_10052824
720 Ga0105244_10392409
721 Ga0105240_10000013
722 Ga0105243_10002616
723 Ga0105248_10042688
724 Ga0105237_10002248
725 Ga0105238_11141288
726 Ga0105249_10071286
727 Ga0105239_10000820
728 Ga0105239_10105894
729 Ga0105239_11174728
730 Ga0105239_11599400
731 Ga0157314_1054330
732 Ga0157373_10007036
733 Ga0157371_10149503
734 Ga0157370_10000720
735 Ga0157370_10217065
736 Ga0157369_10686811
737 Ga0157374_10561430
738 Ga0163162_10641764
739 Ga0163163_10487423
740 Ga0182008_10004588
741 Ga0182007_10024529
742 Ga0182005_1030396
743 Ga0209436_107060
744 Ga0209437_107795
745 Ga0207425_1003332
746 Ga0207425_1009047
747 Ga0207425_1009636
748 Ga0209677_100199
749 Ga0209129_1000118
750 Ga0209129_1002212
751 Ga0209129_1004318
752 Ga0209129_1006453
753 Ga0209129_1012542
754 Ga0209129_1032083
755 Ga0209129_1034693
756 Ga0209233_1000331
757 Ga0209673_1000033
758 Ga0209673_1000052
759 Ga0209673_1000975
760 Ga0209673_1003997
761 Ga0209673_1012018
762 Ga0209673_1050768
763 Ga0209130_1000132
764 Ga0209130_1055437
765 Ga0209675_1025466
766 Ga0209676_1001884
767 Ga0209676_1012256
768 Ga0209676_1042744
769 Ga0209676_1043489
770 Ga0209025_1001035
771 Ga0209025_1007921
772 Ga0209025_1017761
773 Ga0209025_1026749
774 Ga0209025_1051563
775 Ga0209564_1001043
776 Ga0209564_1002864
777 Ga0209564_1008504
778 Ga0209564_1014648
779 Ga0209564_1031667
780 Ga0209758_1000570
781 Ga0209758_1006484
782 Ga0209758_1007025
783 Ga0209758_1016409
784 Ga0209758_1019452
785 Ga0209758_1064411
786 Ga0209050_1003271
787 Ga0209256_1000510
788 Ga0209256_1002448
789 Ga0209256_1002711
790 Ga0209256_1018454
791 Ga0207426_1000246
792 Ga0207426_1000348
793 Ga0207426_1000595
794 Ga0209051_1001505
795 Ga0209051_1007759
796 Ga0209051_1052047
797 Ga0209257_1000989
798 Ga0207655_1141951
799 Ga0207647_10101120
800 Ga0207647_10116537
801 Ga0207695_10000044
802 Ga0207671_10000226
803 Ga0207681_10189983
804 Ga0207644_10302939
805 Ga0207709_10100753
806 Ga0207711_10059397
807 Ga0207711_11699863
808 Ga0207667_10286231
809 Ga0207712_10078997
810 Ga0207668_10019406
811 Ga0207668_10323406
812 Ga0207640_10398768
813 Ga0207658_10718232
814 Ga0207639_11261164
815 Ga0207678_10686569
816 Ga0207676_10505069
817 Ga0207698_10263735
818 Ga0209281_1000028
819 Ga0209371_1000037
820 Ga0209371_1001349
821 Ga0209282_1004745
822 Ga0209813_10001984
823 Ga0209813_10038445
824 Ga0209813_10058282
825 Ga0268266_10002167
826 Ga0268266_10025844
827 Ga0268266_10112804
828 Ga0268266_10151336
829 Ga0268256_1000039
830 Ga0268256_1002379
831 Ga0316181_1149997
832 Ga0265328_10000031
833 Ga0265316_10282486
834 Ga0307513_10030299
835 Ga0307413_10314936
836 Ga0307409_100825934
837 Ga0373946_0385991
838 Ga0373935_0034213
839 Ga0373927_0000135
840 Ga0373925_0001153
841 Ga0395905_0244747
842 Ga0395901_0333882
843 Ga0451787_136136
844 Ga0451791_1908955
845 Ga0451800_0570848
846 Ga0451835_0077690
847 Ga0451835_0079194
848 Ga0451837_1731566
849 Ga0451839_1454183
850 Ga0451839_1536402
851 Ga0451841_0383686
852 Ga0451845_0073473
853 Ga0451847_0361612
854 Ga0451849_0905216
855 Ga0451851_0756758
856 Ga0451843_1300582
857 Ga0451855_0546513
858 Ga0451855_1129947
859 Ga0451853_1938628
860 Ga0450908_092008
861 Ga0466970_0464581
862 Ga0466957_0028365
863 Ga0495617_173022
864 Ga0495638_0001266
865 Ga0495638_0064120
866 Ga0495650_0126521
867 Ga0495605_0001289
868 Ga0495605_0445372
869 Ga0495584_0234090
870 Ga0495585_0003047
871 Ga0495585_0038007
872 Ga0495607_0131607
873 Ga0495607_0413435
874 Ga0495583_0041751
875 Ga0495583_0110732
876 Ga0495583_0366528
877 Ga0495606_0002374
878 Ga0495606_0067795
879 Ga0495606_0165310
880 Ga0495606_0349389
881 Ga0495610_0110516
882 Ga0495616_0002338
883 Ga0495616_0457342
884 Ga0495620_0033384
885 Ga0495620_0253058
886 Ga0495631_0010452
887 Ga0495631_0291382
888 Ga0495631_0503520
889 Ga0495632_0005370
890 Ga0495632_0038801
891 Ga0495637_0314748
892 Ga0495637_0331479
893 Ga0495643_0004293
894 Ga0495643_0130492
895 Ga0495643_0293927
896 Ga0495654_0351361
897 Ga0495609_0031791
898 Ga0495609_0108353
899 Ga0495597_0026461
900 Ga0495633_0023921
901 Ga0495633_0030028
902 Ga0495656_0174590
903 Ga0495611_0025215
904 Ga0495611_0474489
905 Ga0495625_0006348
906 Ga0495625_0763429
907 Ga0495661_0077789
908 Ga0495661_0269611
909 Ga0495588_0000643
910 Ga0495588_0342229
911 Ga0495671_0409918
912 Ga0495649_0455530
913 Ga0495660_0073135
914 Ga0495660_0287067
915 Ga0495636_0515730
916 Ga0495672_0005051
917 Ga0495677_0117824
918 Ga0495673_0334799
919 Ga0495681_0068794
920 Ga0495681_0078383
921 Ga0495686_0002454
922 Ga0495686_0020483
923 Ga0495686_0127075
924 Ga0495615_0023372
925 Ga0496102_0055407
926 Ga0496103_0017929
927 Ga0496104_1159250
928 Ga0496105_0329330
929 Ga0496106_0070383
930 Ga0496106_1468227
931 Ga0496112_0691312
932 Ga0496113_0124914
933 Ga0496113_0203924
934 Ga0496116_0007780
935 Ga0496116_0018079
936 Ga0496116_0044467
937 Ga0496116_0245130
938 Ga0496117_0000031
939 Ga0496117_0088284
940 Ga0496117_0316560
941 Ga0496118_0001884
942 Ga0496118_0004259
943 Ga0496118_0075819
944 Ga0496118_0091414
945 Ga0496119_0006784
946 Ga0496120_0001817
947 Ga0496120_0006387
948 Ga0496120_0010675
949 Ga0496120_0115401
950 Ga0496121_0000034
951 Ga0496121_0005856
952 Ga0496121_0009335
953 Ga0496121_0060592
954 Ga0496121_0110757
955 Ga0496121_0286878
956 Ga0496121_0548778
957 Ga0496121_0675936
958 Ga0496121_0727660
959 Ga0496122_0000023
960 Ga0496122_0043012
961 Ga0496122_0111527
962 Ga0496123_0000027
963 Ga0496123_0044540
964 Ga0496123_0142055
965 Ga0496124_0048776
966 Ga0496124_0050758
967 Ga0496124_0084209
968 Ga0496124_0222435
969 Ga0496124_0469570
970 Ga0496125_0000030
971 Ga0496125_0029644
972 Ga0496125_0039838
973 Ga0496125_0046495
974 Ga0496126_0165011
975 Ga0496126_0179292
976 Ga0496126_0777725
977 Ga0496126_1347516
978 Ga0495682_0341973
979 Ga0501032_0712091
980 Ga0501033_0318985
981 Ga0501036_0189357
982 Ga0501037_0218036
983 Ga0501038_0057586
984 Ga0501039_0049919
985 Ga0501047_0702695
986 Ga0501048_0930197
987 Ga0501068_0404956
988 Ga0501073_0071672
989 Ga0501238_004053
990 Ga0501083_0045788
991 Ga0501035_0000316
992 Ga0501035_0521627
993 Ga0501044_0073462
994 nmdc:mga03683_110939_c1
995 nmdc:mga03683_9220_c1
996 nmdc:mga03n38_111503_c1
997 nmdc:mga03n38_126866_c1
998 nmdc:mga03n38_559789_c1
999 nmdc:mga03n38_634325_c1
1000 nmdc:mga00v17_27918_c1
1001 nmdc:mga00v17_3198_c2
1002 nmdc:mga00v17_406685_c1
1003 nmdc:mga00v17_516391_c1
1004 nmdc:mga00v17_52201_c1
1005 nmdc:mga0yw44_8555_c1
1006 nmdc:mga0k408_13981_c1
1007 nmdc:mga06z11_4609_c1
1008 nmdc:mga06z11_501464_c1
1009 nmdc:mga06z11_84663_c1
1010 nmdc:mga07m45_31424_c1
1011 nmdc:mga07m45_541309_c1
1012 nmdc:mga07m45_790593_c1
1013 nmdc:mga0sz30_139877_c1
1014 nmdc:mga0sz30_40405_c1
1015 Ga0500610_0056659
1016 Ga0500578_0232135
1017 Ga0500651_0429715
1018 Ga0500651_0524398
1019 Ga0500651_0779548
1020 Ga0500650_0097631
1021 Ga0500557_123611
1022 Ga0500560_104057
1023 Ga0500569_078712
1024 Ga0500608_308954
1025 Ga0500618_000862
1026 Ga0500618_001516
1027 Ga0500618_092790
1028 Ga0500628_015372
1029 Ga0500642_0274272
1030 Ga0500658_0000281
1031 Ga0500559_0549247
1032 Ga0500561_0000530
1033 Ga0500568_0001609
1034 Ga0500577_0050226
1035 Ga0500616_0002690
1036 Ga0500616_0033085
1037 Ga0500624_000401
1038 Ga0500627_0076335
1039 Ga0500636_0367780
1040 Ga0500645_097303
1041 Ga0500609_054734
1042 Ga0587068_016060
1043 Ga0501082_0466143
1044 2842511752
1045 2509389461
1046 2510135197
1047 2511133829
1048 2513571574
1049 2513578614
1050 2513598154
1051 2513630203
1052 2513711299
1053 2514019344
1054 2515114352
1055 2515636271
1056 2515643235
1057 2515741540
1058 2517037995
1059 2517078263
1060 2517408587
1061 2520379658
1062 2530647397
1063 2537876633
1064 2554248822
1065 2559295910
1066 2585271618
1067 2585280681
1068 2585531615
1069 2585540731
1070 2585551438
1071 2585563142
1072 2585820787
1073 2585839000
1074 2585902807
1075 2585907361
1076 2587982645
1077 2599603298
1078 2599720285
1079 2601610796
1080 2601747570
1081 2616296361
1082 2643921435
1083 2644240552
1084 2644521488
1085 2719182915
1086 2719387622
1087 2719733632
1088 2720493678
1089 2720615133
1090 2720621926
1091 2720633276
1092 2720776975
1093 2721149027
1094 2721160425
1095 2721165840
1096 2721401256
1097 2722842010
1098 2723028574
1099 2723562176
1100 2723568879
1101 2724040070
1102 2724046388
1103 2724091582
1104 2724106144
1105 2724111949
1106 2725947485
1107 2730109510
1108 2730166150
1109 2730300057
1110 2739037227
1111 2766064324
1112 2776915432
1113 2793295682
1114 2793320665
1115 2793327231
1116 2793332182
1117 2793338761
1118 2793346552
1119 2793353913
1120 2793365853
1121 2805926160
1122 2805937187
1123 2806047318
1124 2806054173
1125 2806060243
1126 2806068854
1127 2806077203
1128 2808988266
1129 2819560920
1130 2819638868
1131 2821128673
1132 2838018383
1133 2838024067
1134 2838048421
1135 2838050755
1136 2838062520
1137 2838072072
1138 2838672869
1139 2838678717
1140 2838690227
1141 2838705653
1142 2838718194
1143 2838723014
1144 2838728261
1145 2838732002
1146 2838741690
1147 2838744898
1148 2841845476
1149 2841850570
1150 2841855955
1151 2841867810
1152 2842116912
1153 2842128920
1154 2842133609
1155 2842145179
1156 2842149983
1157 2842155479
1158 2842161125
1159 2842166643
1160 2842174564
1161 2842179223
1162 2842184741
1163 2842190618
1164 2842194938
1165 2842201661
1166 2842207366
1167 2842215058
1168 2842221727
1169 2842227779
1170 2842232324
1171 2842246739
1172 2842255333
1173 2842261159
1174 2842269586
1175 2842274247
1176 2842280923
1177 2842288461
1178 2842305906
1179 2842311359
1180 2842321055
1181 2842346634
1182 2842366324
1183 2842406193
1184 2842412778
1185 2842419343
1186 2842425704
1187 2842433544
1188 2842439872
1189 2842446501
1190 2842448832
1191 2842467825
1192 2842474481
1193 2842491108
1194 2842498445
1195 2844457075
1196 2852391652
1197 2857534174
1198 2899795276
1199 2899808083
1200 2899849257
1201 2919118548
1202 2926755078
1203 2929141820
1204 2933010671
1205 2933015655
1206 2933572411
1207 2933593084
1208 2933597604
1209 2933603074
1210 2935903685
1211 2936369835
1212 2936379022
1213 2979092492
1214 2979100117
1215 2979104463
1216 2984513741
1217 2984522681
1218 2984541987
1219 2984601417
1220 2996890190
1221 2996895231
1222 639650382
1223 650741124
1224 8003573817
1225 8005262374
1226 8005282376
1227 8005286800
1228 8005295033
1229 8005313648
1230 8005324717
1231 8005381620
1232 8005387825
1233 8005400861
1234 8005431053
1235 8005465043
1236 8005497622
1237 8005561116
1238 8005565742
1239 8005571794
1240 8005623356
1241 8005631064
1242 8005669027
1243 8005694391
1244 8018128862
1245 8018155024
1246 8018177094
1247 8023686486
1248 8024484314
1249 8024490805
1250 8024502381
1251 8046768072
1252 8055435645
1253 8056380362
1254 8056385192
1255 8057581569
1256 8057879234

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02594

DUF167

Uncharacterised ACR, YggU family COG1872

7

84

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1n91-assembly1.cif.gz_A solution nmr structure of protein yggu from escherichia coli. northeast structural genomics consortium target er14. 0.7288 4 99
1yh5-assembly1.cif.gz_A solution nmr structure of protein yggu from escherichia coli. northeast structural genomics consortium target er14. 0.7226 4 100
1n91-assembly1.cif.gz_A solution nmr structure of protein yggu from escherichia coli. northeast structural genomics consortium target er14. 0.6795 4 99
1yh5-assembly1.cif.gz_A solution nmr structure of protein yggu from escherichia coli. northeast structural genomics consortium target er14. 0.6682 4 100
6n1k-assembly1.cif.gz_C full-length human phenylalanine hydroxylase (pah) in the resting state 0.5708 57 99
ID Description Score Start End Superfamily
af_Q58035_1_98_3.30.1200.10 Alpha Beta;2-Layer Sandwich;Conserved Hypothetical Protein Mth637; Chain: A;;YggU-like 0.8732 4 99 3.30.1200.10
af_B7EHD8_35_125_3.30.1200.10 Alpha Beta;2-Layer Sandwich;Conserved Hypothetical Protein Mth637; Chain: A;;YggU-like 0.8606 10 99 3.30.1200.10
af_Q8IKR0_45_147_3.30.1200.10 Alpha Beta;2-Layer Sandwich;Conserved Hypothetical Protein Mth637; Chain: A;;YggU-like 0.8564 4 99 3.30.1200.10
af_I1NJE4_134_231_3.30.1200.10 Alpha Beta;2-Layer Sandwich;Conserved Hypothetical Protein Mth637; Chain: A;;YggU-like 0.8408 4 98 3.30.1200.10
af_X1WD69_65_162_3.30.1200.10 Alpha Beta;2-Layer Sandwich;Conserved Hypothetical Protein Mth637; Chain: A;;YggU-like 0.8288 5 103 3.30.1200.10
ID Description Score Start End GO Terms
AF-A0A258CFB5-F1-model_v4 deleted 0.9904 13 85
AF-A0A527IIW3-F1-model_v4 deleted 0.9897 1 89
AF-A0A5B8FR45-F1-model_v4 UPF0235 protein FDP22_03025 0.9888 1 99
AF-A0A516GYP4-F1-model_v4 UPF0235 protein FNB15_04750 0.986 2 100
AF-A0A4R9RRQ3-F1-model_v4 deleted 0.986 1 99

Map