F470784

General Info

Members Datasets Scaffolds Average Seq Length
629 516 1258 375

Family's Representative Sequence

Representative Sequence 3300053156|Ga0500622_0001210|Ga0500622_0001210_16172_17395
Length 407
Sequence LTFSFALRGPAAGKPSDLFPDHHAQPLKDTKMNDNIISSTVIIGAGIFGVSTGLQLARRGIRVTIVNDGPPANGASGRSLSWLNSARMRSKPYHLLRMAGIDRYRTLAARNPDADWLRFEGGLTWDAEGEGNEIVLAFDYETSIGYDAQHLSSDQIASVTPGVDARSVTSPGAIFNPGEGWVDLPRLIGHLLEEFVTLGGVLITDQGKARVVVEGGRAIGVETTSGSRFKADSVLLATGPAVPEMAADSGQTIGDGTPIALLVQTKPLDHALKAVLNTPRVAVRPAPDGTLSLDADWAADQGVKINPDGSYEIDHSVVAALLEEASKVLEGNPKLEVASIGVGGKPIPGDGEPVLGAFKAIAGYHVAFSHSGATLGLIVGELQAFEIATGREHPMLASFRPERFAVH

Samples

Sample ID Description Type Environment
1 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
17 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
40 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
46 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
53 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
54 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
55 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
56 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
57 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
58 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
59 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
60 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
61 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
62 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
63 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
66 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
67 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
68 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
72 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
74 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
90 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
92 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
95 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
96 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
97 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
98 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
101 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
106 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
107 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
108 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
109 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
110 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
111 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
112 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
113 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
114 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
115 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
116 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
117 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
118 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
119 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
120 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
121 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
122 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
123 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
124 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
125 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
126 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
127 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
128 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
129 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
130 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
131 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
132 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
133 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
134 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
135 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
136 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
137 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
138 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
139 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
140 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
141 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
142 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
143 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
144 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
145 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
146 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
147 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
148 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
149 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
150 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
153 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
154 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
155 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
156 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
157 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
158 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
159 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
160 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
161 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
162 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
163 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
164 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
165 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
166 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
167 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
168 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
169 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
170 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
171 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
172 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
173 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
174 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
175 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
176 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
177 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
178 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
179 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
180 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
181 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
182 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
183 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
184 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
185 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
186 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
187 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
188 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
189 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
190 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
191 2509276019 Ensifer aridi TW10 Isolate Nodule
192 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
193 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
194 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
195 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
196 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
197 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
198 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
199 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
200 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
201 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
202 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
203 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
204 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
205 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
206 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
207 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
208 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
209 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
210 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
211 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
212 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
213 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
214 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
215 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
216 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
217 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
218 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
219 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
220 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
221 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
222 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
223 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
224 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
225 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
226 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
227 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
228 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
229 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
230 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
231 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
232 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
233 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
234 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
235 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
236 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
237 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
238 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
239 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
240 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
241 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
242 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
243 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
244 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
245 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
246 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
247 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
248 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
249 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
250 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
251 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
252 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
253 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
254 2643221568 Rhizobium sp. Root564 Isolate Unclassified
255 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
256 2643221693 Rhizobium sp. Root491 Isolate Unclassified
257 2643221718 Rhizobium sp. Root268 Isolate Unclassified
258 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
259 2718217882 Rhizobium sp. N741 Isolate Nodule
260 2718217927 Rhizobium sp. N324 Isolate Nodule
261 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
262 2718218009 Rhizobium sp. N561 Isolate Nodule
263 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
264 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
265 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
266 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
267 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
268 2718218363 Rhizobium sp. N113 Isolate Nodule
269 2718218366 Rhizobium sp. N621 Isolate Nodule
270 2718218423 Rhizobium sp. N941 Isolate Nodule
271 2721755514 Rhizobium sp. N6212 Isolate Nodule
272 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
273 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
274 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
275 2721755809 Rhizobium sp. N541 Isolate Nodule
276 2721755810 Rhizobium sp. N871 Isolate Nodule
277 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
278 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
279 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
280 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
281 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
282 2728369365 Rhizobium sp. N1341 Isolate Nodule
283 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
284 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
285 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
286 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
287 2773857925 Microvirga vignae BR3299 Isolate Unclassified
288 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
289 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
290 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
291 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
292 2791355260 Rhizobium sp. L9 Isolate Nodule
293 2791355261 Rhizobium sp. J15 Isolate Nodule
294 2791355267 Rhizobium sp. L18 Isolate Nodule
295 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
296 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
297 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
298 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
299 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
300 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
301 2802429633 Rhizobium anhuiense J3 Isolate Nodule
302 2802429634 Rhizobium anhuiense S10 Isolate Nodule
303 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
304 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
305 2802429637 Rhizobium anhuiense C15 Isolate Nodule
306 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
307 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
308 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
309 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
310 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
311 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
312 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
313 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
314 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
315 2838048938 Rhizobium pisi 27/80 Isolate Nodule
316 2838061910 Rhizobium phaseoli L15 Isolate Nodule
317 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
318 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
319 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
320 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
321 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
322 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
323 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
324 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
325 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
326 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
327 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
328 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
329 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
330 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
331 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
332 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
333 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
334 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
335 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
336 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
337 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
338 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
339 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
340 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
341 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
342 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
343 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
344 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
345 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
346 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
347 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
348 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
349 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
350 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
351 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
352 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
353 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
354 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
355 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
356 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
357 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
358 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
359 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
360 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
361 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
362 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
363 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
364 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
365 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
366 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
367 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
368 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
369 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
370 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
371 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
372 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
373 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
374 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
375 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
376 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
377 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
378 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
379 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
380 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
381 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
382 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
383 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
384 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
385 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
386 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
387 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
388 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
389 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
390 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
391 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
392 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
393 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
394 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
395 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
396 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
397 2909042592 Labrys sp. LIt4 Isolate Nodule
398 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
399 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
400 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
401 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
402 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
403 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
404 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
405 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
406 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
407 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
408 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
409 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
410 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
411 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
412 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
413 2933599457 Rhizobium phaseoli M3 Isolate Nodule
414 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
415 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
416 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
417 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
418 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
419 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
420 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
421 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
422 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
423 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
424 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
425 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
426 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
427 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
428 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
429 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
430 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
431 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
432 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
433 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
434 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
435 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
436 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
437 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
438 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
439 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
440 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
441 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
442 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
443 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
444 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
445 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
446 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
447 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
448 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
449 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
450 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
451 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
452 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
453 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
454 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
455 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
456 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
457 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
458 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
459 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
460 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
461 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
462 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
463 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
464 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
465 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
466 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
467 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
468 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
469 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
470 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
471 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
472 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
473 2996893221 Rhizobium sp. R635 Isolate Nodule
474 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
475 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
476 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
477 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
478 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
479 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
480 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
481 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
482 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
483 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
484 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
485 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
486 8005275841 Rhizobium sp. N4311 Isolate Nodule
487 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
488 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
489 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
490 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
491 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
492 8005382845 Rhizobium sp. R634 Isolate Nodule
493 8005395548 Rhizobium sp. R339 Isolate Nodule
494 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
495 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
496 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
497 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
498 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
499 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
500 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
501 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
502 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
503 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
504 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
505 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
506 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
507 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
508 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
509 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
510 8018176218 Rhizobium sp. N122 Isolate Nodule
511 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
512 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
513 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
514 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
515 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
516 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 47.38
Metatranscriptomes 0
Isolates 52.62

Biome Distribution

Category Percentage (%)
Aerial Root 0.16
Bulb 0
Endosphere 14.94
Nodule 41.34
Rhizoplane 1.43
Rhizosphere 23.53
Stem 0
Stem Tuber 0
Unclassified 0.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500622_0001210 3300053156 Bacteria 21227
2 JGI24740J21852_10000003 3300001979 Bacteria 127453
3 JGI25155J39150_1000015 3300002704 Bacteria 178839
4 JGI25156J39149_1000007 3300002705 Bacteria 252108
5 JGI25162J39368_1000102 3300002737 Bacteria 94155
6 JGI25154J39366_1000051 3300002738 Bacteria 123608
7 JGI25157J39369_1000012 3300002741 Bacteria 205167
8 JGI25157J39369_1000762 3300002741 Bacteria 16721
9 JGI25151J46595_10000444 3300003187 Bacteria 40415
10 JGI25151J46595_10001290 3300003187 Bacteria 17618
11 JGI25165J46597_1000070 3300003214 Bacteria 193557
12 JGI25165J46597_1000116 3300003214 Bacteria 137942
13 JGI25165J46597_1000612 3300003214 Bacteria 30341
14 JGI25153J46596_10000897 3300003215 Bacteria 18117
15 JGI25153J46596_10009492 3300003215 Bacteria 4511
16 rootH1_10004271 3300003316 Bacteria 10758
17 rootH2_10014980 3300003320 Bacteria 12651
18 rootH2_10151544 3300003320 Bacteria 11000
19 rootL2_10006749 3300003322 Bacteria 38317
20 rootL2_10134058 3300003322 Bacteria 2762
21 rootH1_10054683 3300003323 Bacteria 13350
22 rootH1_10080337 3300003323 Bacteria 6156
23 rootH1_10135457 3300003323 Bacteria 2067
24 JGI25160J50197_1000496 3300003354 Bacteria 23489
25 JGI25161J50226_1007288 3300003374 Bacteria 1876
26 Ga0055542_1000905 3300003762 Bacteria 20234
27 Ga0055526_1000809 3300003771 Bacteria 23323
28 Ga0055526_1001440 3300003771 Bacteria 16926
29 Ga0055524_1001162 3300003775 Bacteria 15770
30 Ga0055524_1032928 3300003775 Bacteria 1459
31 Ga0055528_1000187 3300003790 Bacteria 52646
32 Ga0055528_1001094 3300003790 Bacteria 17813
33 Ga0055528_1005405 3300003790 Bacteria 5956
34 Ga0055540_1000199 3300003792 Bacteria 58155
35 Ga0058692_1000497 3300003856 Bacteria 17453
36 Ga0065165_1000410 3300005262 Bacteria 68475
37 Ga0065165_1003887 3300005262 Bacteria 9891
38 Ga0065165_1016315 3300005262 Bacteria 2787
39 Ga0070658_10143905 3300005327 Bacteria 1993
40 Ga0070670_100002142 3300005331 Bacteria 16207
41 Ga0070663_100029841 3300005455 Bacteria 3731
42 Ga0068867_100147069 3300005459 Bacteria 1848
43 Ga0070665_100006966 3300005548 Bacteria 11493
44 Ga0070665_100049158 3300005548 Bacteria 4232
45 Ga0068855_100225910 3300005563 Bacteria 2098
46 Ga0068854_100144279 3300005578 Bacteria 1830
47 Ga0068856_100005528 3300005614 Bacteria 12447
48 Ga0068852_100035683 3300005616 Bacteria 4150
49 Ga0068852_100122034 3300005616 Bacteria 2388
50 Ga0070717_10185371 3300006028 Bacteria 1816
51 Ga0075365_10000813 3300006038 Bacteria 12847
52 Ga0075363_100051488 3300006048 Bacteria 2196
53 Ga0075363_100104086 3300006048 Bacteria 1573
54 Ga0075364_10093966 3300006051 Bacteria 1992
55 Ga0075364_10156492 3300006051 Bacteria 1537
56 Ga0075362_10004288 3300006177 Bacteria 5100
57 Ga0075367_10005973 3300006178 Bacteria 6115
58 Ga0075369_10006688 3300006186 Bacteria 4371
59 Ga0099826_10000042 3300006948 Bacteria 92895
60 Ga0105240_10000557 3300009093 Bacteria 69103
61 Ga0105241_10142880 3300009174 Bacteria 1951
62 Ga0105237_10000934 3300009545 Bacteria 39322
63 Ga0105238_10013525 3300009551 Bacteria 8240
64 Ga0123341_1000008 3300009765 Bacteria 134834
65 Ga0123342_1005172 3300009766 Bacteria 19226
66 Ga0105239_10002364 3300010375 Bacteria 24049
67 Ga0105239_10022679 3300010375 Bacteria 6921
68 Ga0105239_10024535 3300010375 Bacteria 6644
69 Ga0105239_10037032 3300010375 Bacteria 5351
70 Ga0105239_10049296 3300010375 Bacteria 4618
71 Ga0157373_10003996 3300013100 Bacteria 11123
72 Ga0157371_10001149 3300013102 Bacteria 28495
73 Ga0157371_10009423 3300013102 Bacteria 7685
74 Ga0157370_10001937 3300013104 Bacteria 25489
75 Ga0157370_10002940 3300013104 Bacteria 20281
76 Ga0157370_10071799 3300013104 Bacteria 3267
77 Ga0157369_10072347 3300013105 Bacteria 3700
78 Ga0171463_1002 3300013249 Bacteria 1274851
79 Ga0182007_10002542 3300015262 Bacteria 8980
80 Ga0182005_1002005 3300015265 Bacteria 7643
81 Ga0183363_1092 3300015690 Bacteria 26253
82 Ga0214542_1030568 3300021321 Bacteria 2085
83 Ga0214543_1000351 3300021327 Bacteria 74129
84 Ga0228711_1000056 3300022739 Bacteria 78987
85 Ga0209435_100006 3300025206 Bacteria 542459
86 Ga0209437_100022 3300025233 Bacteria 625694
87 Ga0209437_100128 3300025233 Bacteria 190300
88 Ga0209646_1000015 3300025246 Bacteria 542459
89 Ga0209026_1000046 3300025250 Bacteria 262031
90 Ga0209026_1000420 3300025250 Bacteria 36034
91 Ga0209677_100544 3300025253 Bacteria 20986
92 Ga0209148_1000056 3300025254 Bacteria 363380
93 Ga0209759_1000005 3300025256 Bacteria 542459
94 Ga0209759_1000149 3300025256 Bacteria 120932
95 Ga0209129_1000554 3300025258 Bacteria 25822
96 Ga0209233_1000031 3300025261 Bacteria 624646
97 Ga0209233_1000072 3300025261 Bacteria 363074
98 Ga0209233_1000131 3300025261 Bacteria 205257
99 Ga0209233_1000311 3300025261 Bacteria 55820
100 Ga0209455_1000214 3300025272 Bacteria 81374
101 Ga0209455_1003633 3300025272 Bacteria 5360
102 Ga0209455_1019256 3300025272 Unclassified 1384
103 Ga0209673_1000022 3300025273 Bacteria 413125
104 Ga0209673_1001359 3300025273 Bacteria 24265
105 Ga0209673_1002057 3300025273 Bacteria 15206
106 Ga0209673_1013501 3300025273 Bacteria 3218
107 Ga0209130_1000130 3300025284 Bacteria 121749
108 Ga0209130_1000537 3300025284 Bacteria 38152
109 Ga0209025_1000190 3300025294 Bacteria 153726
110 Ga0209025_1000609 3300025294 Bacteria 64308
111 Ga0209564_1000163 3300025295 Bacteria 162077
112 Ga0209564_1001179 3300025295 Bacteria 30321
113 Ga0209758_1000734 3300025297 Bacteria 47906
114 Ga0209758_1000847 3300025297 Bacteria 42599
115 Ga0209758_1001204 3300025297 Bacteria 32572
116 Ga0209050_1001943 3300025298 Bacteria 19624
117 Ga0209256_1000551 3300025299 Bacteria 53825
118 Ga0209256_1002296 3300025299 Bacteria 16079
119 Ga0207426_1000109 3300025302 Bacteria 238665
120 Ga0207426_1000196 3300025302 Bacteria 146687
121 Ga0207426_1005853 3300025302 Bacteria 5489
122 Ga0209051_1000359 3300025303 Bacteria 67167
123 Ga0209051_1007092 3300025303 Bacteria 6195
124 Ga0209257_1002168 3300025304 Bacteria 20350
125 Ga0207705_10059125 3300025909 Bacteria 2766
126 Ga0207695_10000646 3300025913 Bacteria 69276
127 Ga0207671_10001180 3300025914 Bacteria 31086
128 Ga0207694_10236225 3300025924 Bacteria 1493
129 Ga0207650_10007325 3300025925 Bacteria 7514
130 Ga0207667_10244298 3300025949 Bacteria 1837
131 Ga0207640_10042905 3300025981 Bacteria 2887
132 Ga0207639_10016765 3300026041 Bacteria 5189
133 Ga0207678_10022686 3300026067 Bacteria 5497
134 Ga0207702_10169462 3300026078 Bacteria 2001
135 Ga0209281_1000272 3300027111 Bacteria 99700
136 Ga0209371_1000191 3300027312 Bacteria 89915
137 Ga0209371_1001558 3300027312 Bacteria 15110
138 Ga0209282_1000055 3300027666 Bacteria 101018
139 Ga0209282_1000065 3300027666 Bacteria 91676
140 Ga0209813_10013263 3300027866 Bacteria 2197
141 Ga0268266_10033360 3300028379 Bacteria 4376
142 Ga0268266_10169753 3300028379 Bacteria 1979
143 Ga0268266_10251466 3300028379 Bacteria 1635
144 Ga0307515_10001999 3300028794 Bacteria 45141
145 Ga0307515_10010173 3300028794 Bacteria 18064
146 Ga0307515_10019373 3300028794 Bacteria 12255
147 Ga0307515_10069836 3300028794 Bacteria 4792
148 Ga0268256_1000028 3300030500 Bacteria 433179
149 Ga0268256_1009209 3300030500 Bacteria 3308
150 Ga0316181_1223021 3300030744 Bacteria 3435
151 Ga0307410_10108681 3300031852 Bacteria 2003
152 Ga0307410_10274098 3300031852 Bacteria 1321
153 Ga0307410_10352505 3300031852 Bacteria 1176
154 Ga0315914_1000095 3300031967 Bacteria 74092
155 Ga0307416_100073414 3300032002 Bacteria 2852
156 Ga0307416_100091150 3300032002 Bacteria 2617
157 Ga0315913_1000019 3300033430 Bacteria 100387
158 Ga0315915_1000023 3300033464 Bacteria 119157
159 Ga0395900_0013265 3300037418 Bacteria 8424
160 Ga0395900_0212046 3300037418 Bacteria 1955
161 Ga0395905_0012141 3300037471 Bacteria 8299
162 Ga0395905_0015868 3300037471 Bacteria 7155
163 Ga0395905_0267742 3300037471 Bacteria 1594
164 Ga0395905_0285742 3300037471 Bacteria 1536
165 Ga0395901_0075442 3300038443 Bacteria 3517
166 Ga0439465_0013137 3300041413 Bacteria 2585
167 Ga0451833_0902581 3300041491 Bacteria 1368
168 Ga0451833_1209899 3300041491 Bacteria 1718
169 Ga0451835_0139667 3300041492 Bacteria 3216
170 Ga0451839_0079019 3300041496 Bacteria 2766
171 Ga0451839_0446666 3300041496 Bacteria 1397
172 Ga0451841_0231425 3300041498 Bacteria 2159
173 Ga0451841_0862854 3300041498 Bacteria 1428
174 Ga0451847_0686684 3300041503 Bacteria 2444
175 Ga0451849_1056793 3300041505 Bacteria 2693
176 Ga0451851_0122269 3300041507 Bacteria 2845
177 Ga0451851_0714427 3300041507 Bacteria 2314
178 Ga0451851_0959637 3300041507 Bacteria 1454
179 Ga0451843_0041261 3300041509 Bacteria 1959
180 Ga0451855_0223423 3300041511 Bacteria 1677
181 Ga0451855_0728288 3300041511 Bacteria 2077
182 Ga0451855_1242750 3300041511 Bacteria 1521
183 Ga0451853_1921654 3300041512 Bacteria 4216
184 Ga0439431_0009617 3300041997 Bacteria 2184
185 Ga0439449_0002605 3300042007 Bacteria 7035
186 Ga0439449_0008270 3300042007 Bacteria 3958
187 Ga0466966_0049244 3300044684 Bacteria 2684
188 Ga0466970_0016387 3300044765 Bacteria 3819
189 Ga0466957_0036505 3300044842 Bacteria 2955
190 Ga0466958_0106352 3300045836 Bacteria 1749
191 Ga0495617_010196 3300046452 Bacteria 3218
192 Ga0495638_0006868 3300046460 Bacteria 8215
193 Ga0495638_0012404 3300046460 Bacteria 5844
194 Ga0495638_0031893 3300046460 Bacteria 3383
195 Ga0495650_0021433 3300046471 Bacteria 3124
196 Ga0495605_0032435 3300046474 Bacteria 2659
197 Ga0495585_0035553 3300046492 Bacteria 2814
198 Ga0495607_0073944 3300046501 Bacteria 1893
199 Ga0495583_0062549 3300046506 Bacteria 1657
200 Ga0495610_0067084 3300046512 Bacteria 1687
201 Ga0495610_0091992 3300046512 Bacteria 1373
202 Ga0495631_0006886 3300046518 Bacteria 5832
203 Ga0495632_0016940 3300046519 Bacteria 4038
204 Ga0495632_0024075 3300046519 Bacteria 3240
205 Ga0495643_0007717 3300046522 Bacteria 6893
206 Ga0495643_0091301 3300046522 Bacteria 1570
207 Ga0495654_0028888 3300046530 Bacteria 2832
208 Ga0495654_0072701 3300046530 Bacteria 1627
209 Ga0495609_0024438 3300046538 Bacteria 2772
210 Ga0495597_0009535 3300046542 Bacteria 4789
211 Ga0495622_0003445 3300046557 Bacteria 7454
212 Ga0495668_0020378 3300046616 Bacteria 3814
213 Ga0495668_0022199 3300046616 Bacteria 3629
214 Ga0495668_0067072 3300046616 Bacteria 1974
215 Ga0495625_0001663 3300046660 Bacteria 26041
216 Ga0495625_0059610 3300046660 Bacteria 2707
217 Ga0495588_0001443 3300046674 Bacteria 10177
218 Ga0495588_0067995 3300046674 Bacteria 1850
219 Ga0495670_0087274 3300046691 Bacteria 1594
220 Ga0495649_0014426 3300046694 Bacteria 4530
221 Ga0495649_0068976 3300046694 Bacteria 1897
222 Ga0495600_0021915 3300046809 Bacteria 4097
223 Ga0495604_0000217 3300047317 Bacteria 52754
224 Ga0495687_036337 3300047443 Bacteria 2205
225 Ga0495681_0010267 3300047470 Bacteria 5677
226 Ga0495681_0022662 3300047470 Bacteria 3355
227 Ga0495686_0021452 3300047472 Bacteria 4289
228 Ga0495602_0222724 3300048088 Bacteria 1423
229 Ga0495615_0013235 3300048090 Bacteria 1720
230 Ga0496100_0007998 3300048903 Bacteria 5873
231 Ga0496102_0021087 3300048905 Bacteria 5762
232 Ga0496113_0173258 3300048916 Bacteria 1709
233 Ga0496116_0000042 3300048919 Bacteria 330516
234 Ga0496116_0011189 3300048919 Bacteria 7455
235 Ga0496117_0009344 3300048920 Bacteria 9136
236 Ga0496117_0135966 3300048920 Bacteria 1481
237 Ga0496118_0003854 3300048921 Bacteria 18431
238 Ga0496118_0007828 3300048921 Bacteria 11207
239 Ga0496118_0014846 3300048921 Bacteria 7257
240 Ga0496118_0087824 3300048921 Bacteria 2154
241 Ga0496119_0004001 3300048922 Bacteria 14917
242 Ga0496119_0023271 3300048922 Bacteria 4402
243 Ga0496120_0000509 3300048923 Bacteria 60589
244 Ga0496120_0002794 3300048923 Bacteria 16912
245 Ga0496120_0005453 3300048923 Bacteria 10146
246 Ga0496120_0033126 3300048923 Bacteria 3108
247 Ga0496121_0002458 3300048924 Bacteria 28284
248 Ga0496121_0051627 3300048924 Bacteria 3461
249 Ga0496121_0225848 3300048924 Bacteria 1315
250 Ga0496122_0000195 3300048925 Bacteria 138274
251 Ga0496122_0000365 3300048925 Bacteria 97184
252 Ga0496122_0011415 3300048925 Bacteria 8998
253 Ga0496122_0011714 3300048925 Bacteria 8837
254 Ga0496122_0033177 3300048925 Bacteria 4253
255 Ga0496123_0000153 3300048926 Bacteria 140053
256 Ga0496123_0000298 3300048926 Bacteria 97184
257 Ga0496123_0000664 3300048926 Bacteria 56865
258 Ga0496123_0005018 3300048926 Bacteria 13549
259 Ga0496123_0035926 3300048926 Bacteria 3523
260 Ga0496124_0005087 3300048927 Bacteria 14983
261 Ga0496124_0017093 3300048927 Bacteria 6857
262 Ga0496124_0029473 3300048927 Bacteria 4889
263 Ga0496125_0006443 3300048928 Bacteria 12689
264 Ga0496125_0017609 3300048928 Bacteria 6806
265 Ga0496125_0174231 3300048928 Bacteria 1442
266 Ga0496126_0000053 3300048929 Bacteria 311989
267 Ga0496126_0120054 3300048929 Bacteria 2281
268 Ga0496126_0229564 3300048929 Bacteria 1555
269 Ga0501068_0230808 3300049584 Bacteria 1177
270 Ga0501241_004221 3300049758 Bacteria 2698
271 nmdc:mga03683_2407_c1 3300050489 Bacteria 5807
272 nmdc:mga00v17_24_c1 3300050491 Bacteria 102283
273 nmdc:mga0yw44_2177_c1 3300050492 Bacteria 8228
274 nmdc:mga0yw44_28064_c1 3300050492 Bacteria 3234
275 nmdc:mga0yw44_31218_c1 3300050492 Bacteria 3096
276 nmdc:mga06z11_18240_c1 3300050494 Bacteria 3201
277 nmdc:mga06z11_2254_c1 3300050494 Bacteria 7333
278 nmdc:mga04h51_13801_c1 3300050495 Bacteria 2296
279 nmdc:mga07m45_37128_c1 3300050496 Bacteria 2717
280 nmdc:mga0sz30_16212_c1 3300050516 Bacteria 2955
281 Ga0500578_0039672 3300053086 Bacteria 3025
282 Ga0500644_0004321 3300053088 Bacteria 3550
283 Ga0500557_001343 3300053105 Bacteria 3947
284 Ga0500560_000555 3300053107 Bacteria 5343
285 Ga0500569_002026 3300053109 Bacteria 3940
286 Ga0500595_044976 3300053119 Bacteria 1397
287 Ga0500608_059554 3300053122 Bacteria 1827
288 Ga0500618_005640 3300053125 Bacteria 3775
289 Ga0500658_0000495 3300053134 Bacteria 16801
290 Ga0500658_0016758 3300053134 Bacteria 2732
291 Ga0500658_0053087 3300053134 Bacteria 1662
292 Ga0500659_0072052 3300053135 Bacteria 1829
293 Ga0500561_0000102 3300053137 Bacteria 16489
294 Ga0500568_0000401 3300053139 Bacteria 33106
295 Ga0500590_000296 3300053148 Bacteria 15848
296 Ga0500616_0000615 3300053153 Bacteria 43215
297 Ga0500622_0000290 3300053156 Bacteria 51286
298 Ga0500636_0059946 3300053177 Bacteria 2223
299 2503201097 2503198000 Bacteria 6884444
300 2509079946 2508501114 Bacteria 7082538
301 2509116409 2508501123 Bacteria 6283661
302 2509141957 2508501127 Bacteria 7037543
303 2509379916 2509276019 Bacteria 6802256
304 2509390641 2509276021 Bacteria 7634384
305 2510136240 2510065019 Bacteria 6903379
306 2510320107 2510065059 Bacteria 6847884
307 2510892742 2510461076 Bacteria 8618824
308 2511135525 2510917022 Bacteria 6504556
309 2511198064 2510917030 Bacteria 7460662
310 2512529609 2512047086 Bacteria 6850303
311 2512975503 2512875026 Bacteria 6861065
312 2513568550 2513237084 Bacteria 7231967
313 2513579352 2513237085 Bacteria 7695351
314 2513605846 2513237089 Bacteria 6553624
315 2513630597 2513237093 Bacteria 7545552
316 2513712054 2513237103 Bacteria 7647401
317 2513914379 2513237144 Bacteria 7530820
318 2513986377 2513237156 Bacteria 6402557
319 2514006854 2513237160 Bacteria 6650282
320 2514018388 2513237162 Bacteria 7468464
321 2514592438 2513237351 Bacteria 6968952
322 2515108831 2515075009 Bacteria 7288508
323 2515611731 2515154107 Bacteria 6795637
324 2515633172 2515154113 Bacteria 7807172
325 2515640378 2515154114 Bacteria 7848616
326 2515656460 2515154116 Bacteria 7552979
327 2515738351 2515154134 Bacteria 7220242
328 2517040768 2516653077 Bacteria 7555578
329 2517080394 2516653085 Bacteria 7346596
330 2517098366 2517093000 Bacteria 7412387
331 2517409856 2517287029 Bacteria 6905599
332 2517567095 2517487022 Bacteria 7227575
333 2524449389 2524023207 Bacteria 6813453
334 2524459272 2524023209 Bacteria 6679728
335 2530649004 2529292951 Bacteria 6916614
336 2535520338 2534681796 Bacteria 7146037
337 2554249661 2554235003 Bacteria 5877155
338 2558864886 2558860100 Bacteria 8458965
339 2559298004 2558860242 Bacteria 5568029
340 2585169188 2582581283 Bacteria 6030556
341 2585222198 2582581298 Bacteria 7315509
342 2585272600 2582581307 Bacteria 6597605
343 2585281165 2582581308 Bacteria 7413247
344 2585327251 2582581315 Bacteria 7318924
345 2585335838 2582581316 Bacteria 7774528
346 2585393558 2582581866 Bacteria 6859583
347 2585526721 2585427526 Bacteria 7258840
348 2585536751 2585427527 Bacteria 7273426
349 2585543201 2585427528 Bacteria 6842387
350 2585544849 2585427529 Bacteria 7395659
351 2585557315 2585427530 Bacteria 7383882
352 2585562268 2585427531 Bacteria 6992870
353 2585841657 2585427593 Bacteria 7141551
354 2585896704 2585427608 Bacteria 6544331
355 2585906565 2585427609 Bacteria 6667127
356 2585993472 2585427633 Bacteria 6413184
357 2586004121 2585427634 Bacteria 6455027
358 2587981987 2585428125 Bacteria 6662905
359 2588515625 2588253730 Bacteria 6881675
360 2599334408 2599185156 Bacteria 5403036
361 2599606338 2599185210 Bacteria 5624189
362 2601612520 2600255279 Bacteria 5605316
363 2601749363 2600255308 Bacteria 5611129
364 2616312257 2615840626 Bacteria 7921970
365 2616552296 2615840698 Bacteria 7319877
366 2643856947 2643221568 Bacteria 5187270
367 2644207947 2643221637 Bacteria 5345260
368 2644519900 2643221693 Bacteria 5513853
369 2644651349 2643221718 Bacteria 5345506
370 2671116903 2667528174 Bacteria 6435400
371 2719184743 2718217882 Bacteria 6556348
372 2719389414 2718217927 Bacteria 6972593
373 2719668739 2718217997 Bacteria 6740740
374 2719728763 2718218009 Bacteria 6478651
375 2720489432 2718218199 Bacteria 6740745
376 2720610104 2718218232 Bacteria 6720332
377 2720617529 2718218233 Bacteria 6662049
378 2720628675 2718218235 Bacteria 6630699
379 2720772625 2718218269 Bacteria 6906114
380 2721144454 2718218363 Bacteria 6524337
381 2721161824 2718218366 Bacteria 6425255
382 2721402182 2718218423 Bacteria 6438183
383 2722842969 2721755514 Bacteria 6424414
384 2723030064 2721755556 Bacteria 6745503
385 2723564469 2721755684 Bacteria 6859907
386 2723569891 2721755685 Bacteria 6704835
387 2724036015 2721755809 Bacteria 6438790
388 2724041788 2721755810 Bacteria 6479005
389 2724092654 2721755819 Bacteria 6906405
390 2724101438 2721755822 Bacteria 6726041
391 2724113038 2721755823 Bacteria 6752556
392 2725949508 2724679232 Bacteria 7646494
393 2730110597 2728369352 Bacteria 6745171
394 2730160858 2728369365 Bacteria 6555560
395 2739035248 2738541333 Bacteria 7106503
396 2753461454 2751185821 Bacteria 6189929
397 2765469006 2765235802 Bacteria 5618596
398 2766069001 2765235942 Bacteria 7445910
399 2774874649 2773857925 Bacteria 6472445
400 2776914916 2775507049 Bacteria 6284736
401 2778177904 2775507266 Bacteria 7392367
402 2792640737 2791355094 Bacteria 7011481
403 2793316656 2791355259 Bacteria 7254731
404 2793323715 2791355260 Bacteria 6598818
405 2793329518 2791355261 Bacteria 6661293
406 2793368640 2791355267 Bacteria 7222458
407 2802720956 2802428858 Bacteria 6636079
408 2802727447 2802428859 Bacteria 6667919
409 2802733414 2802428860 Bacteria 6525526
410 2802740191 2802428861 Bacteria 6534206
411 2802746468 2802428862 Bacteria 6633353
412 2802753266 2802428863 Bacteria 6410669
413 2806047961 2802429633 Bacteria 7341974
414 2806054686 2802429634 Bacteria 7083200
415 2806060694 2802429635 Bacteria 7650140
416 2806069366 2802429636 Bacteria 7597525
417 2806077091 2802429637 Bacteria 7067217
418 2808989455 2808606387 Bacteria 5697198
419 2819562268 2818991439 Bacteria 6907412
420 2819608123 2818991448 Bacteria 6772224
421 2819641703 2818991453 Bacteria 7181617
422 2821447437 2821443989 Bacteria 7658172
423 2835316057 2835312727 Bacteria 7413381
424 2838020384 2838016132 Bacteria 6577831
425 2838025231 2838022645 Bacteria 6494267
426 2838031758 2838029111 Bacteria 6603031
427 2838049826 2838048938 Bacteria 6044578
428 2838062093 2838061910 Bacteria 6794874
429 2838069551 2838068647 Bacteria 6208656
430 2838690592 2838686498 Bacteria 7807632
431 2838718610 2838714209 Bacteria 5525906
432 2838723608 2838719591 Bacteria 5523910
433 2838735886 2838729681 Bacteria 7400765
434 2838748866 2838742623 Bacteria 7396178
435 2840764867 2840764183 Bacteria 6358399
436 2841851695 2841846520 Bacteria 5345850
437 2841855513 2841851746 Bacteria 7532261
438 2841866045 2841864319 Bacteria 6742987
439 2842116474 2842110456 Bacteria 7656360
440 2842130110 2842124991 Bacteria 5346824
441 2842160781 2842156927 Bacteria 6894975
442 2842164302 2842163707 Bacteria 6916235
443 2842174793 2842170452 Bacteria 5525737
444 2842184397 2842180545 Bacteria 6888678
445 2842191275 2842187318 Bacteria 5524014
446 2842200797 2842198810 Bacteria 6608673
447 2842215652 2842211629 Bacteria 5523832
448 2842219781 2842217011 Bacteria 7497767
449 2842228373 2842224351 Bacteria 5524473
450 2842231980 2842229732 Bacteria 7475766
451 2842249693 2842243621 Bacteria 7421798
452 2842263776 2842257432 Bacteria 7401195
453 2842264926 2842264693 Bacteria 6472963
454 2842275094 2842271015 Bacteria 7807131
455 2842301060 2842298080 Bacteria 6123127
456 2842307470 2842304105 Bacteria 7023636
457 2842313067 2842311132 Bacteria 6616990
458 2842341942 2842341865 Bacteria 7003929
459 2842359925 2842357229 Bacteria 6485165
460 2842364294 2842363717 Bacteria 6844742
461 2842397083 2842395702 Bacteria 6780583
462 2842422742 2842422224 Bacteria 6239196
463 2842429021 2842428310 Bacteria 6767288
464 2842435634 2842434925 Bacteria 6502746
465 2842441505 2842441272 Bacteria 6769273
466 2842448426 2842447887 Bacteria 6754142
467 2842463445 2842462802 Bacteria 6588055
468 2842469964 2842469257 Bacteria 6752936
469 2842478490 2842475841 Bacteria 6603183
470 2842505565 2842502639 Bacteria 6604161
471 2842927260 2842922631 Bacteria 5824079
472 2844460248 2844454524 Bacteria 7952546
473 2844535991 2844533157 Bacteria 7517899
474 2847675417 2847670302 Bacteria 6165597
475 2850083810 2850079185 Bacteria 6848280
476 2852395051 2852387548 Bacteria 8025568
477 2856320338 2856314179 Bacteria 6477897
478 2856325232 2856320880 Bacteria 7263508
479 2857355315 2857349434 Bacteria 7926032
480 2857517827 2857516855 Bacteria 7787325
481 2869167790 2869162929 Bacteria 6399702
482 2869292101 2869285874 Bacteria 6901219
483 2871435308 2871429161 Bacteria 6547891
484 2871496014 2871495908 Bacteria 6935695
485 2874127843 2874123672 Bacteria 7238285
486 2874139963 2874139085 Bacteria 7021506
487 2874155009 2874146452 Bacteria 7533118
488 2874161328 2874155637 Bacteria 6724144
489 2874173447 2874168670 Bacteria 8062617
490 2876395482 2876392853 Bacteria 6660880
491 2876420465 2876413966 Bacteria 6831344
492 2878042648 2878035449 Bacteria 6555736
493 2878752443 2878745973 Bacteria 6867388
494 2878760247 2878760144 Bacteria 6823465
495 2878767207 2878767105 Bacteria 6898628
496 2881152323 2881147464 Bacteria 7779814
497 2881162073 2881161766 Bacteria 7127907
498 2882463223 2882456835 Bacteria 6863978
499 2882633522 2882632389 Bacteria 8154593
500 2889012203 2889010040 Bacteria 6749192
501 2894232759 2894232714 Bacteria 8834183
502 2899846103 2899845264 Bacteria 5672268
503 2903505384 2903492973 Bacteria 13473544
504 2903540809 2903540706 Bacteria 7062119
505 2904662113 2904659560 Bacteria 6685615
506 2906314837 2906308376 Bacteria 6841989
507 2906328009 2906321335 Bacteria 6579571
508 2906420882 2906414383 Bacteria 6580790
509 2909042645 2909042592 Bacteria 6499737
510 2915983575 2915980308 Bacteria 6624279
511 2916063216 2916061851 Bacteria 6737736
512 2919102743 2919100787 Bacteria 7710546
513 2919119029 2919114240 Bacteria 5700270
514 2919124389 2919119836 Bacteria 5208557
515 2919170063 2919166419 Bacteria 4952238
516 2919413015 2919408235 Bacteria 6149349
517 2921252339 2921250672 Bacteria 6677771
518 2924738202 2924733363 Bacteria 7574837
519 2926759486 2926754445 Bacteria 5964435
520 2926765398 2926760298 Bacteria 5505990
521 2928526700 2928521798 Bacteria 4960112
522 2933573874 2933570622 Bacteria 7023390
523 2933592691 2933586486 Bacteria 7667493
524 2933598800 2933594066 Bacteria 5594265
525 2933600214 2933599457 Bacteria 5858799
526 2935906237 2935901341 Bacteria 7341747
527 2936374568 2936367885 Bacteria 7324495
528 2936375996 2936375103 Bacteria 6652732
529 2936997116 2936996657 Bacteria 6298727
530 2937032045 2937029754 Bacteria 6424026
531 2937038819 2937036028 Bacteria 6846469
532 2937081418 2937078374 Bacteria 6610289
533 2937088844 2937084907 Bacteria 6618516
534 2937821235 2937813078 Bacteria 7783518
535 2937976316 2937972304 Bacteria 7532020
536 2937994664 2937994558 Bacteria 7036190
537 2954011798 2954011201 Bacteria 4762601
538 2957375881 2957375807 Bacteria 6425588
539 2957442687 2957437181 Bacteria 6568994
540 2957445811 2957443900 Bacteria 6869977
541 2958038743 2958034702 Bacteria 6989922
542 2958064882 2958064165 Bacteria 7158582
543 2958136501 2958130278 Bacteria 6897202
544 2958165142 2958165035 Bacteria 6906348
545 2958185995 2958179912 Bacteria 6874908
546 2960593964 2960591022 Bacteria 6622873
547 2960622502 2960617483 Bacteria 6727748
548 2960634319 2960631154 Bacteria 6732508
549 2960663889 2960660292 Bacteria 7041660
550 2960683041 2960680706 Bacteria 6624464
551 2960697753 2960693952 Bacteria 6749742
552 2961084476 2961077736 Bacteria 7079850
553 2961117267 2961114664 Bacteria 6680456
554 2961163602 2961163497 Bacteria 6901077
555 2965018405 2965018300 Bacteria 6883036
556 2967688256 2967686174 Bacteria 6678622
557 2967730155 2967728569 Bacteria 6641507
558 2968019190 2968016561 Bacteria 7022047
559 2968113175 2968110612 Bacteria 6814636
560 2968123661 2968117919 Bacteria 6536078
561 2968172005 2968171901 Bacteria 6894245
562 2970027739 2970026789 Bacteria 6785236
563 2970127785 2970122695 Bacteria 6625855
564 2970147419 2970143518 Bacteria 6446480
565 2970472551 2970469710 Bacteria 6969209
566 2970491564 2970489779 Bacteria 6517260
567 2970555098 2970554993 Bacteria 6814252
568 2977526387 2977523885 Bacteria 6960446
569 2977533621 2977530762 Bacteria 6951399
570 2977550851 2977544691 Bacteria 6875412
571 2977849564 2977843712 Bacteria 6753583
572 2977866371 2977864932 Bacteria 7534097
573 2977948860 2977942078 Bacteria 7570577
574 2977989726 2977986579 Bacteria 6581278
575 2978970261 2978969890 Bacteria 5400756
576 2979095348 2979089926 Bacteria 5670289
577 2979097602 2979095461 Bacteria 5669583
578 2984587287 2984587000 Bacteria 5263363
579 2987640448 2987636660 Bacteria 8088555
580 2987656729 2987652177 Bacteria 6969023
581 2987659610 2987659509 Bacteria 6966464
582 2989350402 2989349275 Bacteria 6349068
583 2989776382 2989771324 Bacteria 5605128
584 2996355236 2996348954 Bacteria 7239054
585 2996897471 2996893221 Bacteria 5823108
586 3004188653 3004188549 Bacteria 6952365
587 3004208646 3004203850 Bacteria 7307914
588 3004270733 3004268573 Bacteria 7043476
589 3004274289 3004268573 Bacteria 7043476
590 3004281770 3004275668 Bacteria 7114440
591 3004339537 3004334049 Bacteria 8449246
592 3005420909 3005416602 Bacteria 7064308
593 639645492 639633055 Bacteria 7751309
594 650741947 650716007 Bacteria 5573770
595 8004005684 8003999396 Bacteria 7063185
596 8004394919 8004387939 Bacteria 7049250
597 8004642872 8004640170 Bacteria 6723001
598 8004721098 8004714634 Bacteria 6776161
599 8005277757 8005275841 Bacteria 6929066
600 8005285720 8005282627 Bacteria 6675747
601 8005301165 8005301065 Bacteria 6614431
602 8005308172 8005307578 Bacteria 7395396
603 8005319356 8005314921 Bacteria 7072929
604 8005380670 8005376324 Bacteria 6590079
605 8005383212 8005382845 Bacteria 6732062
606 8005398813 8005395548 Bacteria 6806915
607 8005436694 8005430974 Bacteria 6689030
608 8005467677 8005460587 Bacteria 7157962
609 8005487782 8005484373 Bacteria 6297373
610 8005501886 8005497431 Bacteria 6477605
611 8005548083 8005542996 Bacteria 7077758
612 8005562555 8005556819 Bacteria 6908598
613 8005566330 8005563573 Bacteria 7153261
614 8005571714 8005570704 Bacteria 6957481
615 8005624129 8005619151 Bacteria 7030230
616 8005629392 8005626139 Bacteria 6534237
617 8005650298 8005645114 Bacteria 6950293
618 8005673308 8005668836 Bacteria 6953162
619 8005684166 8005682033 Bacteria 6726518
620 8005689021 8005688590 Bacteria 6610080
621 8005697911 8005695170 Bacteria 6912330
622 8018163603 8018163183 Bacteria 7277977
623 8018176317 8018176218 Bacteria 6896178
624 8023681695 8023680758 Bacteria 7729763
625 8024481554 8024479707 Bacteria 6954785
626 8024487502 8024486573 Bacteria 6540512
627 8055623252 8055617313 Bacteria 7548464
628 8056377980 8056375014 Bacteria 7006639
629 8057881431 8057874678 Bacteria 7494653
630 Ga0500622_0001210
631 JGI24740J21852_10000003
632 JGI25155J39150_1000015
633 JGI25156J39149_1000007
634 JGI25162J39368_1000102
635 JGI25154J39366_1000051
636 JGI25157J39369_1000012
637 JGI25157J39369_1000762
638 JGI25151J46595_10000444
639 JGI25151J46595_10001290
640 JGI25165J46597_1000070
641 JGI25165J46597_1000116
642 JGI25165J46597_1000612
643 JGI25153J46596_10000897
644 JGI25153J46596_10009492
645 rootH1_10004271
646 rootH2_10014980
647 rootH2_10151544
648 rootL2_10006749
649 rootL2_10134058
650 rootH1_10054683
651 rootH1_10080337
652 rootH1_10135457
653 JGI25160J50197_1000496
654 JGI25161J50226_1007288
655 Ga0055542_1000905
656 Ga0055526_1000809
657 Ga0055526_1001440
658 Ga0055524_1001162
659 Ga0055524_1032928
660 Ga0055528_1000187
661 Ga0055528_1001094
662 Ga0055528_1005405
663 Ga0055540_1000199
664 Ga0058692_1000497
665 Ga0065165_1000410
666 Ga0065165_1003887
667 Ga0065165_1016315
668 Ga0070658_10143905
669 Ga0070670_100002142
670 Ga0070663_100029841
671 Ga0068867_100147069
672 Ga0070665_100006966
673 Ga0070665_100049158
674 Ga0068855_100225910
675 Ga0068854_100144279
676 Ga0068856_100005528
677 Ga0068852_100035683
678 Ga0068852_100122034
679 Ga0070717_10185371
680 Ga0075365_10000813
681 Ga0075363_100051488
682 Ga0075363_100104086
683 Ga0075364_10093966
684 Ga0075364_10156492
685 Ga0075362_10004288
686 Ga0075367_10005973
687 Ga0075369_10006688
688 Ga0099826_10000042
689 Ga0105240_10000557
690 Ga0105241_10142880
691 Ga0105237_10000934
692 Ga0105238_10013525
693 Ga0123341_1000008
694 Ga0123342_1005172
695 Ga0105239_10002364
696 Ga0105239_10022679
697 Ga0105239_10024535
698 Ga0105239_10037032
699 Ga0105239_10049296
700 Ga0157373_10003996
701 Ga0157371_10001149
702 Ga0157371_10009423
703 Ga0157370_10001937
704 Ga0157370_10002940
705 Ga0157370_10071799
706 Ga0157369_10072347
707 Ga0171463_1002
708 Ga0182007_10002542
709 Ga0182005_1002005
710 Ga0183363_1092
711 Ga0214542_1030568
712 Ga0214543_1000351
713 Ga0228711_1000056
714 Ga0209435_100006
715 Ga0209437_100022
716 Ga0209437_100128
717 Ga0209646_1000015
718 Ga0209026_1000046
719 Ga0209026_1000420
720 Ga0209677_100544
721 Ga0209148_1000056
722 Ga0209759_1000005
723 Ga0209759_1000149
724 Ga0209129_1000554
725 Ga0209233_1000031
726 Ga0209233_1000072
727 Ga0209233_1000131
728 Ga0209233_1000311
729 Ga0209455_1000214
730 Ga0209455_1003633
731 Ga0209455_1019256
732 Ga0209673_1000022
733 Ga0209673_1001359
734 Ga0209673_1002057
735 Ga0209673_1013501
736 Ga0209130_1000130
737 Ga0209130_1000537
738 Ga0209025_1000190
739 Ga0209025_1000609
740 Ga0209564_1000163
741 Ga0209564_1001179
742 Ga0209758_1000734
743 Ga0209758_1000847
744 Ga0209758_1001204
745 Ga0209050_1001943
746 Ga0209256_1000551
747 Ga0209256_1002296
748 Ga0207426_1000109
749 Ga0207426_1000196
750 Ga0207426_1005853
751 Ga0209051_1000359
752 Ga0209051_1007092
753 Ga0209257_1002168
754 Ga0207705_10059125
755 Ga0207695_10000646
756 Ga0207671_10001180
757 Ga0207694_10236225
758 Ga0207650_10007325
759 Ga0207667_10244298
760 Ga0207640_10042905
761 Ga0207639_10016765
762 Ga0207678_10022686
763 Ga0207702_10169462
764 Ga0209281_1000272
765 Ga0209371_1000191
766 Ga0209371_1001558
767 Ga0209282_1000055
768 Ga0209282_1000065
769 Ga0209813_10013263
770 Ga0268266_10033360
771 Ga0268266_10169753
772 Ga0268266_10251466
773 Ga0307515_10001999
774 Ga0307515_10010173
775 Ga0307515_10019373
776 Ga0307515_10069836
777 Ga0268256_1000028
778 Ga0268256_1009209
779 Ga0316181_1223021
780 Ga0307410_10108681
781 Ga0307410_10274098
782 Ga0307410_10352505
783 Ga0315914_1000095
784 Ga0307416_100073414
785 Ga0307416_100091150
786 Ga0315913_1000019
787 Ga0315915_1000023
788 Ga0395900_0013265
789 Ga0395900_0212046
790 Ga0395905_0012141
791 Ga0395905_0015868
792 Ga0395905_0267742
793 Ga0395905_0285742
794 Ga0395901_0075442
795 Ga0439465_0013137
796 Ga0451833_0902581
797 Ga0451833_1209899
798 Ga0451835_0139667
799 Ga0451839_0079019
800 Ga0451839_0446666
801 Ga0451841_0231425
802 Ga0451841_0862854
803 Ga0451847_0686684
804 Ga0451849_1056793
805 Ga0451851_0122269
806 Ga0451851_0714427
807 Ga0451851_0959637
808 Ga0451843_0041261
809 Ga0451855_0223423
810 Ga0451855_0728288
811 Ga0451855_1242750
812 Ga0451853_1921654
813 Ga0439431_0009617
814 Ga0439449_0002605
815 Ga0439449_0008270
816 Ga0466966_0049244
817 Ga0466970_0016387
818 Ga0466957_0036505
819 Ga0466958_0106352
820 Ga0495617_010196
821 Ga0495638_0006868
822 Ga0495638_0012404
823 Ga0495638_0031893
824 Ga0495650_0021433
825 Ga0495605_0032435
826 Ga0495585_0035553
827 Ga0495607_0073944
828 Ga0495583_0062549
829 Ga0495610_0067084
830 Ga0495610_0091992
831 Ga0495631_0006886
832 Ga0495632_0016940
833 Ga0495632_0024075
834 Ga0495643_0007717
835 Ga0495643_0091301
836 Ga0495654_0028888
837 Ga0495654_0072701
838 Ga0495609_0024438
839 Ga0495597_0009535
840 Ga0495622_0003445
841 Ga0495668_0020378
842 Ga0495668_0022199
843 Ga0495668_0067072
844 Ga0495625_0001663
845 Ga0495625_0059610
846 Ga0495588_0001443
847 Ga0495588_0067995
848 Ga0495670_0087274
849 Ga0495649_0014426
850 Ga0495649_0068976
851 Ga0495600_0021915
852 Ga0495604_0000217
853 Ga0495687_036337
854 Ga0495681_0010267
855 Ga0495681_0022662
856 Ga0495686_0021452
857 Ga0495602_0222724
858 Ga0495615_0013235
859 Ga0496100_0007998
860 Ga0496102_0021087
861 Ga0496113_0173258
862 Ga0496116_0000042
863 Ga0496116_0011189
864 Ga0496117_0009344
865 Ga0496117_0135966
866 Ga0496118_0003854
867 Ga0496118_0007828
868 Ga0496118_0014846
869 Ga0496118_0087824
870 Ga0496119_0004001
871 Ga0496119_0023271
872 Ga0496120_0000509
873 Ga0496120_0002794
874 Ga0496120_0005453
875 Ga0496120_0033126
876 Ga0496121_0002458
877 Ga0496121_0051627
878 Ga0496121_0225848
879 Ga0496122_0000195
880 Ga0496122_0000365
881 Ga0496122_0011415
882 Ga0496122_0011714
883 Ga0496122_0033177
884 Ga0496123_0000153
885 Ga0496123_0000298
886 Ga0496123_0000664
887 Ga0496123_0005018
888 Ga0496123_0035926
889 Ga0496124_0005087
890 Ga0496124_0017093
891 Ga0496124_0029473
892 Ga0496125_0006443
893 Ga0496125_0017609
894 Ga0496125_0174231
895 Ga0496126_0000053
896 Ga0496126_0120054
897 Ga0496126_0229564
898 Ga0501068_0230808
899 Ga0501241_004221
900 nmdc:mga03683_2407_c1
901 nmdc:mga00v17_24_c1
902 nmdc:mga0yw44_2177_c1
903 nmdc:mga0yw44_28064_c1
904 nmdc:mga0yw44_31218_c1
905 nmdc:mga06z11_18240_c1
906 nmdc:mga06z11_2254_c1
907 nmdc:mga04h51_13801_c1
908 nmdc:mga07m45_37128_c1
909 nmdc:mga0sz30_16212_c1
910 Ga0500578_0039672
911 Ga0500644_0004321
912 Ga0500557_001343
913 Ga0500560_000555
914 Ga0500569_002026
915 Ga0500595_044976
916 Ga0500608_059554
917 Ga0500618_005640
918 Ga0500658_0000495
919 Ga0500658_0016758
920 Ga0500658_0053087
921 Ga0500659_0072052
922 Ga0500561_0000102
923 Ga0500568_0000401
924 Ga0500590_000296
925 Ga0500616_0000615
926 Ga0500622_0000290
927 Ga0500636_0059946
928 2503201097
929 2509079946
930 2509116409
931 2509141957
932 2509379916
933 2509390641
934 2510136240
935 2510320107
936 2510892742
937 2511135525
938 2511198064
939 2512529609
940 2512975503
941 2513568550
942 2513579352
943 2513605846
944 2513630597
945 2513712054
946 2513914379
947 2513986377
948 2514006854
949 2514018388
950 2514592438
951 2515108831
952 2515611731
953 2515633172
954 2515640378
955 2515656460
956 2515738351
957 2517040768
958 2517080394
959 2517098366
960 2517409856
961 2517567095
962 2524449389
963 2524459272
964 2530649004
965 2535520338
966 2554249661
967 2558864886
968 2559298004
969 2585169188
970 2585222198
971 2585272600
972 2585281165
973 2585327251
974 2585335838
975 2585393558
976 2585526721
977 2585536751
978 2585543201
979 2585544849
980 2585557315
981 2585562268
982 2585841657
983 2585896704
984 2585906565
985 2585993472
986 2586004121
987 2587981987
988 2588515625
989 2599334408
990 2599606338
991 2601612520
992 2601749363
993 2616312257
994 2616552296
995 2643856947
996 2644207947
997 2644519900
998 2644651349
999 2671116903
1000 2719184743
1001 2719389414
1002 2719668739
1003 2719728763
1004 2720489432
1005 2720610104
1006 2720617529
1007 2720628675
1008 2720772625
1009 2721144454
1010 2721161824
1011 2721402182
1012 2722842969
1013 2723030064
1014 2723564469
1015 2723569891
1016 2724036015
1017 2724041788
1018 2724092654
1019 2724101438
1020 2724113038
1021 2725949508
1022 2730110597
1023 2730160858
1024 2739035248
1025 2753461454
1026 2765469006
1027 2766069001
1028 2774874649
1029 2776914916
1030 2778177904
1031 2792640737
1032 2793316656
1033 2793323715
1034 2793329518
1035 2793368640
1036 2802720956
1037 2802727447
1038 2802733414
1039 2802740191
1040 2802746468
1041 2802753266
1042 2806047961
1043 2806054686
1044 2806060694
1045 2806069366
1046 2806077091
1047 2808989455
1048 2819562268
1049 2819608123
1050 2819641703
1051 2821447437
1052 2835316057
1053 2838020384
1054 2838025231
1055 2838031758
1056 2838049826
1057 2838062093
1058 2838069551
1059 2838690592
1060 2838718610
1061 2838723608
1062 2838735886
1063 2838748866
1064 2840764867
1065 2841851695
1066 2841855513
1067 2841866045
1068 2842116474
1069 2842130110
1070 2842160781
1071 2842164302
1072 2842174793
1073 2842184397
1074 2842191275
1075 2842200797
1076 2842215652
1077 2842219781
1078 2842228373
1079 2842231980
1080 2842249693
1081 2842263776
1082 2842264926
1083 2842275094
1084 2842301060
1085 2842307470
1086 2842313067
1087 2842341942
1088 2842359925
1089 2842364294
1090 2842397083
1091 2842422742
1092 2842429021
1093 2842435634
1094 2842441505
1095 2842448426
1096 2842463445
1097 2842469964
1098 2842478490
1099 2842505565
1100 2842927260
1101 2844460248
1102 2844535991
1103 2847675417
1104 2850083810
1105 2852395051
1106 2856320338
1107 2856325232
1108 2857355315
1109 2857517827
1110 2869167790
1111 2869292101
1112 2871435308
1113 2871496014
1114 2874127843
1115 2874139963
1116 2874155009
1117 2874161328
1118 2874173447
1119 2876395482
1120 2876420465
1121 2878042648
1122 2878752443
1123 2878760247
1124 2878767207
1125 2881152323
1126 2881162073
1127 2882463223
1128 2882633522
1129 2889012203
1130 2894232759
1131 2899846103
1132 2903505384
1133 2903540809
1134 2904662113
1135 2906314837
1136 2906328009
1137 2906420882
1138 2909042645
1139 2915983575
1140 2916063216
1141 2919102743
1142 2919119029
1143 2919124389
1144 2919170063
1145 2919413015
1146 2921252339
1147 2924738202
1148 2926759486
1149 2926765398
1150 2928526700
1151 2933573874
1152 2933592691
1153 2933598800
1154 2933600214
1155 2935906237
1156 2936374568
1157 2936375996
1158 2936997116
1159 2937032045
1160 2937038819
1161 2937081418
1162 2937088844
1163 2937821235
1164 2937976316
1165 2937994664
1166 2954011798
1167 2957375881
1168 2957442687
1169 2957445811
1170 2958038743
1171 2958064882
1172 2958136501
1173 2958165142
1174 2958185995
1175 2960593964
1176 2960622502
1177 2960634319
1178 2960663889
1179 2960683041
1180 2960697753
1181 2961084476
1182 2961117267
1183 2961163602
1184 2965018405
1185 2967688256
1186 2967730155
1187 2968019190
1188 2968113175
1189 2968123661
1190 2968172005
1191 2970027739
1192 2970127785
1193 2970147419
1194 2970472551
1195 2970491564
1196 2970555098
1197 2977526387
1198 2977533621
1199 2977550851
1200 2977849564
1201 2977866371
1202 2977948860
1203 2977989726
1204 2978970261
1205 2979095348
1206 2979097602
1207 2984587287
1208 2987640448
1209 2987656729
1210 2987659610
1211 2989350402
1212 2989776382
1213 2996355236
1214 2996897471
1215 3004188653
1216 3004208646
1217 3004270733
1218 3004274289
1219 3004281770
1220 3004339537
1221 3005420909
1222 639645492
1223 650741947
1224 8004005684
1225 8004394919
1226 8004642872
1227 8004721098
1228 8005277757
1229 8005285720
1230 8005301165
1231 8005308172
1232 8005319356
1233 8005380670
1234 8005383212
1235 8005398813
1236 8005436694
1237 8005467677
1238 8005487782
1239 8005501886
1240 8005548083
1241 8005562555
1242 8005566330
1243 8005571714
1244 8005624129
1245 8005629392
1246 8005650298
1247 8005673308
1248 8005684166
1249 8005689021
1250 8005697911
1251 8018163603
1252 8018176317
1253 8023681695
1254 8024481554
1255 8024487502
1256 8055623252
1257 8056377980
1258 8057881431

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01266

DAO

FAD dependent oxidoreductase

39

385

0.81

PF00890

FAD_binding_2

FAD binding domain

39

326

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
2y0d-assembly1.cif.gz_D bcec mutation y10k 0.9782 8 37
2y0d-assembly1.cif.gz_C bcec mutation y10k 0.978 8 37
2y0d-assembly1.cif.gz_A bcec mutation y10k 0.9775 8 37
2y0d-assembly1.cif.gz_B bcec mutation y10k 0.9774 8 37
3g0o-assembly1.cif.gz_A crystal structure of 3-hydroxyisobutyrate dehydrogenase (ygbj) from salmonella typhimurium 0.9712 9 36
ID Description Score Start End Superfamily
af_Q58454_1_196_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 1.001 9 37 3.40.50.720
af_O17762_3_218_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.991 8 36 3.40.50.720
af_M9NFH8_1768_1873_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.988 9 39 3.40.50.720
3gg2D01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9878 9 36 3.40.50.720
1mfzC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9863 10 37 3.40.50.720
ID Description Score Start End GO Terms
AF-H3RCR4-F1-model_v4 FAD dependent oxidoreductase (EC 1.-.-.-) 0.9828 117 372 GO:0005737
GO:0016491
AF-H0FZA6-F1-model_v4 FAD dependent oxidoreductase 0.9802 7 374 GO:0005737
GO:0016020
AF-A0A542J2H7-F1-model_v4 deleted 0.9799 5 374
AF-A0A506U0U4-F1-model_v4 FAD-binding oxidoreductase 0.975 1 374 GO:0005737
AF-A0A530JZR0-F1-model_v4 FAD-binding oxidoreductase 0.9744 1 312 GO:0005737

Map