F470732

General Info

Members Datasets Scaffolds Average Seq Length
629 280 1258 233

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10304412|Ga0105237_103044123
Length 250
Sequence MLDVHPGPLALFGGFMEPRSQTVFNHGTAPAVGVAESQNRVLRNTYWLLSLSMLPTVAGAWAGMQLNFLSLFAASPVMAPLLMFGVMIGALFGVTALRNSAWGVPALFGFTFIAGLMLAPILSVALGFRNGGQLIGLAGGMTAVIFFAMAGIATVTKRDFSFMGKFLFIGLVLLIVASLANIFLQIPALSVTVSAIAVLLFSAYLLHDVSRIVRGGETNYITATLSLFLDVYNIFISLLNILLMFSGQRD

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
176 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
177 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
178 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
179 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
180 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
181 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
182 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
183 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
190 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
191 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
192 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
193 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
194 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
195 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
196 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
197 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
198 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
199 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
202 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
203 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
204 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
207 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
208 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
209 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
210 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
211 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
212 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
213 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
214 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
215 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
216 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
217 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
218 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
219 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
220 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
221 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
222 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
223 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
224 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
225 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
226 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
227 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
228 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
229 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
230 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
231 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
232 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
233 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
234 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
235 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
236 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
237 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
238 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
239 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
240 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
241 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
242 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
243 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
244 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
245 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
246 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
247 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
248 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
249 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
250 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
251 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
252 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
253 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
258 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
259 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
262 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
263 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
264 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
265 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
266 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
267 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 2643221664 Massilia sp. Root418 Isolate Unclassified
276 2738541280 Massilia sp. GV090 Isolate Unclassified
277 2738541300 Massilia sp. GV016 Isolate Unclassified
278 2738543018 Massilia sp. GV045 Isolate Unclassified
279 2738543030 Massilia sp. GV097 Isolate Unclassified
280 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.5
Metatranscriptomes 2.54
Isolates 0.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.32
Nodule 0
Rhizoplane 2.38
Rhizosphere 96.18
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10304412 3300009545 Bacteria 1597
2 JGI24748J21848_1012936 3300002074 Bacteria 986
3 Ga0070658_10622671 3300005327 Bacteria 936
4 Ga0070676_10000975 3300005328 Bacteria 14221
5 Ga0070676_10290665 3300005328 Bacteria 1104
6 Ga0070676_10341499 3300005328 Bacteria 1027
7 Ga0070676_10362219 3300005328 Bacteria 999
8 Ga0070683_100081264 3300005329 Bacteria 3034
9 Ga0070683_100093131 3300005329 Bacteria 2830
10 Ga0070683_100171932 3300005329 Bacteria 2057
11 Ga0070690_100024054 3300005330 Bacteria 3743
12 Ga0070670_100030196 3300005331 Bacteria 4667
13 Ga0070670_100031567 3300005331 Bacteria 4563
14 Ga0070670_100034350 3300005331 Bacteria 4363
15 Ga0070670_100118242 3300005331 Bacteria 2286
16 Ga0070670_100155446 3300005331 Bacteria 1980
17 Ga0070670_100284706 3300005331 Bacteria 1443
18 Ga0070677_10000807 3300005333 Bacteria 10366
19 Ga0070677_10114922 3300005333 Bacteria 1207
20 Ga0068869_100072952 3300005334 Bacteria 2544
21 Ga0068869_100087312 3300005334 Bacteria 2339
22 Ga0068869_100100776 3300005334 Bacteria 2184
23 Ga0070666_10001239 3300005335 Bacteria 15435
24 Ga0070666_10009140 3300005335 Bacteria 6179
25 Ga0070680_100046206 3300005336 Bacteria 3541
26 Ga0070680_100212762 3300005336 Bacteria 1631
27 Ga0070682_100069975 3300005337 Bacteria 2242
28 Ga0068868_100001857 3300005338 Bacteria 14499
29 Ga0068868_100005645 3300005338 Bacteria 8806
30 Ga0068868_100173623 3300005338 Bacteria 1785
31 Ga0070660_100014044 3300005339 Bacteria 5764
32 Ga0070660_100100830 3300005339 Bacteria 2287
33 Ga0070660_100164259 3300005339 Bacteria 1790
34 Ga0070660_100332316 3300005339 Bacteria 1250
35 Ga0070689_100003142 3300005340 Bacteria 10924
36 Ga0070689_100669986 3300005340 Bacteria 904
37 Ga0070661_100085770 3300005344 Bacteria 2327
38 Ga0070661_100161304 3300005344 Bacteria 1698
39 Ga0070661_100219051 3300005344 Bacteria 1459
40 Ga0070692_10036823 3300005345 Bacteria 2485
41 Ga0070692_10390545 3300005345 Bacteria 876
42 Ga0070668_100009765 3300005347 Bacteria 7114
43 Ga0070668_100011053 3300005347 Bacteria 6720
44 Ga0070668_100024428 3300005347 Bacteria 4579
45 Ga0070668_100092604 3300005347 Bacteria 2384
46 Ga0070669_100130606 3300005353 Bacteria 1926
47 Ga0070675_100013624 3300005354 Bacteria 6394
48 Ga0070675_100028134 3300005354 Bacteria 4523
49 Ga0070675_100030634 3300005354 Bacteria 4344
50 Ga0070675_100261794 3300005354 Bacteria 1516
51 Ga0070671_100002986 3300005355 Bacteria 13164
52 Ga0070671_100013348 3300005355 Bacteria 6621
53 Ga0070671_100052646 3300005355 Bacteria 3384
54 Ga0070671_100297517 3300005355 Bacteria 1374
55 Ga0070671_100346011 3300005355 Bacteria 1269
56 Ga0070674_100014547 3300005356 Bacteria 4894
57 Ga0070674_100065882 3300005356 Bacteria 2544
58 Ga0070674_100086827 3300005356 Bacteria 2248
59 Ga0070674_100401046 3300005356 Bacteria 1121
60 Ga0070673_100005623 3300005364 Bacteria 8043
61 Ga0070673_100005830 3300005364 Bacteria 7938
62 Ga0070673_100043334 3300005364 Bacteria 3476
63 Ga0070673_100051987 3300005364 Bacteria 3212
64 Ga0070673_100124315 3300005364 Bacteria 2156
65 Ga0070688_100000458 3300005365 Bacteria 20699
66 Ga0070688_100204330 3300005365 Bacteria 1384
67 Ga0070659_100124663 3300005366 Bacteria 2089
68 Ga0070659_100147820 3300005366 Bacteria 1915
69 Ga0070659_100165857 3300005366 Bacteria 1807
70 Ga0070659_100288401 3300005366 Bacteria 1366
71 Ga0070667_100003537 3300005367 Bacteria 13310
72 Ga0070667_100013731 3300005367 Bacteria 6695
73 Ga0070667_100237462 3300005367 Bacteria 1626
74 Ga0070667_100267578 3300005367 Bacteria 1532
75 Ga0070709_10001951 3300005434 Bacteria 11233
76 Ga0070714_100009134 3300005435 Bacteria 7777
77 Ga0070714_100040356 3300005435 Bacteria 3934
78 Ga0070714_100209573 3300005435 Bacteria 1786
79 Ga0070714_100738068 3300005435 Bacteria 951
80 Ga0070714_100854003 3300005435 Bacteria 883
81 Ga0070713_100002402 3300005436 Bacteria 12211
82 Ga0070713_100020507 3300005436 Bacteria 5068
83 Ga0070713_100142839 3300005436 Bacteria 2122
84 Ga0070713_100214158 3300005436 Bacteria 1745
85 Ga0070710_10036498 3300005437 Bacteria 2688
86 Ga0070701_10012622 3300005438 Bacteria 3816
87 Ga0070711_100003780 3300005439 Bacteria 8880
88 Ga0070711_100239915 3300005439 Bacteria 1417
89 Ga0070694_100037166 3300005444 Bacteria 3229
90 Ga0070708_100054327 3300005445 Bacteria 3557
91 Ga0070663_100008281 3300005455 Bacteria 6387
92 Ga0070663_100123186 3300005455 Bacteria 1961
93 Ga0070663_100146392 3300005455 Bacteria 1808
94 Ga0070663_100238322 3300005455 Bacteria 1435
95 Ga0070678_100001518 3300005456 Bacteria 12390
96 Ga0070678_100007823 3300005456 Bacteria 6360
97 Ga0070678_100093439 3300005456 Bacteria 2313
98 Ga0070662_100084522 3300005457 Bacteria 2371
99 Ga0070662_100316928 3300005457 Bacteria 1271
100 Ga0070662_100788667 3300005457 Bacteria 807
101 Ga0070681_10005398 3300005458 Bacteria 12344
102 Ga0070681_10008601 3300005458 Bacteria 10006
103 Ga0070681_10217907 3300005458 Bacteria 1824
104 Ga0070681_10348590 3300005458 Bacteria 1391
105 Ga0068867_100008965 3300005459 Bacteria 7058
106 Ga0068867_100026811 3300005459 Bacteria 4139
107 Ga0068867_100487133 3300005459 Bacteria 1058
108 Ga0070685_10008324 3300005466 Bacteria 5324
109 Ga0070685_10225443 3300005466 Bacteria 1230
110 Ga0070707_100071004 3300005468 Bacteria 3354
111 Ga0070698_100589264 3300005471 Bacteria 1052
112 Ga0070699_100023002 3300005518 Bacteria 5370
113 Ga0070699_100046715 3300005518 Bacteria 3746
114 Ga0070679_100011162 3300005530 Bacteria 8557
115 Ga0070679_100046471 3300005530 Bacteria 4327
116 Ga0070679_100151429 3300005530 Bacteria 2296
117 Ga0070679_100215667 3300005530 Bacteria 1882
118 Ga0070679_100310377 3300005530 Bacteria 1527
119 Ga0070684_100042537 3300005535 Bacteria 3922
120 Ga0070684_100081329 3300005535 Bacteria 2866
121 Ga0070697_100013500 3300005536 Bacteria 6408
122 Ga0068853_100046600 3300005539 Bacteria 3718
123 Ga0068853_100178978 3300005539 Bacteria 1922
124 Ga0068853_100222230 3300005539 Bacteria 1725
125 Ga0068853_100400438 3300005539 Bacteria 1285
126 Ga0070672_100000308 3300005543 Bacteria 27646
127 Ga0070672_100002977 3300005543 Bacteria 10912
128 Ga0070672_100023780 3300005543 Bacteria 4520
129 Ga0070672_100028844 3300005543 Bacteria 4155
130 Ga0070672_100039503 3300005543 Bacteria 3615
131 Ga0070672_100079170 3300005543 Bacteria 2630
132 Ga0070686_100040050 3300005544 Bacteria 2922
133 Ga0070696_100035587 3300005546 Bacteria 3429
134 Ga0070696_100064816 3300005546 Bacteria 2560
135 Ga0070693_100024807 3300005547 Bacteria 3220
136 Ga0070665_100001417 3300005548 Bacteria 28129
137 Ga0070665_100001524 3300005548 Bacteria 26828
138 Ga0070665_100007532 3300005548 Bacteria 11066
139 Ga0070665_100021232 3300005548 Bacteria 6529
140 Ga0070665_100089954 3300005548 Bacteria 3075
141 Ga0068855_100001119 3300005563 Bacteria 33345
142 Ga0070664_100000934 3300005564 Bacteria 22823
143 Ga0070664_100067175 3300005564 Bacteria 3064
144 Ga0070664_100271007 3300005564 Bacteria 1529
145 Ga0070664_100595648 3300005564 Bacteria 1025
146 Ga0068857_100002116 3300005577 Bacteria 16149
147 Ga0068857_100028759 3300005577 Bacteria 4904
148 Ga0068857_100160467 3300005577 Bacteria 2040
149 Ga0068854_100003623 3300005578 Bacteria 9664
150 Ga0068854_100021061 3300005578 Bacteria 4420
151 Ga0068854_100029133 3300005578 Bacteria 3820
152 Ga0068854_100193172 3300005578 Bacteria 1596
153 Ga0068856_100006845 3300005614 Bacteria 11150
154 Ga0068856_100013862 3300005614 Bacteria 7795
155 Ga0068856_100185290 3300005614 Bacteria 2095
156 Ga0068852_100000768 3300005616 Bacteria 21136
157 Ga0068852_100012670 3300005616 Bacteria 6413
158 Ga0068852_100112895 3300005616 Bacteria 2473
159 Ga0068852_100147553 3300005616 Bacteria 2183
160 Ga0068852_100150540 3300005616 Bacteria 2163
161 Ga0068859_100002028 3300005617 Bacteria 20687
162 Ga0068859_100156595 3300005617 Bacteria 2356
163 Ga0068859_100302767 3300005617 Bacteria 1692
164 Ga0068864_100000455 3300005618 Bacteria 35377
165 Ga0068864_100000740 3300005618 Bacteria 27362
166 Ga0068864_100063009 3300005618 Bacteria 3213
167 Ga0068864_100177810 3300005618 Bacteria 1944
168 Ga0068864_100502645 3300005618 Bacteria 1166
169 Ga0068864_100649693 3300005618 Bacteria 1027
170 Ga0068866_10000548 3300005718 Bacteria 17150
171 Ga0068866_10208924 3300005718 Bacteria 1171
172 Ga0068861_100207468 3300005719 Bacteria 1648
173 Ga0068861_100307053 3300005719 Bacteria 1376
174 Ga0068861_100489192 3300005719 Bacteria 1110
175 Ga0068851_10006873 3300005834 Bacteria 5212
176 Ga0068851_10078478 3300005834 Bacteria 1720
177 Ga0068870_10004919 3300005840 Bacteria 5785
178 Ga0068863_100009317 3300005841 Bacteria 9581
179 Ga0068863_100036668 3300005841 Bacteria 4670
180 Ga0068863_100050940 3300005841 Bacteria 3924
181 Ga0068863_100401422 3300005841 Bacteria 1341
182 Ga0068863_100670217 3300005841 Bacteria 1029
183 Ga0068858_100000850 3300005842 Bacteria 31613
184 Ga0068858_100032194 3300005842 Bacteria 4870
185 Ga0068858_100141381 3300005842 Bacteria 2259
186 Ga0068858_100389535 3300005842 Bacteria 1338
187 Ga0068858_100452841 3300005842 Bacteria 1237
188 Ga0068860_100008471 3300005843 Bacteria 10247
189 Ga0068860_100022393 3300005843 Bacteria 6112
190 Ga0068860_100353651 3300005843 Bacteria 1446
191 Ga0068860_100399763 3300005843 Bacteria 1359
192 Ga0068862_100029944 3300005844 Bacteria 4587
193 Ga0068862_100111823 3300005844 Bacteria 2398
194 Ga0081455_10172117 3300005937 Bacteria 1648
195 Ga0070716_100011269 3300006173 Bacteria 4501
196 Ga0070712_100004102 3300006175 Bacteria 8949
197 Ga0070712_100255614 3300006175 Bacteria 1402
198 Ga0075366_10133174 3300006195 Bacteria 1500
199 Ga0097621_100005686 3300006237 Bacteria 8801
200 Ga0097621_100027814 3300006237 Bacteria 4451
201 Ga0097621_100072662 3300006237 Bacteria 2845
202 Ga0097621_100419683 3300006237 Bacteria 1201
203 Ga0097621_100456682 3300006237 Bacteria 1152
204 Ga0068871_100050572 3300006358 Bacteria 3362
205 Ga0068871_100285365 3300006358 Bacteria 1445
206 Ga0075428_100170197 3300006844 Bacteria 2362
207 Ga0075428_100235058 3300006844 Bacteria 1978
208 Ga0075434_100110026 3300006871 Bacteria 2766
209 Ga0068865_100085048 3300006881 Bacteria 2281
210 Ga0068865_100138120 3300006881 Bacteria 1834
211 Ga0068865_100195897 3300006881 Bacteria 1566
212 Ga0097620_100002027 3300006931 Bacteria 20687
213 Ga0097620_100156598 3300006931 Bacteria 2356
214 Ga0097620_100302747 3300006931 Bacteria 1692
215 Ga0075435_100043986 3300007076 Bacteria 3577
216 Ga0105240_10000332 3300009093 Bacteria 88613
217 Ga0105240_10090010 3300009093 Bacteria 3752
218 Ga0105240_10090143 3300009093 Bacteria 3749
219 Ga0105240_10810231 3300009093 Bacteria 1014
220 Ga0105245_10013288 3300009098 Bacteria 7172
221 Ga0105245_10189531 3300009098 Bacteria 1969
222 Ga0105247_10029095 3300009101 Bacteria 3346
223 Ga0105243_10057543 3300009148 Bacteria 3096
224 Ga0105241_10004491 3300009174 Bacteria 10319
225 Ga0105241_10024851 3300009174 Bacteria 4451
226 Ga0105241_10044096 3300009174 Bacteria 3379
227 Ga0105248_10032092 3300009177 Bacteria 5869
228 Ga0105248_10121389 3300009177 Bacteria 2948
229 Ga0105248_10310224 3300009177 Bacteria 1777
230 Ga0105248_10354239 3300009177 Bacteria 1652
231 Ga0105248_10860738 3300009177 Bacteria 1023
232 Ga0105237_10028957 3300009545 Bacteria 5634
233 Ga0105238_10000244 3300009551 Bacteria 60605
234 Ga0105238_10198644 3300009551 Bacteria 1981
235 Ga0105239_10073547 3300010375 Bacteria 3757
236 Ga0105239_10092064 3300010375 Bacteria 3346
237 Ga0105246_10051342 3300011119 Bacteria 2832
238 Ga0105246_10395288 3300011119 Bacteria 1146
239 Ga0157373_10019865 3300013100 Bacteria 4887
240 Ga0157373_10024332 3300013100 Bacteria 4388
241 Ga0157373_10051274 3300013100 Bacteria 2940
242 Ga0157373_10370840 3300013100 Bacteria 1023
243 Ga0157373_10485500 3300013100 Bacteria 891
244 Ga0157371_10023665 3300013102 Bacteria 4491
245 Ga0157371_10253857 3300013102 Bacteria 1267
246 Ga0157370_10005883 3300013104 Bacteria 13674
247 Ga0157370_10009707 3300013104 Bacteria 10233
248 Ga0157370_10026468 3300013104 Bacteria 5727
249 Ga0157370_10279217 3300013104 Bacteria 1543
250 Ga0157370_10553279 3300013104 Bacteria 1055
251 Ga0157369_10005394 3300013105 Bacteria 14884
252 Ga0157369_10194997 3300013105 Bacteria 2127
253 Ga0157369_10201144 3300013105 Bacteria 2091
254 Ga0157369_10787895 3300013105 Bacteria 977
255 Ga0157374_10003271 3300013296 Bacteria 13608
256 Ga0157374_10215666 3300013296 Bacteria 1882
257 Ga0157374_10807317 3300013296 Bacteria 954
258 Ga0157378_10005893 3300013297 Bacteria 10735
259 Ga0157378_10064824 3300013297 Bacteria 3269
260 Ga0157378_10137993 3300013297 Bacteria 2262
261 Ga0157378_10165684 3300013297 Bacteria 2070
262 Ga0163162_10020054 3300013306 Bacteria 6566
263 Ga0163162_10061410 3300013306 Bacteria 3796
264 Ga0163162_10169699 3300013306 Bacteria 2306
265 Ga0163162_10290493 3300013306 Bacteria 1767
266 Ga0163162_10343862 3300013306 Bacteria 1624
267 Ga0163162_10510112 3300013306 Bacteria 1333
268 Ga0157372_10002879 3300013307 Bacteria 18604
269 Ga0157372_10057898 3300013307 Bacteria 4332
270 Ga0157372_10132165 3300013307 Bacteria 2872
271 Ga0157372_10271123 3300013307 Bacteria 1972
272 Ga0157375_10006021 3300013308 Bacteria 10577
273 Ga0157375_10011902 3300013308 Bacteria 7697
274 Ga0157375_10035555 3300013308 Bacteria 4756
275 Ga0157375_10068797 3300013308 Bacteria 3544
276 Ga0157375_10243716 3300013308 Bacteria 1957
277 Ga0157375_10439583 3300013308 Bacteria 1470
278 Ga0163163_10000310 3300014325 Bacteria 47904
279 Ga0163163_10043746 3300014325 Bacteria 4392
280 Ga0163163_10349037 3300014325 Bacteria 1535
281 Ga0157380_10043712 3300014326 Bacteria 3508
282 Ga0182008_10067352 3300014497 Bacteria 1762
283 Ga0182008_10082404 3300014497 Bacteria 1583
284 Ga0157377_10126571 3300014745 Bacteria 1555
285 Ga0157377_10451438 3300014745 Bacteria 887
286 Ga0157379_10000626 3300014968 Bacteria 28509
287 Ga0157379_10136790 3300014968 Bacteria 2207
288 Ga0157376_10005464 3300014969 Bacteria 8883
289 Ga0157376_10111908 3300014969 Bacteria 2405
290 Ga0157376_10234134 3300014969 Bacteria 1707
291 Ga0157376_10358740 3300014969 Bacteria 1397
292 Ga0163161_10038381 3300017792 Bacteria 3435
293 Ga0163161_10293990 3300017792 Bacteria 1277
294 Ga0197907_10357466 3300020069 Bacteria 869
295 Ga0206356_10470992 3300020070 Bacteria 1566
296 Ga0206350_10016023 3300020080 Bacteria 825
297 Ga0206354_10100971 3300020081 Bacteria 773
298 Ga0154015_1377351 3300020610 Bacteria 1473
299 Ga0154015_1531000 3300020610 Bacteria 1266
300 Ga0224712_10100485 3300022467 Bacteria 1226
301 Ga0207697_10022631 3300025315 Bacteria 2574
302 Ga0207656_10025393 3300025321 Bacteria 2405
303 Ga0207682_10000061 3300025893 Bacteria 46850
304 Ga0207682_10115312 3300025893 Bacteria 1186
305 Ga0207692_10283412 3300025898 Bacteria 1003
306 Ga0207642_10029855 3300025899 Bacteria 2263
307 Ga0207710_10272210 3300025900 Bacteria 851
308 Ga0207688_10013116 3300025901 Bacteria 4505
309 Ga0207688_10180618 3300025901 Bacteria 1258
310 Ga0207680_10004784 3300025903 Bacteria 6447
311 Ga0207680_10014384 3300025903 Bacteria 4093
312 Ga0207680_10286128 3300025903 Bacteria 1146
313 Ga0207680_10368882 3300025903 Bacteria 1010
314 Ga0207699_10134270 3300025906 Bacteria 1618
315 Ga0207645_10002609 3300025907 Bacteria 14052
316 Ga0207643_10005370 3300025908 Bacteria 6859
317 Ga0207643_10031149 3300025908 Bacteria 2972
318 Ga0207643_10190550 3300025908 Bacteria 1245
319 Ga0207643_10238416 3300025908 Bacteria 1117
320 Ga0207705_10083383 3300025909 Bacteria 2332
321 Ga0207705_10085213 3300025909 Bacteria 2308
322 Ga0207705_10274479 3300025909 Bacteria 1289
323 Ga0207705_10480875 3300025909 Bacteria 964
324 Ga0207705_10551014 3300025909 Bacteria 896
325 Ga0207654_10129434 3300025911 Bacteria 1596
326 Ga0207654_10238568 3300025911 Bacteria 1214
327 Ga0207707_10013250 3300025912 Bacteria 7183
328 Ga0207707_10033435 3300025912 Bacteria 4500
329 Ga0207707_10109658 3300025912 Bacteria 2413
330 Ga0207707_10403609 3300025912 Bacteria 1173
331 Ga0207695_10039493 3300025913 Bacteria 5073
332 Ga0207695_10066294 3300025913 Bacteria 3709
333 Ga0207695_10111471 3300025913 Bacteria 2715
334 Ga0207695_10220565 3300025913 Bacteria 1804
335 Ga0207671_10283072 3300025914 Bacteria 1308
336 Ga0207693_10000485 3300025915 Bacteria 36061
337 Ga0207693_10055636 3300025915 Bacteria 3104
338 Ga0207693_10171803 3300025915 Bacteria 1707
339 Ga0207693_10363514 3300025915 Bacteria 1132
340 Ga0207663_10041522 3300025916 Bacteria 2803
341 Ga0207660_10114229 3300025917 Bacteria 2036
342 Ga0207660_10337101 3300025917 Bacteria 1207
343 Ga0207660_10455997 3300025917 Bacteria 1034
344 Ga0207662_10054613 3300025918 Bacteria 2382
345 Ga0207662_10146324 3300025918 Bacteria 1500
346 Ga0207657_10000240 3300025919 Bacteria 58053
347 Ga0207657_10002577 3300025919 Bacteria 19605
348 Ga0207657_10701394 3300025919 Bacteria 786
349 Ga0207649_10042056 3300025920 Bacteria 2785
350 Ga0207649_10069389 3300025920 Bacteria 2244
351 Ga0207649_10089399 3300025920 Bacteria 2013
352 Ga0207652_10008752 3300025921 Bacteria 8147
353 Ga0207652_10050689 3300025921 Bacteria 3557
354 Ga0207652_10174010 3300025921 Bacteria 1932
355 Ga0207652_10343166 3300025921 Bacteria 1348
356 Ga0207652_10493927 3300025921 Bacteria 1102
357 Ga0207652_10640028 3300025921 Bacteria 951
358 Ga0207681_10024021 3300025923 Bacteria 3907
359 Ga0207681_10083649 3300025923 Bacteria 2259
360 Ga0207694_10171593 3300025924 Bacteria 1756
361 Ga0207694_10373780 3300025924 Bacteria 1182
362 Ga0207650_10020951 3300025925 Bacteria 4618
363 Ga0207650_10021783 3300025925 Bacteria 4532
364 Ga0207650_10066683 3300025925 Bacteria 2699
365 Ga0207650_10183340 3300025925 Bacteria 1669
366 Ga0207659_10019552 3300025926 Bacteria 4461
367 Ga0207659_10029096 3300025926 Bacteria 3761
368 Ga0207659_10073026 3300025926 Bacteria 2510
369 Ga0207659_10089151 3300025926 Bacteria 2300
370 Ga0207659_10195386 3300025926 Bacteria 1612
371 Ga0207687_10001442 3300025927 Bacteria 16268
372 Ga0207687_10042059 3300025927 Bacteria 3141
373 Ga0207700_10010411 3300025928 Bacteria 5867
374 Ga0207700_10015613 3300025928 Bacteria 5016
375 Ga0207700_10036619 3300025928 Bacteria 3547
376 Ga0207700_10159423 3300025928 Bacteria 1873
377 Ga0207700_10394235 3300025928 Bacteria 1212
378 Ga0207664_10009373 3300025929 Bacteria 6867
379 Ga0207664_10015854 3300025929 Bacteria 5486
380 Ga0207664_10134989 3300025929 Bacteria 2081
381 Ga0207664_10160377 3300025929 Bacteria 1918
382 Ga0207664_10508323 3300025929 Bacteria 1079
383 Ga0207644_10010849 3300025931 Bacteria 6015
384 Ga0207644_10014416 3300025931 Bacteria 5288
385 Ga0207644_10015490 3300025931 Bacteria 5119
386 Ga0207644_10103945 3300025931 Bacteria 2138
387 Ga0207690_10042995 3300025932 Bacteria 2971
388 Ga0207690_10166598 3300025932 Bacteria 1647
389 Ga0207690_10352325 3300025932 Bacteria 1164
390 Ga0207706_10053246 3300025933 Bacteria 3573
391 Ga0207686_10058449 3300025934 Bacteria 2431
392 Ga0207686_10454499 3300025934 Bacteria 986
393 Ga0207709_10516106 3300025935 Bacteria 935
394 Ga0207670_10173526 3300025936 Bacteria 1618
395 Ga0207669_10125310 3300025937 Bacteria 1753
396 Ga0207669_10158948 3300025937 Bacteria 1593
397 Ga0207669_10282044 3300025937 Bacteria 1253
398 Ga0207665_10052801 3300025939 Bacteria 2739
399 Ga0207691_10000016 3300025940 Bacteria 141024
400 Ga0207691_10000403 3300025940 Bacteria 43257
401 Ga0207691_10004470 3300025940 Bacteria 13543
402 Ga0207691_10005992 3300025940 Bacteria 11740
403 Ga0207691_10049904 3300025940 Bacteria 3833
404 Ga0207691_10094699 3300025940 Bacteria 2672
405 Ga0207711_10000115 3300025941 Bacteria 83472
406 Ga0207711_10415327 3300025941 Bacteria 1251
407 Ga0207711_10557049 3300025941 Bacteria 1069
408 Ga0207689_10007197 3300025942 Bacteria 9773
409 Ga0207689_10013293 3300025942 Bacteria 7022
410 Ga0207689_10237980 3300025942 Bacteria 1505
411 Ga0207661_10145483 3300025944 Bacteria 2044
412 Ga0207679_10151487 3300025945 Bacteria 1888
413 Ga0207679_10184331 3300025945 Bacteria 1729
414 Ga0207679_10297700 3300025945 Bacteria 1389
415 Ga0207679_10392443 3300025945 Bacteria 1219
416 Ga0207667_10071924 3300025949 Bacteria 3595
417 Ga0207667_10106771 3300025949 Bacteria 2888
418 Ga0207651_10000427 3300025960 Bacteria 17939
419 Ga0207651_10020040 3300025960 Bacteria 4025
420 Ga0207651_10026974 3300025960 Bacteria 3600
421 Ga0207651_10029467 3300025960 Bacteria 3478
422 Ga0207651_10035670 3300025960 Bacteria 3238
423 Ga0207668_10045746 3300025972 Bacteria 2986
424 Ga0207668_10097017 3300025972 Bacteria 2180
425 Ga0207668_10111456 3300025972 Bacteria 2054
426 Ga0207668_10182993 3300025972 Bacteria 1654
427 Ga0207640_10009888 3300025981 Bacteria 5355
428 Ga0207640_10023654 3300025981 Bacteria 3695
429 Ga0207640_10035643 3300025981 Bacteria 3115
430 Ga0207640_10056033 3300025981 Bacteria 2585
431 Ga0207640_10464380 3300025981 Bacteria 1046
432 Ga0207658_10017552 3300025986 Bacteria 4934
433 Ga0207658_10027345 3300025986 Bacteria 4006
434 Ga0207658_10105780 3300025986 Bacteria 2214
435 Ga0207658_10251010 3300025986 Bacteria 1503
436 Ga0207677_10000210 3300026023 Bacteria 47077
437 Ga0207677_10010883 3300026023 Bacteria 5163
438 Ga0207677_10106146 3300026023 Bacteria 2080
439 Ga0207677_10413495 3300026023 Bacteria 1147
440 Ga0207703_10000438 3300026035 Bacteria 43827
441 Ga0207639_10047455 3300026041 Bacteria 3246
442 Ga0207639_10120046 3300026041 Bacteria 2158
443 Ga0207639_10214358 3300026041 Bacteria 1659
444 Ga0207639_10419124 3300026041 Bacteria 1210
445 Ga0207678_10045920 3300026067 Bacteria 3777
446 Ga0207678_10150957 3300026067 Bacteria 1984
447 Ga0207678_10153548 3300026067 Bacteria 1966
448 Ga0207678_10272028 3300026067 Bacteria 1453
449 Ga0207708_10033508 3300026075 Bacteria 3903
450 Ga0207702_10016093 3300026078 Bacteria 6192
451 Ga0207702_10028889 3300026078 Bacteria 4611
452 Ga0207702_10056716 3300026078 Bacteria 3326
453 Ga0207702_10449489 3300026078 Bacteria 1250
454 Ga0207702_10461156 3300026078 Bacteria 1234
455 Ga0207702_10909325 3300026078 Bacteria 872
456 Ga0207641_10001573 3300026088 Bacteria 22307
457 Ga0207641_10047920 3300026088 Bacteria 3605
458 Ga0207641_10513885 3300026088 Bacteria 1164
459 Ga0207648_10022497 3300026089 Bacteria 5658
460 Ga0207648_10105331 3300026089 Bacteria 2474
461 Ga0207648_10377093 3300026089 Bacteria 1282
462 Ga0207648_10428040 3300026089 Bacteria 1203
463 Ga0207676_10000415 3300026095 Bacteria 36094
464 Ga0207676_10013255 3300026095 Bacteria 5921
465 Ga0207676_10047895 3300026095 Bacteria 3315
466 Ga0207676_10078201 3300026095 Bacteria 2678
467 Ga0207676_10410373 3300026095 Bacteria 1268
468 Ga0207676_10665449 3300026095 Bacteria 1006
469 Ga0207674_10000237 3300026116 Bacteria 68721
470 Ga0207674_10006274 3300026116 Bacteria 14012
471 Ga0207674_10050952 3300026116 Bacteria 4226
472 Ga0207674_10156279 3300026116 Bacteria 2236
473 Ga0207674_10705792 3300026116 Bacteria 974
474 Ga0207675_100028498 3300026118 Bacteria 5199
475 Ga0207675_100032081 3300026118 Bacteria 4893
476 Ga0207675_100046380 3300026118 Bacteria 4060
477 Ga0207675_100143050 3300026118 Bacteria 2273
478 Ga0207675_100272663 3300026118 Bacteria 1642
479 Ga0207683_10000322 3300026121 Bacteria 43758
480 Ga0207683_10005374 3300026121 Bacteria 10981
481 Ga0207683_10038415 3300026121 Bacteria 4172
482 Ga0207683_10322733 3300026121 Bacteria 1415
483 Ga0207698_10012505 3300026142 Bacteria 5558
484 Ga0207698_10086819 3300026142 Bacteria 2546
485 Ga0207698_10093281 3300026142 Bacteria 2471
486 Ga0207698_10115819 3300026142 Bacteria 2258
487 Ga0207698_10147089 3300026142 Bacteria 2039
488 Ga0207698_10260853 3300026142 Bacteria 1592
489 Ga0268266_10008005 3300028379 Bacteria 9450
490 Ga0268266_10027867 3300028379 Bacteria 4803
491 Ga0268266_10049569 3300028379 Bacteria 3601
492 Ga0268266_10142775 3300028379 Bacteria 2150
493 Ga0268266_10277195 3300028379 Bacteria 1558
494 Ga0268265_10038952 3300028380 Bacteria 3500
495 Ga0268265_10469516 3300028380 Bacteria 1179
496 Ga0268264_10001696 3300028381 Bacteria 20279
497 Ga0268264_10092407 3300028381 Bacteria 2612
498 Ga0268264_10351872 3300028381 Bacteria 1402
499 Ga0268264_10395140 3300028381 Bacteria 1327
500 Ga0268264_10558636 3300028381 Bacteria 1123
501 Ga0268264_10668912 3300028381 Bacteria 1029
502 Ga0268264_10735130 3300028381 Bacteria 982
503 Ga0265332_10002744 3300031238 Bacteria 8776
504 Ga0265325_10034431 3300031241 Bacteria 2694
505 Ga0265329_10022400 3300031242 Bacteria 2114
506 Ga0265331_10016184 3300031250 Bacteria 3920
507 Ga0265327_10015235 3300031251 Bacteria 4978
508 Ga0265316_10297821 3300031344 Bacteria 1175
509 Ga0307516_10031515 3300031730 Bacteria 5343
510 Ga0307413_10174906 3300031824 Bacteria 1524
511 Ga0307410_10191898 3300031852 Bacteria 1554
512 Ga0307412_10222448 3300031911 Bacteria 1448
513 Ga0307412_10376139 3300031911 Bacteria 1148
514 Ga0307409_100029964 3300031995 Bacteria 3903
515 Ga0307416_100301141 3300032002 Bacteria 1594
516 Ga0307414_10130847 3300032004 Bacteria 1948
517 Ga0307411_10006056 3300032005 Bacteria 6013
518 Ga0307411_10125323 3300032005 Bacteria 1867
519 Ga0373928_0022491 3300035084 Bacteria 1338
520 Ga0373934_0021469 3300035086 Bacteria 2485
521 Ga0373936_0145769 3300035113 Bacteria 1024
522 Ga0373953_0097056 3300035117 Bacteria 1237
523 Ga0373954_0003066 3300035118 Bacteria 7055
524 Ga0373956_0134589 3300035119 Bacteria 1158
525 Ga0373957_0003850 3300035120 Bacteria 4500
526 Ga0373943_0033714 3300035170 Bacteria 2441
527 Ga0373946_0114061 3300035171 Bacteria 1226
528 Ga0373955_0003010 3300035172 Bacteria 7384
529 Ga0373924_0006705 3300035410 Bacteria 4134
530 Ga0373931_0044303 3300035691 Bacteria 2346
531 Ga0373927_0080462 3300035695 Bacteria 2111
532 Ga0373933_0015824 3300035724 Bacteria 4209
533 Ga0373933_0026781 3300035724 Bacteria 3314
534 Ga0373947_0032374 3300035725 Bacteria 3081
535 Ga0373937_0009175 3300036401 Bacteria 8586
536 Ga0373937_0024904 3300036401 Bacteria 5401
537 Ga0373937_0524797 3300036401 Bacteria 1125
538 Ga0373925_0059311 3300037068 Bacteria 2870
539 Ga0373925_0112638 3300037068 Bacteria 2103
540 Ga0395899_0104107 3300037312 Bacteria 2046
541 Ga0395900_0341325 3300037418 Bacteria 1473
542 Ga0395898_0199776 3300037466 Bacteria 1909
543 Ga0395901_0069237 3300038443 Bacteria 3675
544 Ga0395901_0324675 3300038443 Bacteria 1592
545 Ga0451577_0002330 3300042876 Bacteria 22882
546 Ga0451577_0423642 3300042876 Bacteria 1209
547 Ga0453683_0086917 3300044673 Bacteria 1959
548 Ga0466963_0021552 3300044694 Bacteria 4068
549 Ga0453684_0008886 3300044712 Bacteria 17799
550 Ga0453684_0110465 3300044712 Bacteria 3341
551 Ga0451576_0002999 3300045051 Bacteria 23862
552 Ga0451576_0315382 3300045051 Bacteria 1636
553 Ga0451576_0320270 3300045051 Bacteria 1622
554 Ga0495629_0106737 3300046459 Bacteria 1953
555 Ga0495651_0360249 3300046462 Bacteria 959
556 Ga0495580_0119055 3300046472 Bacteria 1833
557 Ga0495639_0053629 3300046475 Bacteria 1837
558 Ga0495662_0056805 3300046476 Bacteria 1890
559 Ga0495594_0097429 3300046499 Bacteria 1653
560 Ga0495606_0037758 3300046507 Bacteria 3276
561 Ga0495606_0053060 3300046507 Bacteria 2632
562 Ga0495630_0083896 3300046517 Bacteria 2406
563 Ga0495654_0021588 3300046530 Bacteria 3348
564 Ga0495665_0010339 3300046531 Bacteria 5050
565 Ga0495640_0211486 3300046533 Bacteria 1226
566 Ga0495609_0101809 3300046538 Bacteria 1244
567 Ga0495645_0088355 3300046543 Bacteria 2217
568 Ga0495645_0228964 3300046543 Bacteria 1246
569 Ga0495635_0043202 3300046663 Bacteria 3110
570 Ga0495659_0000122 3300046664 Bacteria 34041
571 Ga0495623_0059055 3300046679 Bacteria 2410
572 Ga0495613_0024468 3300046689 Bacteria 4499
573 Ga0495671_0000430 3300046692 Bacteria 33279
574 Ga0495660_0002980 3300046810 Bacteria 10569
575 Ga0495674_0491516 3300047319 Bacteria 982
576 Ga0495672_0000176 3300047320 Bacteria 92728
577 Ga0495676_0508718 3300047321 Bacteria 790
578 Ga0495680_0037414 3300047322 Bacteria 3887
579 Ga0495675_0079181 3300047444 Bacteria 2070
580 Ga0495684_0039104 3300047471 Bacteria 3636
581 Ga0495684_0334449 3300047471 Bacteria 1079
582 Ga0495686_0009713 3300047472 Bacteria 6907
583 Ga0495602_0219067 3300048088 Bacteria 1438
584 Ga0495614_0012737 3300048089 Bacteria 3690
585 Ga0496100_0064502 3300048903 Bacteria 2424
586 Ga0496101_0010694 3300048904 Bacteria 6065
587 Ga0496101_0462870 3300048904 Bacteria 1001
588 Ga0496104_0023522 3300048907 Bacteria 5665
589 Ga0496105_0019861 3300048908 Bacteria 5421
590 Ga0496106_0101829 3300048909 Bacteria 2228
591 Ga0496106_0653294 3300048909 Bacteria 840
592 Ga0496109_0020289 3300048912 Bacteria 5869
593 Ga0496109_0408504 3300048912 Bacteria 1283
594 Ga0496110_0137917 3300048913 Bacteria 2205
595 Ga0496112_0002173 3300048915 Bacteria 15586
596 Ga0496112_0026219 3300048915 Bacteria 5605
597 Ga0496112_0154404 3300048915 Bacteria 2263
598 Ga0496114_0028308 3300048917 Bacteria 4597
599 Ga0496114_0362275 3300048917 Bacteria 1283
600 Ga0496125_0182914 3300048928 Bacteria 1394
601 Ga0501310_002663 3300049130 Bacteria 1706
602 Ga0501033_0171338 3300049570 Bacteria 1559
603 Ga0501038_0445391 3300049574 Bacteria 996
604 Ga0501040_0247710 3300049576 Bacteria 1271
605 Ga0501067_0037399 3300049583 Bacteria 2696
606 Ga0501219_012304 3300049703 Bacteria 662
607 Ga0501035_0006955 3300049822 Bacteria 10565
608 Ga0501044_0001056 3300049823 Bacteria 33138
609 Ga0501045_0437962 3300049824 Bacteria 972
610 nmdc:mga0rr50_88706_c1 3300050513 Bacteria 2403
611 nmdc:mga08x19_30093_c1 3300050514 Bacteria 3409
612 nmdc:mga08x19_49289_c1 3300050514 Bacteria 2700
613 Ga0495612_0017904 3300053078 Bacteria 2836
614 Ga0495619_0005152 3300053085 Bacteria 8295
615 Ga0500634_0016000 3300053161 Bacteria 3997
616 Ga0587093_025330 3300059478 Bacteria 822
617 Ga0587090_040772 3300059510 Bacteria 816
618 Ga0587113_010239 3300059625 Bacteria 862
619 Ga0587115_014942 3300059626 Bacteria 1022
620 Ga0587128_026143 3300059630 Bacteria 934
621 Ga0587068_031069 3300059641 Bacteria 926
622 Ga0587075_017360 3300059644 Bacteria 1034
623 Ga0587078_016403 3300059646 Bacteria 902
624 2644357137 2643221664 Bacteria 7272945
625 2738741600 2738541280 Bacteria 6630198
626 2738843784 2738541300 Bacteria 6675882
627 2739275135 2738543018 Bacteria 6718814
628 2739344179 2738543030 Bacteria 6719714
629 2887377906 2887375801 Bacteria 5334027
630 Ga0105237_10304412
631 JGI24748J21848_1012936
632 Ga0070658_10622671
633 Ga0070676_10000975
634 Ga0070676_10290665
635 Ga0070676_10341499
636 Ga0070676_10362219
637 Ga0070683_100081264
638 Ga0070683_100093131
639 Ga0070683_100171932
640 Ga0070690_100024054
641 Ga0070670_100030196
642 Ga0070670_100031567
643 Ga0070670_100034350
644 Ga0070670_100118242
645 Ga0070670_100155446
646 Ga0070670_100284706
647 Ga0070677_10000807
648 Ga0070677_10114922
649 Ga0068869_100072952
650 Ga0068869_100087312
651 Ga0068869_100100776
652 Ga0070666_10001239
653 Ga0070666_10009140
654 Ga0070680_100046206
655 Ga0070680_100212762
656 Ga0070682_100069975
657 Ga0068868_100001857
658 Ga0068868_100005645
659 Ga0068868_100173623
660 Ga0070660_100014044
661 Ga0070660_100100830
662 Ga0070660_100164259
663 Ga0070660_100332316
664 Ga0070689_100003142
665 Ga0070689_100669986
666 Ga0070661_100085770
667 Ga0070661_100161304
668 Ga0070661_100219051
669 Ga0070692_10036823
670 Ga0070692_10390545
671 Ga0070668_100009765
672 Ga0070668_100011053
673 Ga0070668_100024428
674 Ga0070668_100092604
675 Ga0070669_100130606
676 Ga0070675_100013624
677 Ga0070675_100028134
678 Ga0070675_100030634
679 Ga0070675_100261794
680 Ga0070671_100002986
681 Ga0070671_100013348
682 Ga0070671_100052646
683 Ga0070671_100297517
684 Ga0070671_100346011
685 Ga0070674_100014547
686 Ga0070674_100065882
687 Ga0070674_100086827
688 Ga0070674_100401046
689 Ga0070673_100005623
690 Ga0070673_100005830
691 Ga0070673_100043334
692 Ga0070673_100051987
693 Ga0070673_100124315
694 Ga0070688_100000458
695 Ga0070688_100204330
696 Ga0070659_100124663
697 Ga0070659_100147820
698 Ga0070659_100165857
699 Ga0070659_100288401
700 Ga0070667_100003537
701 Ga0070667_100013731
702 Ga0070667_100237462
703 Ga0070667_100267578
704 Ga0070709_10001951
705 Ga0070714_100009134
706 Ga0070714_100040356
707 Ga0070714_100209573
708 Ga0070714_100738068
709 Ga0070714_100854003
710 Ga0070713_100002402
711 Ga0070713_100020507
712 Ga0070713_100142839
713 Ga0070713_100214158
714 Ga0070710_10036498
715 Ga0070701_10012622
716 Ga0070711_100003780
717 Ga0070711_100239915
718 Ga0070694_100037166
719 Ga0070708_100054327
720 Ga0070663_100008281
721 Ga0070663_100123186
722 Ga0070663_100146392
723 Ga0070663_100238322
724 Ga0070678_100001518
725 Ga0070678_100007823
726 Ga0070678_100093439
727 Ga0070662_100084522
728 Ga0070662_100316928
729 Ga0070662_100788667
730 Ga0070681_10005398
731 Ga0070681_10008601
732 Ga0070681_10217907
733 Ga0070681_10348590
734 Ga0068867_100008965
735 Ga0068867_100026811
736 Ga0068867_100487133
737 Ga0070685_10008324
738 Ga0070685_10225443
739 Ga0070707_100071004
740 Ga0070698_100589264
741 Ga0070699_100023002
742 Ga0070699_100046715
743 Ga0070679_100011162
744 Ga0070679_100046471
745 Ga0070679_100151429
746 Ga0070679_100215667
747 Ga0070679_100310377
748 Ga0070684_100042537
749 Ga0070684_100081329
750 Ga0070697_100013500
751 Ga0068853_100046600
752 Ga0068853_100178978
753 Ga0068853_100222230
754 Ga0068853_100400438
755 Ga0070672_100000308
756 Ga0070672_100002977
757 Ga0070672_100023780
758 Ga0070672_100028844
759 Ga0070672_100039503
760 Ga0070672_100079170
761 Ga0070686_100040050
762 Ga0070696_100035587
763 Ga0070696_100064816
764 Ga0070693_100024807
765 Ga0070665_100001417
766 Ga0070665_100001524
767 Ga0070665_100007532
768 Ga0070665_100021232
769 Ga0070665_100089954
770 Ga0068855_100001119
771 Ga0070664_100000934
772 Ga0070664_100067175
773 Ga0070664_100271007
774 Ga0070664_100595648
775 Ga0068857_100002116
776 Ga0068857_100028759
777 Ga0068857_100160467
778 Ga0068854_100003623
779 Ga0068854_100021061
780 Ga0068854_100029133
781 Ga0068854_100193172
782 Ga0068856_100006845
783 Ga0068856_100013862
784 Ga0068856_100185290
785 Ga0068852_100000768
786 Ga0068852_100012670
787 Ga0068852_100112895
788 Ga0068852_100147553
789 Ga0068852_100150540
790 Ga0068859_100002028
791 Ga0068859_100156595
792 Ga0068859_100302767
793 Ga0068864_100000455
794 Ga0068864_100000740
795 Ga0068864_100063009
796 Ga0068864_100177810
797 Ga0068864_100502645
798 Ga0068864_100649693
799 Ga0068866_10000548
800 Ga0068866_10208924
801 Ga0068861_100207468
802 Ga0068861_100307053
803 Ga0068861_100489192
804 Ga0068851_10006873
805 Ga0068851_10078478
806 Ga0068870_10004919
807 Ga0068863_100009317
808 Ga0068863_100036668
809 Ga0068863_100050940
810 Ga0068863_100401422
811 Ga0068863_100670217
812 Ga0068858_100000850
813 Ga0068858_100032194
814 Ga0068858_100141381
815 Ga0068858_100389535
816 Ga0068858_100452841
817 Ga0068860_100008471
818 Ga0068860_100022393
819 Ga0068860_100353651
820 Ga0068860_100399763
821 Ga0068862_100029944
822 Ga0068862_100111823
823 Ga0081455_10172117
824 Ga0070716_100011269
825 Ga0070712_100004102
826 Ga0070712_100255614
827 Ga0075366_10133174
828 Ga0097621_100005686
829 Ga0097621_100027814
830 Ga0097621_100072662
831 Ga0097621_100419683
832 Ga0097621_100456682
833 Ga0068871_100050572
834 Ga0068871_100285365
835 Ga0075428_100170197
836 Ga0075428_100235058
837 Ga0075434_100110026
838 Ga0068865_100085048
839 Ga0068865_100138120
840 Ga0068865_100195897
841 Ga0097620_100002027
842 Ga0097620_100156598
843 Ga0097620_100302747
844 Ga0075435_100043986
845 Ga0105240_10000332
846 Ga0105240_10090010
847 Ga0105240_10090143
848 Ga0105240_10810231
849 Ga0105245_10013288
850 Ga0105245_10189531
851 Ga0105247_10029095
852 Ga0105243_10057543
853 Ga0105241_10004491
854 Ga0105241_10024851
855 Ga0105241_10044096
856 Ga0105248_10032092
857 Ga0105248_10121389
858 Ga0105248_10310224
859 Ga0105248_10354239
860 Ga0105248_10860738
861 Ga0105237_10028957
862 Ga0105238_10000244
863 Ga0105238_10198644
864 Ga0105239_10073547
865 Ga0105239_10092064
866 Ga0105246_10051342
867 Ga0105246_10395288
868 Ga0157373_10019865
869 Ga0157373_10024332
870 Ga0157373_10051274
871 Ga0157373_10370840
872 Ga0157373_10485500
873 Ga0157371_10023665
874 Ga0157371_10253857
875 Ga0157370_10005883
876 Ga0157370_10009707
877 Ga0157370_10026468
878 Ga0157370_10279217
879 Ga0157370_10553279
880 Ga0157369_10005394
881 Ga0157369_10194997
882 Ga0157369_10201144
883 Ga0157369_10787895
884 Ga0157374_10003271
885 Ga0157374_10215666
886 Ga0157374_10807317
887 Ga0157378_10005893
888 Ga0157378_10064824
889 Ga0157378_10137993
890 Ga0157378_10165684
891 Ga0163162_10020054
892 Ga0163162_10061410
893 Ga0163162_10169699
894 Ga0163162_10290493
895 Ga0163162_10343862
896 Ga0163162_10510112
897 Ga0157372_10002879
898 Ga0157372_10057898
899 Ga0157372_10132165
900 Ga0157372_10271123
901 Ga0157375_10006021
902 Ga0157375_10011902
903 Ga0157375_10035555
904 Ga0157375_10068797
905 Ga0157375_10243716
906 Ga0157375_10439583
907 Ga0163163_10000310
908 Ga0163163_10043746
909 Ga0163163_10349037
910 Ga0157380_10043712
911 Ga0182008_10067352
912 Ga0182008_10082404
913 Ga0157377_10126571
914 Ga0157377_10451438
915 Ga0157379_10000626
916 Ga0157379_10136790
917 Ga0157376_10005464
918 Ga0157376_10111908
919 Ga0157376_10234134
920 Ga0157376_10358740
921 Ga0163161_10038381
922 Ga0163161_10293990
923 Ga0197907_10357466
924 Ga0206356_10470992
925 Ga0206350_10016023
926 Ga0206354_10100971
927 Ga0154015_1377351
928 Ga0154015_1531000
929 Ga0224712_10100485
930 Ga0207697_10022631
931 Ga0207656_10025393
932 Ga0207682_10000061
933 Ga0207682_10115312
934 Ga0207692_10283412
935 Ga0207642_10029855
936 Ga0207710_10272210
937 Ga0207688_10013116
938 Ga0207688_10180618
939 Ga0207680_10004784
940 Ga0207680_10014384
941 Ga0207680_10286128
942 Ga0207680_10368882
943 Ga0207699_10134270
944 Ga0207645_10002609
945 Ga0207643_10005370
946 Ga0207643_10031149
947 Ga0207643_10190550
948 Ga0207643_10238416
949 Ga0207705_10083383
950 Ga0207705_10085213
951 Ga0207705_10274479
952 Ga0207705_10480875
953 Ga0207705_10551014
954 Ga0207654_10129434
955 Ga0207654_10238568
956 Ga0207707_10013250
957 Ga0207707_10033435
958 Ga0207707_10109658
959 Ga0207707_10403609
960 Ga0207695_10039493
961 Ga0207695_10066294
962 Ga0207695_10111471
963 Ga0207695_10220565
964 Ga0207671_10283072
965 Ga0207693_10000485
966 Ga0207693_10055636
967 Ga0207693_10171803
968 Ga0207693_10363514
969 Ga0207663_10041522
970 Ga0207660_10114229
971 Ga0207660_10337101
972 Ga0207660_10455997
973 Ga0207662_10054613
974 Ga0207662_10146324
975 Ga0207657_10000240
976 Ga0207657_10002577
977 Ga0207657_10701394
978 Ga0207649_10042056
979 Ga0207649_10069389
980 Ga0207649_10089399
981 Ga0207652_10008752
982 Ga0207652_10050689
983 Ga0207652_10174010
984 Ga0207652_10343166
985 Ga0207652_10493927
986 Ga0207652_10640028
987 Ga0207681_10024021
988 Ga0207681_10083649
989 Ga0207694_10171593
990 Ga0207694_10373780
991 Ga0207650_10020951
992 Ga0207650_10021783
993 Ga0207650_10066683
994 Ga0207650_10183340
995 Ga0207659_10019552
996 Ga0207659_10029096
997 Ga0207659_10073026
998 Ga0207659_10089151
999 Ga0207659_10195386
1000 Ga0207687_10001442
1001 Ga0207687_10042059
1002 Ga0207700_10010411
1003 Ga0207700_10015613
1004 Ga0207700_10036619
1005 Ga0207700_10159423
1006 Ga0207700_10394235
1007 Ga0207664_10009373
1008 Ga0207664_10015854
1009 Ga0207664_10134989
1010 Ga0207664_10160377
1011 Ga0207664_10508323
1012 Ga0207644_10010849
1013 Ga0207644_10014416
1014 Ga0207644_10015490
1015 Ga0207644_10103945
1016 Ga0207690_10042995
1017 Ga0207690_10166598
1018 Ga0207690_10352325
1019 Ga0207706_10053246
1020 Ga0207686_10058449
1021 Ga0207686_10454499
1022 Ga0207709_10516106
1023 Ga0207670_10173526
1024 Ga0207669_10125310
1025 Ga0207669_10158948
1026 Ga0207669_10282044
1027 Ga0207665_10052801
1028 Ga0207691_10000016
1029 Ga0207691_10000403
1030 Ga0207691_10004470
1031 Ga0207691_10005992
1032 Ga0207691_10049904
1033 Ga0207691_10094699
1034 Ga0207711_10000115
1035 Ga0207711_10415327
1036 Ga0207711_10557049
1037 Ga0207689_10007197
1038 Ga0207689_10013293
1039 Ga0207689_10237980
1040 Ga0207661_10145483
1041 Ga0207679_10151487
1042 Ga0207679_10184331
1043 Ga0207679_10297700
1044 Ga0207679_10392443
1045 Ga0207667_10071924
1046 Ga0207667_10106771
1047 Ga0207651_10000427
1048 Ga0207651_10020040
1049 Ga0207651_10026974
1050 Ga0207651_10029467
1051 Ga0207651_10035670
1052 Ga0207668_10045746
1053 Ga0207668_10097017
1054 Ga0207668_10111456
1055 Ga0207668_10182993
1056 Ga0207640_10009888
1057 Ga0207640_10023654
1058 Ga0207640_10035643
1059 Ga0207640_10056033
1060 Ga0207640_10464380
1061 Ga0207658_10017552
1062 Ga0207658_10027345
1063 Ga0207658_10105780
1064 Ga0207658_10251010
1065 Ga0207677_10000210
1066 Ga0207677_10010883
1067 Ga0207677_10106146
1068 Ga0207677_10413495
1069 Ga0207703_10000438
1070 Ga0207639_10047455
1071 Ga0207639_10120046
1072 Ga0207639_10214358
1073 Ga0207639_10419124
1074 Ga0207678_10045920
1075 Ga0207678_10150957
1076 Ga0207678_10153548
1077 Ga0207678_10272028
1078 Ga0207708_10033508
1079 Ga0207702_10016093
1080 Ga0207702_10028889
1081 Ga0207702_10056716
1082 Ga0207702_10449489
1083 Ga0207702_10461156
1084 Ga0207702_10909325
1085 Ga0207641_10001573
1086 Ga0207641_10047920
1087 Ga0207641_10513885
1088 Ga0207648_10022497
1089 Ga0207648_10105331
1090 Ga0207648_10377093
1091 Ga0207648_10428040
1092 Ga0207676_10000415
1093 Ga0207676_10013255
1094 Ga0207676_10047895
1095 Ga0207676_10078201
1096 Ga0207676_10410373
1097 Ga0207676_10665449
1098 Ga0207674_10000237
1099 Ga0207674_10006274
1100 Ga0207674_10050952
1101 Ga0207674_10156279
1102 Ga0207674_10705792
1103 Ga0207675_100028498
1104 Ga0207675_100032081
1105 Ga0207675_100046380
1106 Ga0207675_100143050
1107 Ga0207675_100272663
1108 Ga0207683_10000322
1109 Ga0207683_10005374
1110 Ga0207683_10038415
1111 Ga0207683_10322733
1112 Ga0207698_10012505
1113 Ga0207698_10086819
1114 Ga0207698_10093281
1115 Ga0207698_10115819
1116 Ga0207698_10147089
1117 Ga0207698_10260853
1118 Ga0268266_10008005
1119 Ga0268266_10027867
1120 Ga0268266_10049569
1121 Ga0268266_10142775
1122 Ga0268266_10277195
1123 Ga0268265_10038952
1124 Ga0268265_10469516
1125 Ga0268264_10001696
1126 Ga0268264_10092407
1127 Ga0268264_10351872
1128 Ga0268264_10395140
1129 Ga0268264_10558636
1130 Ga0268264_10668912
1131 Ga0268264_10735130
1132 Ga0265332_10002744
1133 Ga0265325_10034431
1134 Ga0265329_10022400
1135 Ga0265331_10016184
1136 Ga0265327_10015235
1137 Ga0265316_10297821
1138 Ga0307516_10031515
1139 Ga0307413_10174906
1140 Ga0307410_10191898
1141 Ga0307412_10222448
1142 Ga0307412_10376139
1143 Ga0307409_100029964
1144 Ga0307416_100301141
1145 Ga0307414_10130847
1146 Ga0307411_10006056
1147 Ga0307411_10125323
1148 Ga0373928_0022491
1149 Ga0373934_0021469
1150 Ga0373936_0145769
1151 Ga0373953_0097056
1152 Ga0373954_0003066
1153 Ga0373956_0134589
1154 Ga0373957_0003850
1155 Ga0373943_0033714
1156 Ga0373946_0114061
1157 Ga0373955_0003010
1158 Ga0373924_0006705
1159 Ga0373931_0044303
1160 Ga0373927_0080462
1161 Ga0373933_0015824
1162 Ga0373933_0026781
1163 Ga0373947_0032374
1164 Ga0373937_0009175
1165 Ga0373937_0024904
1166 Ga0373937_0524797
1167 Ga0373925_0059311
1168 Ga0373925_0112638
1169 Ga0395899_0104107
1170 Ga0395900_0341325
1171 Ga0395898_0199776
1172 Ga0395901_0069237
1173 Ga0395901_0324675
1174 Ga0451577_0002330
1175 Ga0451577_0423642
1176 Ga0453683_0086917
1177 Ga0466963_0021552
1178 Ga0453684_0008886
1179 Ga0453684_0110465
1180 Ga0451576_0002999
1181 Ga0451576_0315382
1182 Ga0451576_0320270
1183 Ga0495629_0106737
1184 Ga0495651_0360249
1185 Ga0495580_0119055
1186 Ga0495639_0053629
1187 Ga0495662_0056805
1188 Ga0495594_0097429
1189 Ga0495606_0037758
1190 Ga0495606_0053060
1191 Ga0495630_0083896
1192 Ga0495654_0021588
1193 Ga0495665_0010339
1194 Ga0495640_0211486
1195 Ga0495609_0101809
1196 Ga0495645_0088355
1197 Ga0495645_0228964
1198 Ga0495635_0043202
1199 Ga0495659_0000122
1200 Ga0495623_0059055
1201 Ga0495613_0024468
1202 Ga0495671_0000430
1203 Ga0495660_0002980
1204 Ga0495674_0491516
1205 Ga0495672_0000176
1206 Ga0495676_0508718
1207 Ga0495680_0037414
1208 Ga0495675_0079181
1209 Ga0495684_0039104
1210 Ga0495684_0334449
1211 Ga0495686_0009713
1212 Ga0495602_0219067
1213 Ga0495614_0012737
1214 Ga0496100_0064502
1215 Ga0496101_0010694
1216 Ga0496101_0462870
1217 Ga0496104_0023522
1218 Ga0496105_0019861
1219 Ga0496106_0101829
1220 Ga0496106_0653294
1221 Ga0496109_0020289
1222 Ga0496109_0408504
1223 Ga0496110_0137917
1224 Ga0496112_0002173
1225 Ga0496112_0026219
1226 Ga0496112_0154404
1227 Ga0496114_0028308
1228 Ga0496114_0362275
1229 Ga0496125_0182914
1230 Ga0501310_002663
1231 Ga0501033_0171338
1232 Ga0501038_0445391
1233 Ga0501040_0247710
1234 Ga0501067_0037399
1235 Ga0501219_012304
1236 Ga0501035_0006955
1237 Ga0501044_0001056
1238 Ga0501045_0437962
1239 nmdc:mga0rr50_88706_c1
1240 nmdc:mga08x19_30093_c1
1241 nmdc:mga08x19_49289_c1
1242 Ga0495612_0017904
1243 Ga0495619_0005152
1244 Ga0500634_0016000
1245 Ga0587093_025330
1246 Ga0587090_040772
1247 Ga0587113_010239
1248 Ga0587115_014942
1249 Ga0587128_026143
1250 Ga0587068_031069
1251 Ga0587075_017360
1252 Ga0587078_016403
1253 2644357137
1254 2738741600
1255 2738843784
1256 2739275135
1257 2739344179
1258 2887377906

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01027

Bax1-I

Inhibitor of apoptosis-promoting Bax1

39

242

0.88

Map