F470622

General Info

Members Datasets Scaffolds Average Seq Length
628 283 1256 90

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_101212651|Ga0070682_1012126512
Length 106
Sequence VVLSFPRPQPGRSVEHMPSYLVETYLARDQMSALAARERRAHSAAQELTEGTTRVRFDRSIHVPEDEICFYVFDAPSVRVATEAAERAGLAPIRVVEAVSSGEERR

Samples

Sample ID Description Type Environment
1 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
165 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
166 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
169 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
170 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
179 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
180 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
181 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
182 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
183 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
184 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
185 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
186 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
187 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
188 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
189 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
190 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
191 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
192 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
193 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
194 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
195 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
196 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
197 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
198 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
199 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
200 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
201 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
202 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
203 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
204 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
205 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
206 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
207 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
208 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
209 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
210 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
211 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
212 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
213 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
214 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
215 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
216 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
217 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
218 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
219 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
220 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
221 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
222 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
223 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
224 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
225 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
226 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
227 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
228 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
229 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
230 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
231 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
232 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
233 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
234 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
235 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
236 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
237 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
238 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
239 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
240 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
241 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
242 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
243 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
244 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
245 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
246 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
247 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
248 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
249 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
250 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
251 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
252 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
253 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
254 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
255 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
256 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
257 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
258 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
259 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
260 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
261 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
262 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
263 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
264 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
265 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
266 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
268 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
269 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
270 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
271 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
272 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
273 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
274 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
275 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
276 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
277 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
278 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
279 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
280 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
281 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
282 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
283 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.48
Nodule 0
Rhizoplane 11.94
Rhizosphere 86.62
Stem 0
Stem Tuber 0
Unclassified 25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070682_101212651 3300005337 Bacteria 637
2 JGI24747J21853_1045065 3300001978 Unclassified 529
3 JGI24744J21845_10000410 3300002077 Bacteria 7442
4 Ga0070658_10672549 3300005327 Bacteria 898
5 Ga0070683_100006137 3300005329 Bacteria 10075
6 Ga0070683_100272382 3300005329 Bacteria 1610
7 Ga0070683_102408302 3300005329 Bacteria 504
8 Ga0070690_100012069 3300005330 Bacteria 5074
9 Ga0070690_100506397 3300005330 Bacteria 904
10 Ga0070670_100693959 3300005331 Unclassified 915
11 Ga0070680_100030305 3300005336 Bacteria 4346
12 Ga0070682_100007934 3300005337 Bacteria 5972
13 Ga0070682_100063983 3300005337 Bacteria 2334
14 Ga0068868_100037618 3300005338 Bacteria 3753
15 Ga0068868_100218460 3300005338 Bacteria 1595
16 Ga0068868_101454104 3300005338 Bacteria 640
17 Ga0068868_101994668 3300005338 Bacteria 551
18 Ga0070660_100019684 3300005339 Bacteria 4950
19 Ga0070660_100025989 3300005339 Bacteria 4357
20 Ga0070660_100527460 3300005339 Unclassified 984
21 Ga0070660_101296374 3300005339 Unclassified 618
22 Ga0070689_100009699 3300005340 Bacteria 6831
23 Ga0070691_10030950 3300005341 Bacteria 2508
24 Ga0070691_10100035 3300005341 Unclassified 1439
25 Ga0070691_10228038 3300005341 Bacteria 990
26 Ga0070687_100005183 3300005343 Bacteria 5262
27 Ga0070687_100226857 3300005343 Bacteria 1147
28 Ga0070661_100511525 3300005344 Unclassified 962
29 Ga0070661_100875713 3300005344 Bacteria 740
30 Ga0070692_10027586 3300005345 Bacteria 2816
31 Ga0070692_10279218 3300005345 Unclassified 1012
32 Ga0070668_100013713 3300005347 Bacteria 6053
33 Ga0070668_101141606 3300005347 Unclassified 704
34 Ga0070669_101476916 3300005353 Bacteria 591
35 Ga0070671_100530355 3300005355 Bacteria 1014
36 Ga0070671_100819471 3300005355 Bacteria 811
37 Ga0070671_101284930 3300005355 Unclassified 645
38 Ga0070674_100004923 3300005356 Bacteria 7653
39 Ga0070674_100123751 3300005356 Bacteria 1918
40 Ga0070674_101470787 3300005356 Unclassified 612
41 Ga0070674_101549292 3300005356 Unclassified 597
42 Ga0070673_100637436 3300005364 Bacteria 974
43 Ga0070688_100003350 3300005365 Bacteria 8215
44 Ga0070659_100056777 3300005366 Unclassified 3087
45 Ga0070659_100589886 3300005366 Bacteria 954
46 Ga0070659_101671235 3300005366 Bacteria 569
47 Ga0070667_100080041 3300005367 Bacteria 2794
48 Ga0070703_10023309 3300005406 Bacteria 1822
49 Ga0070709_10055623 3300005434 Bacteria 2499
50 Ga0070714_100009128 3300005435 Bacteria 7779
51 Ga0070710_10443987 3300005437 Bacteria 878
52 Ga0070701_10002318 3300005438 Bacteria 7308
53 Ga0070701_10422304 3300005438 Bacteria 850
54 Ga0070711_100004585 3300005439 Bacteria 8177
55 Ga0070711_101299750 3300005439 Bacteria 631
56 Ga0070711_101858472 3300005439 Bacteria 529
57 Ga0070705_100254000 3300005440 Unclassified 1235
58 Ga0070705_101343263 3300005440 Unclassified 594
59 Ga0070700_100000684 3300005441 Bacteria 16765
60 Ga0070700_100425708 3300005441 Unclassified 1004
61 Ga0070694_100025678 3300005444 Bacteria 3812
62 Ga0070694_101155679 3300005444 Bacteria 647
63 Ga0070708_101358568 3300005445 Bacteria 663
64 Ga0070663_100350505 3300005455 Bacteria 1195
65 Ga0070678_100011232 3300005456 Bacteria 5514
66 Ga0070678_100018364 3300005456 Bacteria 4531
67 Ga0070678_100150510 3300005456 Unclassified 1874
68 Ga0070678_101012146 3300005456 Bacteria 764
69 Ga0070662_100021355 3300005457 Bacteria 4420
70 Ga0070662_100025079 3300005457 Bacteria 4115
71 Ga0070662_100430348 3300005457 Unclassified 1093
72 Ga0070662_100496269 3300005457 Bacteria 1018
73 Ga0070681_10007772 3300005458 Bacteria 10482
74 Ga0070681_10217719 3300005458 Bacteria 1825
75 Ga0070681_10634274 3300005458 Unclassified 983
76 Ga0070681_11012552 3300005458 Unclassified 751
77 Ga0068867_100000986 3300005459 Bacteria 19422
78 Ga0068867_102129086 3300005459 Bacteria 532
79 Ga0070685_10053078 3300005466 Bacteria 2347
80 Ga0070707_100039303 3300005468 Bacteria 4521
81 Ga0070707_100387181 3300005468 Bacteria 1358
82 Ga0070707_100555468 3300005468 Unclassified 1110
83 Ga0070707_100661764 3300005468 Bacteria 1007
84 Ga0070698_100125523 3300005471 Unclassified 2524
85 Ga0070699_100041716 3300005518 Bacteria 3971
86 Ga0070699_100120611 3300005518 Bacteria 2305
87 Ga0070699_101995221 3300005518 Unclassified 530
88 Ga0070679_100004971 3300005530 Bacteria 12270
89 Ga0070679_100030308 3300005530 Bacteria 5342
90 Ga0070679_100216519 3300005530 Bacteria 1877
91 Ga0070684_100008974 3300005535 Bacteria 7854
92 Ga0070684_100104520 3300005535 Bacteria 2534
93 Ga0070684_101235465 3300005535 Bacteria 703
94 Ga0070697_100144168 3300005536 Unclassified 2004
95 Ga0070697_100215161 3300005536 Bacteria 1637
96 Ga0068853_100034461 3300005539 Bacteria 4297
97 Ga0068853_100997550 3300005539 Bacteria 806
98 Ga0070672_100021126 3300005543 Bacteria 4759
99 Ga0070672_100527137 3300005543 Bacteria 1024
100 Ga0070686_100000523 3300005544 Bacteria 22983
101 Ga0070686_100540515 3300005544 Bacteria 910
102 Ga0070686_100936352 3300005544 Bacteria 707
103 Ga0070695_100686423 3300005545 Bacteria 811
104 Ga0070695_100936883 3300005545 Unclassified 701
105 Ga0070696_100001749 3300005546 Bacteria 14248
106 Ga0070696_100462458 3300005546 Bacteria 1003
107 Ga0070696_101699421 3300005546 Bacteria 544
108 Ga0070693_100034299 3300005547 Bacteria 2808
109 Ga0070693_100068056 3300005547 Bacteria 2089
110 Ga0070665_100057638 3300005548 Bacteria 3894
111 Ga0070665_101469562 3300005548 Unclassified 690
112 Ga0070704_100468730 3300005549 Bacteria 1088
113 Ga0070704_100637239 3300005549 Bacteria 940
114 Ga0070704_101789243 3300005549 Bacteria 568
115 Ga0068855_100012336 3300005563 Bacteria 10323
116 Ga0070664_100103297 3300005564 Bacteria 2481
117 Ga0070664_100109531 3300005564 Bacteria 2409
118 Ga0068857_100342218 3300005577 Bacteria 1384
119 Ga0068854_100605057 3300005578 Bacteria 936
120 Ga0068854_102050459 3300005578 Unclassified 528
121 Ga0068856_100014810 3300005614 Bacteria 7529
122 Ga0068856_100030731 3300005614 Bacteria 5251
123 Ga0068856_100059750 3300005614 Unclassified 3765
124 Ga0068856_100501038 3300005614 Bacteria 1235
125 Ga0070702_100006305 3300005615 Bacteria 5604
126 Ga0070702_100035408 3300005615 Bacteria 2758
127 Ga0070702_100229291 3300005615 Bacteria 1247
128 Ga0068852_100305044 3300005616 Bacteria 1542
129 Ga0068852_100546967 3300005616 Bacteria 1158
130 Ga0068852_100973099 3300005616 Bacteria 867
131 Ga0068859_102505504 3300005617 Unclassified 568
132 Ga0068864_100309030 3300005618 Unclassified 1482
133 Ga0068866_10002569 3300005718 Bacteria 7489
134 Ga0068866_10138400 3300005718 Bacteria 1394
135 Ga0068861_100135858 3300005719 Bacteria 2001
136 Ga0068858_100622056 3300005842 Bacteria 1048
137 Ga0081455_10009763 3300005937 Bacteria 9828
138 Ga0081455_10111753 3300005937 Unclassified 2170
139 Ga0081455_10124371 3300005937 Unclassified 2027
140 Ga0081455_10279425 3300005937 Bacteria 1207
141 Ga0081538_10050214 3300005981 Unclassified 2521
142 Ga0070717_10179498 3300006028 Bacteria 1845
143 Ga0070717_10509348 3300006028 Bacteria 1088
144 Ga0075365_10937759 3300006038 Bacteria 610
145 Ga0075432_10034493 3300006058 Bacteria 1758
146 Ga0070715_10677782 3300006163 Bacteria 613
147 Ga0070712_100018552 3300006175 Bacteria 4522
148 Ga0075362_10212789 3300006177 Bacteria 943
149 Ga0097621_100018941 3300006237 Bacteria 5273
150 Ga0097621_100142929 3300006237 Bacteria 2046
151 Ga0097621_101385735 3300006237 Unclassified 665
152 Ga0068871_100045220 3300006358 Bacteria 3543
153 Ga0068871_100089661 3300006358 Bacteria 2560
154 Ga0068871_101689656 3300006358 Unclassified 600
155 Ga0075433_10176680 3300006852 Unclassified 1900
156 Ga0075434_100060407 3300006871 Bacteria 3770
157 Ga0068865_100000286 3300006881 Bacteria 27770
158 Ga0068865_100548610 3300006881 Bacteria 970
159 Ga0075436_101521976 3300006914 Unclassified 508
160 Ga0097620_102506136 3300006931 Unclassified 568
161 Ga0075435_100638105 3300007076 Bacteria 924
162 Ga0075435_101070210 3300007076 Bacteria 705
163 Ga0105240_10147746 3300009093 Bacteria 2803
164 Ga0105240_12188349 3300009093 Bacteria 573
165 Ga0111539_10082650 3300009094 Bacteria 3778
166 Ga0105245_10012042 3300009098 Bacteria 7521
167 Ga0105245_10046901 3300009098 Bacteria 3862
168 Ga0105245_10613118 3300009098 Bacteria 1116
169 Ga0105245_11440031 3300009098 Bacteria 739
170 Ga0105245_11551381 3300009098 Unclassified 714
171 Ga0105245_12096095 3300009098 Unclassified 619
172 Ga0105245_12154029 3300009098 Unclassified 611
173 Ga0114129_10043799 3300009147 Bacteria 6298
174 Ga0114129_10100464 3300009147 Bacteria 4003
175 Ga0114129_10236759 3300009147 Bacteria 2456
176 Ga0114129_11512839 3300009147 Unclassified 824
177 Ga0114129_13477749 3300009147 Unclassified 504
178 Ga0105243_10003355 3300009148 Bacteria 12986
179 Ga0105243_10079115 3300009148 Bacteria 2679
180 Ga0105243_10226869 3300009148 Bacteria 1655
181 Ga0105243_10317818 3300009148 Bacteria 1418
182 Ga0105243_12590892 3300009148 Bacteria 547
183 Ga0105241_12448238 3300009174 Unclassified 522
184 Ga0105242_10005827 3300009176 Bacteria 9491
185 Ga0105242_10124576 3300009176 Bacteria 2216
186 Ga0105242_10338677 3300009176 Bacteria 1385
187 Ga0105242_10396438 3300009176 Bacteria 1287
188 Ga0105242_10933145 3300009176 Bacteria 871
189 Ga0105242_12352098 3300009176 Bacteria 580
190 Ga0105242_13047764 3300009176 Bacteria 519
191 Ga0105248_10193901 3300009177 Unclassified 2289
192 Ga0105248_10411428 3300009177 Bacteria 1523
193 Ga0105248_10777686 3300009177 Bacteria 1080
194 Ga0105238_10236880 3300009551 Bacteria 1802
195 Ga0105238_10645273 3300009551 Bacteria 1068
196 Ga0105238_11320163 3300009551 Bacteria 748
197 Ga0105249_10004882 3300009553 Bacteria 11574
198 Ga0105249_10641465 3300009553 Bacteria 1119
199 Ga0105249_11321702 3300009553 Unclassified 793
200 Ga0105249_11672961 3300009553 Bacteria 709
201 Ga0105249_12003212 3300009553 Unclassified 652
202 Ga0105239_10004320 3300010375 Bacteria 17037
203 Ga0105239_10264646 3300010375 Unclassified 1933
204 Ga0105239_10570940 3300010375 Bacteria 1289
205 Ga0105239_11136654 3300010375 Bacteria 899
206 Ga0157371_10298194 3300013102 Bacteria 1167
207 Ga0157371_10543866 3300013102 Unclassified 860
208 Ga0157370_10018418 3300013104 Bacteria 7024
209 Ga0157369_10302486 3300013105 Bacteria 1663
210 Ga0157369_10555127 3300013105 Unclassified 1187
211 Ga0157374_10820952 3300013296 Unclassified 946
212 Ga0157374_11201040 3300013296 Unclassified 780
213 Ga0157374_11856567 3300013296 Bacteria 628
214 Ga0157378_10004820 3300013297 Bacteria 11823
215 Ga0157378_13135436 3300013297 Bacteria 513
216 Ga0163162_10010276 3300013306 Bacteria 9096
217 Ga0163162_13210420 3300013306 Bacteria 524
218 Ga0157372_10103797 3300013307 Bacteria 3249
219 Ga0157372_10955924 3300013307 Bacteria 993
220 Ga0157372_12220660 3300013307 Unclassified 630
221 Ga0157375_10010067 3300013308 Bacteria 8314
222 Ga0157375_10751356 3300013308 Bacteria 1126
223 Ga0163163_10267763 3300014325 Bacteria 1760
224 Ga0157380_10039843 3300014326 Bacteria 3656
225 Ga0157380_10596941 3300014326 Bacteria 1092
226 Ga0157380_12859205 3300014326 Bacteria 549
227 Ga0157380_13040250 3300014326 Unclassified 535
228 Ga0157380_13203603 3300014326 Bacteria 523
229 Ga0157377_10011422 3300014745 Bacteria 4433
230 Ga0157377_10029870 3300014745 Bacteria 2948
231 Ga0157377_10106494 3300014745 Unclassified 1679
232 Ga0157377_10124075 3300014745 Unclassified 1569
233 Ga0157379_10220463 3300014968 Unclassified 1718
234 Ga0157376_10045663 3300014969 Bacteria 3608
235 Ga0157376_10090003 3300014969 Bacteria 2655
236 Ga0182007_10251746 3300015262 Bacteria 634
237 Ga0163161_11056075 3300017792 Unclassified 696
238 Ga0163161_11895532 3300017792 Bacteria 530
239 Ga0206356_11500200 3300020070 Bacteria 1000
240 Ga0206353_10197676 3300020082 Bacteria 1796
241 Ga0207653_10362714 3300025885 Bacteria 567
242 Ga0207642_10000768 3300025899 Bacteria 9921
243 Ga0207680_10092189 3300025903 Bacteria 1930
244 Ga0207699_10105056 3300025906 Bacteria 1800
245 Ga0207684_10019221 3300025910 Bacteria 5845
246 Ga0207654_10024204 3300025911 Bacteria 3262
247 Ga0207707_10018166 3300025912 Bacteria 6128
248 Ga0207707_10075070 3300025912 Bacteria 2949
249 Ga0207707_10662861 3300025912 Unclassified 879
250 Ga0207707_10813439 3300025912 Unclassified 778
251 Ga0207695_10519927 3300025913 Bacteria 1072
252 Ga0207693_10037975 3300025915 Bacteria 3794
253 Ga0207663_10002331 3300025916 Bacteria 9117
254 Ga0207663_10504026 3300025916 Bacteria 941
255 Ga0207660_10012481 3300025917 Bacteria 5561
256 Ga0207660_10034647 3300025917 Bacteria 3500
257 Ga0207660_10085305 3300025917 Bacteria 2329
258 Ga0207662_10076268 3300025918 Unclassified 2037
259 Ga0207657_10000773 3300025919 Bacteria 33955
260 Ga0207657_10035878 3300025919 Bacteria 4441
261 Ga0207657_10174600 3300025919 Bacteria 1740
262 Ga0207657_10494401 3300025919 Unclassified 958
263 Ga0207652_10004716 3300025921 Bacteria 11055
264 Ga0207652_10384469 3300025921 Bacteria 1267
265 Ga0207646_10024074 3300025922 Bacteria 5582
266 Ga0207646_10304374 3300025922 Bacteria 1440
267 Ga0207681_11379416 3300025923 Unclassified 592
268 Ga0207687_10013317 3300025927 Bacteria 5370
269 Ga0207687_10020012 3300025927 Bacteria 4438
270 Ga0207687_10315664 3300025927 Unclassified 1263
271 Ga0207687_10315984 3300025927 Bacteria 1263
272 Ga0207664_10000776 3300025929 Bacteria 21568
273 Ga0207664_10714810 3300025929 Unclassified 901
274 Ga0207664_10868636 3300025929 Unclassified 810
275 Ga0207644_10390951 3300025931 Bacteria 1135
276 Ga0207644_10885107 3300025931 Bacteria 748
277 Ga0207644_11004827 3300025931 Unclassified 700
278 Ga0207644_11588393 3300025931 Unclassified 549
279 Ga0207690_10216314 3300025932 Bacteria 1464
280 Ga0207690_10329120 3300025932 Unclassified 1203
281 Ga0207706_10017269 3300025933 Bacteria 6502
282 Ga0207706_10037817 3300025933 Bacteria 4283
283 Ga0207706_10202201 3300025933 Bacteria 1742
284 Ga0207706_11186675 3300025933 Bacteria 635
285 Ga0207706_11516106 3300025933 Bacteria 546
286 Ga0207686_10066287 3300025934 Bacteria 2305
287 Ga0207686_10224314 3300025934 Unclassified 1359
288 Ga0207686_10293493 3300025934 Unclassified 1205
289 Ga0207686_10406996 3300025934 Bacteria 1038
290 Ga0207686_10452261 3300025934 Bacteria 988
291 Ga0207686_10827891 3300025934 Bacteria 743
292 Ga0207709_10001144 3300025935 Bacteria 19343
293 Ga0207709_10236093 3300025935 Bacteria 1327
294 Ga0207709_10285277 3300025935 Bacteria 1221
295 Ga0207709_10631359 3300025935 Unclassified 851
296 Ga0207670_10015173 3300025936 Bacteria 4596
297 Ga0207669_10002896 3300025937 Bacteria 7361
298 Ga0207704_10004281 3300025938 Bacteria 6523
299 Ga0207704_10770110 3300025938 Bacteria 802
300 Ga0207704_11582192 3300025938 Unclassified 563
301 Ga0207691_10045781 3300025940 Bacteria 4021
302 Ga0207691_10189702 3300025940 Unclassified 1793
303 Ga0207691_10292068 3300025940 Bacteria 1402
304 Ga0207711_10489440 3300025941 Bacteria 1146
305 Ga0207711_10724072 3300025941 Bacteria 928
306 Ga0207711_10794358 3300025941 Bacteria 882
307 Ga0207711_11789418 3300025941 Bacteria 557
308 Ga0207689_10538311 3300025942 Unclassified 980
309 Ga0207689_11565040 3300025942 Bacteria 549
310 Ga0207661_10001854 3300025944 Bacteria 14466
311 Ga0207661_10135798 3300025944 Bacteria 2112
312 Ga0207661_10219974 3300025944 Bacteria 1678
313 Ga0207679_10097319 3300025945 Bacteria 2292
314 Ga0207679_10191020 3300025945 Bacteria 1703
315 Ga0207667_11138237 3300025949 Bacteria 762
316 Ga0207667_11143870 3300025949 Bacteria 760
317 Ga0207712_10007418 3300025961 Bacteria 6926
318 Ga0207712_11761050 3300025961 Unclassified 555
319 Ga0207668_10106295 3300025972 Bacteria 2096
320 Ga0207668_10928145 3300025972 Unclassified 776
321 Ga0207640_10373228 3300025981 Unclassified 1153
322 Ga0207640_10501779 3300025981 Bacteria 1011
323 Ga0207640_10718881 3300025981 Bacteria 858
324 Ga0207640_12168802 3300025981 Unclassified 504
325 Ga0207677_10054113 3300026023 Unclassified 2736
326 Ga0207677_10171903 3300026023 Bacteria 1695
327 Ga0207677_10999300 3300026023 Bacteria 758
328 Ga0207677_11493041 3300026023 Unclassified 624
329 Ga0207639_10396460 3300026041 Bacteria 1243
330 Ga0207639_10432840 3300026041 Bacteria 1191
331 Ga0207639_11525321 3300026041 Bacteria 627
332 Ga0207678_10202273 3300026067 Bacteria 1698
333 Ga0207678_11869026 3300026067 Unclassified 524
334 Ga0207708_10000370 3300026075 Bacteria 35189
335 Ga0207708_10501713 3300026075 Unclassified 1017
336 Ga0207702_10040004 3300026078 Bacteria 3930
337 Ga0207702_10054630 3300026078 Bacteria 3385
338 Ga0207702_10527968 3300026078 Bacteria 1153
339 Ga0207702_12123639 3300026078 Bacteria 551
340 Ga0207648_10002247 3300026089 Bacteria 20900
341 Ga0207648_10089303 3300026089 Bacteria 2692
342 Ga0207648_10130330 3300026089 Bacteria 2214
343 Ga0207674_10344720 3300026116 Bacteria 1440
344 Ga0207675_100084685 3300026118 Bacteria 2975
345 Ga0207675_100116389 3300026118 Bacteria 2526
346 Ga0207675_100335667 3300026118 Bacteria 1478
347 Ga0207683_10001015 3300026121 Bacteria 25590
348 Ga0207683_10031089 3300026121 Bacteria 4632
349 Ga0207683_11927582 3300026121 Bacteria 539
350 Ga0207698_10177735 3300026142 Bacteria 1881
351 Ga0207428_10132846 3300027907 Unclassified 1904
352 Ga0268266_10043992 3300028379 Bacteria 3817
353 Ga0268266_12071057 3300028379 Bacteria 542
354 Ga0268265_11042009 3300028380 Unclassified 810
355 Ga0268265_11050525 3300028380 Bacteria 807
356 Ga0307405_11464240 3300031731 Unclassified 599
357 Ga0307413_11745798 3300031824 Unclassified 556
358 Ga0307406_11673498 3300031901 Unclassified 563
359 Ga0307409_100482118 3300031995 Bacteria 1204
360 Ga0307409_101215963 3300031995 Unclassified 777
361 Ga0307409_101315182 3300031995 Bacteria 748
362 Ga0307416_100888041 3300032002 Bacteria 991
363 Ga0307411_11971045 3300032005 Unclassified 545
364 Ga0373943_0030324 3300035170 Bacteria 2558
365 Ga0373946_0504353 3300035171 Bacteria 621
366 Ga0373924_0240892 3300035410 Bacteria 800
367 Ga0373931_0358219 3300035691 Unclassified 915
368 Ga0373927_0032417 3300035695 Bacteria 3403
369 Ga0373933_0435097 3300035724 Bacteria 857
370 Ga0373947_0000750 3300035725 Bacteria 19442
371 Ga0373937_0877241 3300036401 Unclassified 846
372 Ga0373925_0031560 3300037068 Bacteria 3894
373 Ga0373925_0739433 3300037068 Bacteria 811
374 Ga0395899_0010490 3300037312 Bacteria 7095
375 Ga0395899_0012927 3300037312 Bacteria 6389
376 Ga0395899_0084844 3300037312 Bacteria 2302
377 Ga0395899_0202531 3300037312 Bacteria 1383
378 Ga0395899_0542972 3300037312 Unclassified 748
379 Ga0395900_0031507 3300037418 Bacteria 5449
380 Ga0395900_0052648 3300037418 Bacteria 4190
381 Ga0395900_0087736 3300037418 Bacteria 3197
382 Ga0395900_0108730 3300037418 Bacteria 2848
383 Ga0395900_0126870 3300037418 Unclassified 2617
384 Ga0395900_0199942 3300037418 Unclassified 2023
385 Ga0395900_0228270 3300037418 Bacteria 1873
386 Ga0395900_0591948 3300037418 Unclassified 1050
387 Ga0395900_0897764 3300037418 Bacteria 810
388 Ga0395900_1003527 3300037418 Bacteria 755
389 Ga0395898_0003542 3300037466 Bacteria 17407
390 Ga0395898_0003781 3300037466 Bacteria 16751
391 Ga0395898_0012138 3300037466 Bacteria 8915
392 Ga0395898_0040492 3300037466 Bacteria 4607
393 Ga0395898_0529115 3300037466 Bacteria 1120
394 Ga0395898_0568489 3300037466 Unclassified 1076
395 Ga0395898_1373279 3300037466 Bacteria 634
396 Ga0395898_1404753 3300037466 Bacteria 626
397 Ga0395905_0008588 3300037471 Bacteria 10069
398 Ga0395905_0018120 3300037471 Bacteria 6684
399 Ga0395905_0023055 3300037471 Bacteria 5885
400 Ga0395905_0034723 3300037471 Bacteria 4736
401 Ga0395905_0037392 3300037471 Bacteria 4558
402 Ga0395905_0047036 3300037471 Bacteria 4045
403 Ga0395901_0001220 3300038443 Bacteria 27391
404 Ga0395901_0015468 3300038443 Bacteria 7769
405 Ga0395901_0026068 3300038443 Bacteria 6002
406 Ga0395901_0027185 3300038443 Bacteria 5877
407 Ga0395901_0071870 3300038443 Bacteria 3606
408 Ga0395901_0826996 3300038443 Unclassified 913
409 Ga0395901_1521765 3300038443 Bacteria 624
410 Ga0439436_0149161 3300041404 Bacteria 659
411 Ga0439447_087527 3300041407 Bacteria 717
412 Ga0439453_0039286 3300041408 Bacteria 923
413 Ga0439461_0004195 3300041410 Bacteria 2396
414 Ga0451807_2706511 3300041486 Bacteria 992
415 Ga0451835_0562485 3300041492 Bacteria 570
416 Ga0451847_0748361 3300041503 Unclassified 539
417 Ga0451851_0052068 3300041507 Unclassified 563
418 Ga0451853_1372945 3300041512 Bacteria 820
419 Ga0451853_2994250 3300041512 Bacteria 634
420 Ga0451853_3609184 3300041512 Bacteria 732
421 Ga0439441_010822 3300042001 Bacteria 1538
422 Ga0439445_0028798 3300042004 Bacteria 1433
423 Ga0439445_0121430 3300042004 Unclassified 750
424 Ga0439451_057667 3300042009 Bacteria 777
425 Ga0450920_003237 3300042122 Bacteria 2810
426 Ga0450920_016222 3300042122 Unclassified 1419
427 Ga0450907_056905 3300042146 Unclassified 674
428 Ga0439446_0229588 3300042156 Bacteria 635
429 Ga0439446_0231376 3300042156 Bacteria 632
430 Ga0450908_051993 3300042184 Unclassified 714
431 Ga0450909_035676 3300042185 Unclassified 760
432 Ga0439434_0023797 3300042435 Bacteria 1845
433 Ga0451577_0471418 3300042876 Unclassified 1140
434 Ga0466966_0202891 3300044684 Bacteria 1199
435 Ga0451576_0478706 3300045051 Bacteria 1308
436 Ga0451576_0821809 3300045051 Unclassified 976
437 Ga0466958_0817821 3300045836 Unclassified 608
438 Ga0495603_0019923 3300046455 Bacteria 4063
439 Ga0495603_0109033 3300046455 Bacteria 1615
440 Ga0495603_0254908 3300046455 Unclassified 1010
441 Ga0495603_0261612 3300046455 Bacteria 996
442 Ga0495629_0002899 3300046459 Bacteria 13092
443 Ga0495629_0036795 3300046459 Bacteria 3453
444 Ga0495641_0078393 3300046461 Bacteria 1481
445 Ga0495651_0016245 3300046462 Bacteria 5765
446 Ga0495653_0089608 3300046463 Bacteria 2253
447 Ga0495653_0681305 3300046463 Unclassified 626
448 Ga0495582_0144308 3300046473 Bacteria 1350
449 Ga0495582_0270376 3300046473 Unclassified 975
450 Ga0495582_0375267 3300046473 Bacteria 819
451 Ga0495582_0650289 3300046473 Bacteria 610
452 Ga0495605_0446440 3300046474 Unclassified 533
453 Ga0495639_0169474 3300046475 Unclassified 1059
454 Ga0495664_0085930 3300046477 Bacteria 1889
455 Ga0495664_0265164 3300046477 Bacteria 1038
456 Ga0495664_0396666 3300046477 Bacteria 829
457 Ga0495584_0068453 3300046491 Bacteria 1783
458 Ga0495594_0142686 3300046499 Unclassified 1359
459 Ga0495594_0717372 3300046499 Unclassified 565
460 Ga0495596_0109550 3300046500 Bacteria 1072
461 Ga0495607_0561538 3300046501 Unclassified 500
462 Ga0495616_0098857 3300046513 Bacteria 1371
463 Ga0495618_0075135 3300046514 Bacteria 2152
464 Ga0495628_0040109 3300046516 Bacteria 3743
465 Ga0495628_0240483 3300046516 Bacteria 1354
466 Ga0495630_0009184 3300046517 Bacteria 7111
467 Ga0495630_0128818 3300046517 Unclassified 1921
468 Ga0495630_0304788 3300046517 Bacteria 1217
469 Ga0495630_0618227 3300046517 Bacteria 830
470 Ga0495630_0806157 3300046517 Bacteria 717
471 Ga0495630_1389078 3300046517 Bacteria 528
472 Ga0495644_0189253 3300046523 Unclassified 792
473 Ga0495644_0210955 3300046523 Unclassified 750
474 Ga0495663_0017803 3300046525 Bacteria 2019
475 Ga0495663_0091510 3300046525 Bacteria 992
476 Ga0495666_0272147 3300046526 Bacteria 769
477 Ga0495642_0396798 3300046528 Bacteria 608
478 Ga0495652_0064211 3300046529 Bacteria 3088
479 Ga0495652_0290640 3300046529 Bacteria 1193
480 Ga0495640_0034105 3300046533 Bacteria 3613
481 Ga0495640_0269716 3300046533 Bacteria 1062
482 Ga0495598_0153652 3300046537 Bacteria 805
483 Ga0495645_0540215 3300046543 Bacteria 724
484 Ga0495633_0189444 3300046558 Bacteria 946
485 Ga0495667_0344454 3300046559 Bacteria 942
486 Ga0495656_0585559 3300046615 Unclassified 596
487 Ga0495634_0114196 3300046642 Bacteria 1734
488 Ga0495634_0346799 3300046642 Bacteria 890
489 Ga0495634_0446823 3300046642 Bacteria 763
490 Ga0495611_0516656 3300046648 Bacteria 542
491 Ga0495635_0239268 3300046663 Bacteria 1225
492 Ga0495635_0250130 3300046663 Bacteria 1195
493 Ga0495588_0247641 3300046674 Unclassified 940
494 Ga0495588_0264245 3300046674 Unclassified 907
495 Ga0495657_0111543 3300046675 Bacteria 1732
496 Ga0495657_0370543 3300046675 Bacteria 845
497 Ga0495599_0673543 3300046678 Bacteria 598
498 Ga0495647_0103768 3300046681 Bacteria 1180
499 Ga0495647_0634725 3300046681 Unclassified 502
500 Ga0495658_0165817 3300046683 Bacteria 1365
501 Ga0495658_0414643 3300046683 Bacteria 859
502 Ga0495658_0502395 3300046683 Bacteria 776
503 Ga0495658_0690998 3300046683 Unclassified 654
504 Ga0495669_0235129 3300046684 Bacteria 879
505 Ga0495613_0133825 3300046689 Bacteria 1775
506 Ga0495613_0380051 3300046689 Unclassified 966
507 Ga0495613_0601136 3300046689 Bacteria 732
508 Ga0495624_0300842 3300046690 Unclassified 967
509 Ga0495600_0227789 3300046809 Bacteria 1191
510 Ga0495581_0092041 3300047315 Bacteria 1760
511 Ga0495581_0179953 3300047315 Unclassified 1236
512 Ga0495581_0393315 3300047315 Bacteria 809
513 Ga0495604_0294286 3300047317 Bacteria 1092
514 Ga0495674_0009324 3300047319 Bacteria 9331
515 Ga0495674_0103168 3300047319 Bacteria 2425
516 Ga0495674_0318022 3300047319 Unclassified 1269
517 Ga0495674_0491221 3300047319 Archaea 983
518 Ga0495674_0797275 3300047319 Bacteria 735
519 Ga0495676_0066139 3300047321 Unclassified 2803
520 Ga0495676_0212417 3300047321 Bacteria 1338
521 Ga0495680_0005930 3300047322 Bacteria 11417
522 Ga0495680_0669778 3300047322 Bacteria 688
523 Ga0495675_0381074 3300047444 Bacteria 825
524 Ga0495677_0237802 3300047445 Unclassified 711
525 Ga0495684_0022218 3300047471 Bacteria 4885
526 Ga0495684_0057195 3300047471 Bacteria 2973
527 Ga0495684_0397777 3300047471 Bacteria 968
528 Ga0495593_0102049 3300047673 Bacteria 1471
529 Ga0495602_0183777 3300048088 Unclassified 1610
530 Ga0495615_0251592 3300048090 Unclassified 560
531 Ga0496100_0002185 3300048903 Bacteria 9870
532 Ga0496100_0020706 3300048903 Bacteria 3948
533 Ga0496100_0025887 3300048903 Bacteria 3591
534 Ga0496100_0305948 3300048903 Unclassified 1191
535 Ga0496100_0699457 3300048903 Unclassified 791
536 Ga0496100_0817031 3300048903 Bacteria 731
537 Ga0496100_0963270 3300048903 Unclassified 671
538 Ga0496100_1039255 3300048903 Unclassified 645
539 Ga0496101_0002439 3300048904 Bacteria 11431
540 Ga0496101_0008696 3300048904 Bacteria 6640
541 Ga0496101_0016853 3300048904 Bacteria 4946
542 Ga0496101_0379540 3300048904 Unclassified 1112
543 Ga0496101_0382242 3300048904 Bacteria 1108
544 Ga0496101_0758989 3300048904 Bacteria 765
545 Ga0496102_0021173 3300048905 Bacteria 5749
546 Ga0496102_0548705 3300048905 Bacteria 1079
547 Ga0496102_0834484 3300048905 Unclassified 844
548 Ga0496102_0868282 3300048905 Bacteria 824
549 Ga0496102_1550433 3300048905 Bacteria 581
550 Ga0496103_0005429 3300048906 Bacteria 7630
551 Ga0496103_0026543 3300048906 Bacteria 3505
552 Ga0496104_0001048 3300048907 Bacteria 23633
553 Ga0496104_0082104 3300048907 Bacteria 3074
554 Ga0496104_0177193 3300048907 Bacteria 2042
555 Ga0496104_0209737 3300048907 Bacteria 1860
556 Ga0496104_0321021 3300048907 Bacteria 1461
557 Ga0496104_1143534 3300048907 Unclassified 682
558 Ga0496105_0000594 3300048908 Bacteria 24087
559 Ga0496105_0099023 3300048908 Bacteria 2407
560 Ga0496105_0144633 3300048908 Bacteria 1956
561 Ga0496105_0472047 3300048908 Bacteria 988
562 Ga0496105_1109397 3300048908 Unclassified 587
563 Ga0496106_0036161 3300048909 Bacteria 3694
564 Ga0496106_0118454 3300048909 Unclassified 2067
565 Ga0496106_1401999 3300048909 Unclassified 540
566 Ga0496106_1503968 3300048909 Bacteria 518
567 Ga0496107_0000673 3300048910 Bacteria 19356
568 Ga0496107_0008812 3300048910 Bacteria 6989
569 Ga0496107_0066518 3300048910 Unclassified 2613
570 Ga0496107_0257864 3300048910 Unclassified 1298
571 Ga0496107_0540036 3300048910 Bacteria 864
572 Ga0496108_0465257 3300048911 Bacteria 1105
573 Ga0496108_0704571 3300048911 Bacteria 875
574 Ga0496109_0000463 3300048912 Bacteria 34599
575 Ga0496109_0049517 3300048912 Bacteria 3825
576 Ga0496109_0359069 3300048912 Bacteria 1376
577 Ga0496109_0378038 3300048912 Unclassified 1338
578 Ga0496109_0519615 3300048912 Bacteria 1124
579 Ga0496109_0668314 3300048912 Unclassified 976
580 Ga0496109_0737544 3300048912 Bacteria 923
581 Ga0496109_1071513 3300048912 Bacteria 743
582 Ga0496110_0000563 3300048913 Bacteria 25359
583 Ga0496110_0150252 3300048913 Bacteria 2109
584 Ga0496110_0521296 3300048913 Unclassified 1081
585 Ga0496110_1204639 3300048913 Unclassified 666
586 Ga0496110_1708421 3300048913 Bacteria 540
587 Ga0496111_0022674 3300048914 Bacteria 4398
588 Ga0496111_0186381 3300048914 Bacteria 1543
589 Ga0496111_0842352 3300048914 Unclassified 662
590 Ga0496111_0851391 3300048914 Unclassified 658
591 Ga0496112_0144311 3300048915 Bacteria 2349
592 Ga0496112_0150553 3300048915 Unclassified 2294
593 Ga0496112_0532657 3300048915 Unclassified 1109
594 Ga0496114_0000690 3300048917 Bacteria 25130
595 Ga0496114_0002459 3300048917 Bacteria 14136
596 Ga0496114_0002627 3300048917 Bacteria 13713
597 Ga0496114_0047191 3300048917 Bacteria 3582
598 Ga0496114_0180097 3300048917 Bacteria 1845
599 Ga0496114_0209512 3300048917 Bacteria 1709
600 Ga0496114_0912086 3300048917 Unclassified 760
601 Ga0496115_0000573 3300048918 Bacteria 28473
602 Ga0496115_0043515 3300048918 Unclassified 3582
603 Ga0496115_0406679 3300048918 Bacteria 1104
604 Ga0496115_0911488 3300048918 Bacteria 677
605 Ga0501040_0551565 3300049576 Bacteria 832
606 Ga0501071_0379183 3300049587 Unclassified 1078
607 Ga0501072_1426238 3300049588 Archaea 535
608 Ga0501076_1079165 3300049592 Bacteria 661
609 Ga0501077_0141386 3300049593 Bacteria 1527
610 nmdc:mga04h51_471231_c1 3300050495 Bacteria 533
611 nmdc:mga05p37_372337_c1 3300050507 Bacteria 1676
612 nmdc:mga08y16_1179110_c1 3300050511 Bacteria 737
613 nmdc:mga08y16_478539_c1 3300050511 Bacteria 1267
614 nmdc:mga0n895_133995_c1 3300050512 Bacteria 2503
615 nmdc:mga0n895_508479_c1 3300050512 Bacteria 1213
616 nmdc:mga0n895_517606_c1 3300050512 Bacteria 1201
617 nmdc:mga0rr50_1020707_c1 3300050513 Bacteria 704
618 nmdc:mga0rr50_638978_c1 3300050513 Unclassified 908
619 nmdc:mga0a205_341502_c1 3300050515 Bacteria 1366
620 Ga0495601_0052472 3300053077 Bacteria 2575
621 Ga0495601_0483968 3300053077 Unclassified 799
622 Ga0495601_0694837 3300053077 Bacteria 649
623 Ga0495612_0525702 3300053078 Bacteria 544
624 Ga0495595_0332061 3300053084 Bacteria 766
625 Ga0495619_0649684 3300053085 Bacteria 719
626 Ga0501084_0764382 3300054114 Bacteria 814
627 Ga0590074_128521 3300059423 Unclassified 508
628 Ga0590075_090688 3300059424 Bacteria 793
629 Ga0070682_101212651
630 JGI24747J21853_1045065
631 JGI24744J21845_10000410
632 Ga0070658_10672549
633 Ga0070683_100006137
634 Ga0070683_100272382
635 Ga0070683_102408302
636 Ga0070690_100012069
637 Ga0070690_100506397
638 Ga0070670_100693959
639 Ga0070680_100030305
640 Ga0070682_100007934
641 Ga0070682_100063983
642 Ga0068868_100037618
643 Ga0068868_100218460
644 Ga0068868_101454104
645 Ga0068868_101994668
646 Ga0070660_100019684
647 Ga0070660_100025989
648 Ga0070660_100527460
649 Ga0070660_101296374
650 Ga0070689_100009699
651 Ga0070691_10030950
652 Ga0070691_10100035
653 Ga0070691_10228038
654 Ga0070687_100005183
655 Ga0070687_100226857
656 Ga0070661_100511525
657 Ga0070661_100875713
658 Ga0070692_10027586
659 Ga0070692_10279218
660 Ga0070668_100013713
661 Ga0070668_101141606
662 Ga0070669_101476916
663 Ga0070671_100530355
664 Ga0070671_100819471
665 Ga0070671_101284930
666 Ga0070674_100004923
667 Ga0070674_100123751
668 Ga0070674_101470787
669 Ga0070674_101549292
670 Ga0070673_100637436
671 Ga0070688_100003350
672 Ga0070659_100056777
673 Ga0070659_100589886
674 Ga0070659_101671235
675 Ga0070667_100080041
676 Ga0070703_10023309
677 Ga0070709_10055623
678 Ga0070714_100009128
679 Ga0070710_10443987
680 Ga0070701_10002318
681 Ga0070701_10422304
682 Ga0070711_100004585
683 Ga0070711_101299750
684 Ga0070711_101858472
685 Ga0070705_100254000
686 Ga0070705_101343263
687 Ga0070700_100000684
688 Ga0070700_100425708
689 Ga0070694_100025678
690 Ga0070694_101155679
691 Ga0070708_101358568
692 Ga0070663_100350505
693 Ga0070678_100011232
694 Ga0070678_100018364
695 Ga0070678_100150510
696 Ga0070678_101012146
697 Ga0070662_100021355
698 Ga0070662_100025079
699 Ga0070662_100430348
700 Ga0070662_100496269
701 Ga0070681_10007772
702 Ga0070681_10217719
703 Ga0070681_10634274
704 Ga0070681_11012552
705 Ga0068867_100000986
706 Ga0068867_102129086
707 Ga0070685_10053078
708 Ga0070707_100039303
709 Ga0070707_100387181
710 Ga0070707_100555468
711 Ga0070707_100661764
712 Ga0070698_100125523
713 Ga0070699_100041716
714 Ga0070699_100120611
715 Ga0070699_101995221
716 Ga0070679_100004971
717 Ga0070679_100030308
718 Ga0070679_100216519
719 Ga0070684_100008974
720 Ga0070684_100104520
721 Ga0070684_101235465
722 Ga0070697_100144168
723 Ga0070697_100215161
724 Ga0068853_100034461
725 Ga0068853_100997550
726 Ga0070672_100021126
727 Ga0070672_100527137
728 Ga0070686_100000523
729 Ga0070686_100540515
730 Ga0070686_100936352
731 Ga0070695_100686423
732 Ga0070695_100936883
733 Ga0070696_100001749
734 Ga0070696_100462458
735 Ga0070696_101699421
736 Ga0070693_100034299
737 Ga0070693_100068056
738 Ga0070665_100057638
739 Ga0070665_101469562
740 Ga0070704_100468730
741 Ga0070704_100637239
742 Ga0070704_101789243
743 Ga0068855_100012336
744 Ga0070664_100103297
745 Ga0070664_100109531
746 Ga0068857_100342218
747 Ga0068854_100605057
748 Ga0068854_102050459
749 Ga0068856_100014810
750 Ga0068856_100030731
751 Ga0068856_100059750
752 Ga0068856_100501038
753 Ga0070702_100006305
754 Ga0070702_100035408
755 Ga0070702_100229291
756 Ga0068852_100305044
757 Ga0068852_100546967
758 Ga0068852_100973099
759 Ga0068859_102505504
760 Ga0068864_100309030
761 Ga0068866_10002569
762 Ga0068866_10138400
763 Ga0068861_100135858
764 Ga0068858_100622056
765 Ga0081455_10009763
766 Ga0081455_10111753
767 Ga0081455_10124371
768 Ga0081455_10279425
769 Ga0081538_10050214
770 Ga0070717_10179498
771 Ga0070717_10509348
772 Ga0075365_10937759
773 Ga0075432_10034493
774 Ga0070715_10677782
775 Ga0070712_100018552
776 Ga0075362_10212789
777 Ga0097621_100018941
778 Ga0097621_100142929
779 Ga0097621_101385735
780 Ga0068871_100045220
781 Ga0068871_100089661
782 Ga0068871_101689656
783 Ga0075433_10176680
784 Ga0075434_100060407
785 Ga0068865_100000286
786 Ga0068865_100548610
787 Ga0075436_101521976
788 Ga0097620_102506136
789 Ga0075435_100638105
790 Ga0075435_101070210
791 Ga0105240_10147746
792 Ga0105240_12188349
793 Ga0111539_10082650
794 Ga0105245_10012042
795 Ga0105245_10046901
796 Ga0105245_10613118
797 Ga0105245_11440031
798 Ga0105245_11551381
799 Ga0105245_12096095
800 Ga0105245_12154029
801 Ga0114129_10043799
802 Ga0114129_10100464
803 Ga0114129_10236759
804 Ga0114129_11512839
805 Ga0114129_13477749
806 Ga0105243_10003355
807 Ga0105243_10079115
808 Ga0105243_10226869
809 Ga0105243_10317818
810 Ga0105243_12590892
811 Ga0105241_12448238
812 Ga0105242_10005827
813 Ga0105242_10124576
814 Ga0105242_10338677
815 Ga0105242_10396438
816 Ga0105242_10933145
817 Ga0105242_12352098
818 Ga0105242_13047764
819 Ga0105248_10193901
820 Ga0105248_10411428
821 Ga0105248_10777686
822 Ga0105238_10236880
823 Ga0105238_10645273
824 Ga0105238_11320163
825 Ga0105249_10004882
826 Ga0105249_10641465
827 Ga0105249_11321702
828 Ga0105249_11672961
829 Ga0105249_12003212
830 Ga0105239_10004320
831 Ga0105239_10264646
832 Ga0105239_10570940
833 Ga0105239_11136654
834 Ga0157371_10298194
835 Ga0157371_10543866
836 Ga0157370_10018418
837 Ga0157369_10302486
838 Ga0157369_10555127
839 Ga0157374_10820952
840 Ga0157374_11201040
841 Ga0157374_11856567
842 Ga0157378_10004820
843 Ga0157378_13135436
844 Ga0163162_10010276
845 Ga0163162_13210420
846 Ga0157372_10103797
847 Ga0157372_10955924
848 Ga0157372_12220660
849 Ga0157375_10010067
850 Ga0157375_10751356
851 Ga0163163_10267763
852 Ga0157380_10039843
853 Ga0157380_10596941
854 Ga0157380_12859205
855 Ga0157380_13040250
856 Ga0157380_13203603
857 Ga0157377_10011422
858 Ga0157377_10029870
859 Ga0157377_10106494
860 Ga0157377_10124075
861 Ga0157379_10220463
862 Ga0157376_10045663
863 Ga0157376_10090003
864 Ga0182007_10251746
865 Ga0163161_11056075
866 Ga0163161_11895532
867 Ga0206356_11500200
868 Ga0206353_10197676
869 Ga0207653_10362714
870 Ga0207642_10000768
871 Ga0207680_10092189
872 Ga0207699_10105056
873 Ga0207684_10019221
874 Ga0207654_10024204
875 Ga0207707_10018166
876 Ga0207707_10075070
877 Ga0207707_10662861
878 Ga0207707_10813439
879 Ga0207695_10519927
880 Ga0207693_10037975
881 Ga0207663_10002331
882 Ga0207663_10504026
883 Ga0207660_10012481
884 Ga0207660_10034647
885 Ga0207660_10085305
886 Ga0207662_10076268
887 Ga0207657_10000773
888 Ga0207657_10035878
889 Ga0207657_10174600
890 Ga0207657_10494401
891 Ga0207652_10004716
892 Ga0207652_10384469
893 Ga0207646_10024074
894 Ga0207646_10304374
895 Ga0207681_11379416
896 Ga0207687_10013317
897 Ga0207687_10020012
898 Ga0207687_10315664
899 Ga0207687_10315984
900 Ga0207664_10000776
901 Ga0207664_10714810
902 Ga0207664_10868636
903 Ga0207644_10390951
904 Ga0207644_10885107
905 Ga0207644_11004827
906 Ga0207644_11588393
907 Ga0207690_10216314
908 Ga0207690_10329120
909 Ga0207706_10017269
910 Ga0207706_10037817
911 Ga0207706_10202201
912 Ga0207706_11186675
913 Ga0207706_11516106
914 Ga0207686_10066287
915 Ga0207686_10224314
916 Ga0207686_10293493
917 Ga0207686_10406996
918 Ga0207686_10452261
919 Ga0207686_10827891
920 Ga0207709_10001144
921 Ga0207709_10236093
922 Ga0207709_10285277
923 Ga0207709_10631359
924 Ga0207670_10015173
925 Ga0207669_10002896
926 Ga0207704_10004281
927 Ga0207704_10770110
928 Ga0207704_11582192
929 Ga0207691_10045781
930 Ga0207691_10189702
931 Ga0207691_10292068
932 Ga0207711_10489440
933 Ga0207711_10724072
934 Ga0207711_10794358
935 Ga0207711_11789418
936 Ga0207689_10538311
937 Ga0207689_11565040
938 Ga0207661_10001854
939 Ga0207661_10135798
940 Ga0207661_10219974
941 Ga0207679_10097319
942 Ga0207679_10191020
943 Ga0207667_11138237
944 Ga0207667_11143870
945 Ga0207712_10007418
946 Ga0207712_11761050
947 Ga0207668_10106295
948 Ga0207668_10928145
949 Ga0207640_10373228
950 Ga0207640_10501779
951 Ga0207640_10718881
952 Ga0207640_12168802
953 Ga0207677_10054113
954 Ga0207677_10171903
955 Ga0207677_10999300
956 Ga0207677_11493041
957 Ga0207639_10396460
958 Ga0207639_10432840
959 Ga0207639_11525321
960 Ga0207678_10202273
961 Ga0207678_11869026
962 Ga0207708_10000370
963 Ga0207708_10501713
964 Ga0207702_10040004
965 Ga0207702_10054630
966 Ga0207702_10527968
967 Ga0207702_12123639
968 Ga0207648_10002247
969 Ga0207648_10089303
970 Ga0207648_10130330
971 Ga0207674_10344720
972 Ga0207675_100084685
973 Ga0207675_100116389
974 Ga0207675_100335667
975 Ga0207683_10001015
976 Ga0207683_10031089
977 Ga0207683_11927582
978 Ga0207698_10177735
979 Ga0207428_10132846
980 Ga0268266_10043992
981 Ga0268266_12071057
982 Ga0268265_11042009
983 Ga0268265_11050525
984 Ga0307405_11464240
985 Ga0307413_11745798
986 Ga0307406_11673498
987 Ga0307409_100482118
988 Ga0307409_101215963
989 Ga0307409_101315182
990 Ga0307416_100888041
991 Ga0307411_11971045
992 Ga0373943_0030324
993 Ga0373946_0504353
994 Ga0373924_0240892
995 Ga0373931_0358219
996 Ga0373927_0032417
997 Ga0373933_0435097
998 Ga0373947_0000750
999 Ga0373937_0877241
1000 Ga0373925_0031560
1001 Ga0373925_0739433
1002 Ga0395899_0010490
1003 Ga0395899_0012927
1004 Ga0395899_0084844
1005 Ga0395899_0202531
1006 Ga0395899_0542972
1007 Ga0395900_0031507
1008 Ga0395900_0052648
1009 Ga0395900_0087736
1010 Ga0395900_0108730
1011 Ga0395900_0126870
1012 Ga0395900_0199942
1013 Ga0395900_0228270
1014 Ga0395900_0591948
1015 Ga0395900_0897764
1016 Ga0395900_1003527
1017 Ga0395898_0003542
1018 Ga0395898_0003781
1019 Ga0395898_0012138
1020 Ga0395898_0040492
1021 Ga0395898_0529115
1022 Ga0395898_0568489
1023 Ga0395898_1373279
1024 Ga0395898_1404753
1025 Ga0395905_0008588
1026 Ga0395905_0018120
1027 Ga0395905_0023055
1028 Ga0395905_0034723
1029 Ga0395905_0037392
1030 Ga0395905_0047036
1031 Ga0395901_0001220
1032 Ga0395901_0015468
1033 Ga0395901_0026068
1034 Ga0395901_0027185
1035 Ga0395901_0071870
1036 Ga0395901_0826996
1037 Ga0395901_1521765
1038 Ga0439436_0149161
1039 Ga0439447_087527
1040 Ga0439453_0039286
1041 Ga0439461_0004195
1042 Ga0451807_2706511
1043 Ga0451835_0562485
1044 Ga0451847_0748361
1045 Ga0451851_0052068
1046 Ga0451853_1372945
1047 Ga0451853_2994250
1048 Ga0451853_3609184
1049 Ga0439441_010822
1050 Ga0439445_0028798
1051 Ga0439445_0121430
1052 Ga0439451_057667
1053 Ga0450920_003237
1054 Ga0450920_016222
1055 Ga0450907_056905
1056 Ga0439446_0229588
1057 Ga0439446_0231376
1058 Ga0450908_051993
1059 Ga0450909_035676
1060 Ga0439434_0023797
1061 Ga0451577_0471418
1062 Ga0466966_0202891
1063 Ga0451576_0478706
1064 Ga0451576_0821809
1065 Ga0466958_0817821
1066 Ga0495603_0019923
1067 Ga0495603_0109033
1068 Ga0495603_0254908
1069 Ga0495603_0261612
1070 Ga0495629_0002899
1071 Ga0495629_0036795
1072 Ga0495641_0078393
1073 Ga0495651_0016245
1074 Ga0495653_0089608
1075 Ga0495653_0681305
1076 Ga0495582_0144308
1077 Ga0495582_0270376
1078 Ga0495582_0375267
1079 Ga0495582_0650289
1080 Ga0495605_0446440
1081 Ga0495639_0169474
1082 Ga0495664_0085930
1083 Ga0495664_0265164
1084 Ga0495664_0396666
1085 Ga0495584_0068453
1086 Ga0495594_0142686
1087 Ga0495594_0717372
1088 Ga0495596_0109550
1089 Ga0495607_0561538
1090 Ga0495616_0098857
1091 Ga0495618_0075135
1092 Ga0495628_0040109
1093 Ga0495628_0240483
1094 Ga0495630_0009184
1095 Ga0495630_0128818
1096 Ga0495630_0304788
1097 Ga0495630_0618227
1098 Ga0495630_0806157
1099 Ga0495630_1389078
1100 Ga0495644_0189253
1101 Ga0495644_0210955
1102 Ga0495663_0017803
1103 Ga0495663_0091510
1104 Ga0495666_0272147
1105 Ga0495642_0396798
1106 Ga0495652_0064211
1107 Ga0495652_0290640
1108 Ga0495640_0034105
1109 Ga0495640_0269716
1110 Ga0495598_0153652
1111 Ga0495645_0540215
1112 Ga0495633_0189444
1113 Ga0495667_0344454
1114 Ga0495656_0585559
1115 Ga0495634_0114196
1116 Ga0495634_0346799
1117 Ga0495634_0446823
1118 Ga0495611_0516656
1119 Ga0495635_0239268
1120 Ga0495635_0250130
1121 Ga0495588_0247641
1122 Ga0495588_0264245
1123 Ga0495657_0111543
1124 Ga0495657_0370543
1125 Ga0495599_0673543
1126 Ga0495647_0103768
1127 Ga0495647_0634725
1128 Ga0495658_0165817
1129 Ga0495658_0414643
1130 Ga0495658_0502395
1131 Ga0495658_0690998
1132 Ga0495669_0235129
1133 Ga0495613_0133825
1134 Ga0495613_0380051
1135 Ga0495613_0601136
1136 Ga0495624_0300842
1137 Ga0495600_0227789
1138 Ga0495581_0092041
1139 Ga0495581_0179953
1140 Ga0495581_0393315
1141 Ga0495604_0294286
1142 Ga0495674_0009324
1143 Ga0495674_0103168
1144 Ga0495674_0318022
1145 Ga0495674_0491221
1146 Ga0495674_0797275
1147 Ga0495676_0066139
1148 Ga0495676_0212417
1149 Ga0495680_0005930
1150 Ga0495680_0669778
1151 Ga0495675_0381074
1152 Ga0495677_0237802
1153 Ga0495684_0022218
1154 Ga0495684_0057195
1155 Ga0495684_0397777
1156 Ga0495593_0102049
1157 Ga0495602_0183777
1158 Ga0495615_0251592
1159 Ga0496100_0002185
1160 Ga0496100_0020706
1161 Ga0496100_0025887
1162 Ga0496100_0305948
1163 Ga0496100_0699457
1164 Ga0496100_0817031
1165 Ga0496100_0963270
1166 Ga0496100_1039255
1167 Ga0496101_0002439
1168 Ga0496101_0008696
1169 Ga0496101_0016853
1170 Ga0496101_0379540
1171 Ga0496101_0382242
1172 Ga0496101_0758989
1173 Ga0496102_0021173
1174 Ga0496102_0548705
1175 Ga0496102_0834484
1176 Ga0496102_0868282
1177 Ga0496102_1550433
1178 Ga0496103_0005429
1179 Ga0496103_0026543
1180 Ga0496104_0001048
1181 Ga0496104_0082104
1182 Ga0496104_0177193
1183 Ga0496104_0209737
1184 Ga0496104_0321021
1185 Ga0496104_1143534
1186 Ga0496105_0000594
1187 Ga0496105_0099023
1188 Ga0496105_0144633
1189 Ga0496105_0472047
1190 Ga0496105_1109397
1191 Ga0496106_0036161
1192 Ga0496106_0118454
1193 Ga0496106_1401999
1194 Ga0496106_1503968
1195 Ga0496107_0000673
1196 Ga0496107_0008812
1197 Ga0496107_0066518
1198 Ga0496107_0257864
1199 Ga0496107_0540036
1200 Ga0496108_0465257
1201 Ga0496108_0704571
1202 Ga0496109_0000463
1203 Ga0496109_0049517
1204 Ga0496109_0359069
1205 Ga0496109_0378038
1206 Ga0496109_0519615
1207 Ga0496109_0668314
1208 Ga0496109_0737544
1209 Ga0496109_1071513
1210 Ga0496110_0000563
1211 Ga0496110_0150252
1212 Ga0496110_0521296
1213 Ga0496110_1204639
1214 Ga0496110_1708421
1215 Ga0496111_0022674
1216 Ga0496111_0186381
1217 Ga0496111_0842352
1218 Ga0496111_0851391
1219 Ga0496112_0144311
1220 Ga0496112_0150553
1221 Ga0496112_0532657
1222 Ga0496114_0000690
1223 Ga0496114_0002459
1224 Ga0496114_0002627
1225 Ga0496114_0047191
1226 Ga0496114_0180097
1227 Ga0496114_0209512
1228 Ga0496114_0912086
1229 Ga0496115_0000573
1230 Ga0496115_0043515
1231 Ga0496115_0406679
1232 Ga0496115_0911488
1233 Ga0501040_0551565
1234 Ga0501071_0379183
1235 Ga0501072_1426238
1236 Ga0501076_1079165
1237 Ga0501077_0141386
1238 nmdc:mga04h51_471231_c1
1239 nmdc:mga05p37_372337_c1
1240 nmdc:mga08y16_1179110_c1
1241 nmdc:mga08y16_478539_c1
1242 nmdc:mga0n895_133995_c1
1243 nmdc:mga0n895_508479_c1
1244 nmdc:mga0n895_517606_c1
1245 nmdc:mga0rr50_1020707_c1
1246 nmdc:mga0rr50_638978_c1
1247 nmdc:mga0a205_341502_c1
1248 Ga0495601_0052472
1249 Ga0495601_0483968
1250 Ga0495601_0694837
1251 Ga0495612_0525702
1252 Ga0495595_0332061
1253 Ga0495619_0649684
1254 Ga0501084_0764382
1255 Ga0590074_128521
1256 Ga0590075_090688

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4oi3-assembly1.cif.gz_B crystal structure analysis of sco4226 from streptomyces coelicolor a3(2) 0.7736 3 84
3rhu-assembly1.cif.gz_A epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins 0.7578 35 59
4oi3-assembly1.cif.gz_B crystal structure analysis of sco4226 from streptomyces coelicolor a3(2) 0.7499 3 84
3edd-assembly1.cif.gz_A structural base for cyclodextrin hydrolysis 0.7483 39 59
4x4p-assembly5.cif.gz_C crystal structure of the a.fulgidus cca-adding enzyme in complex with a g70a arginyl-trna minihelix ending in ccac 0.7316 2 60
ID Description Score Start End Superfamily
af_Q4DS91_59_305_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.8316 39 62 1.10.510.10
af_E9AH80_569_880_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.8277 39 58 1.10.510.10
4oi3B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.7854 4 84 3.30.70.3090
af_Q559E5_5_168_3.30.980.10 Alpha Beta;2-Layer Sandwich;Threonyl-tRNA Synthetase; Chain A, domain 2;Threonyl-trna Synthetase; Chain A, domain 2 0.7729 39 59 3.30.980.10
4oi3B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.7601 4 84 3.30.70.3090
ID Description Score Start End GO Terms
AF-A0A535A836-F1-model_v4 DUF4242 domain-containing protein 0.9837 1 84
AF-A0A7W0NIG7-F1-model_v4 DUF4242 domain-containing protein 0.9834 1 83
AF-A0A536GG11-F1-model_v4 DUF4242 domain-containing protein 0.9797 20 84
AF-A0A7Y5XTQ4-F1-model_v4 DUF4242 domain-containing protein 0.9728 1 89
AF-A0A7C2D9X3-F1-model_v4 DUF4242 domain-containing protein 0.9683 2 85

Map