F470622
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 628 | 283 | 1256 | 90 |
Family's Representative Sequence
| Representative Sequence | 3300005337|Ga0070682_101212651|Ga0070682_1012126512 |
| Length | 106 |
| Sequence | VVLSFPRPQPGRSVEHMPSYLVETYLARDQMSALAARERRAHSAAQELTEGTTRVRFDRSIHVPEDEICFYVFDAPSVRVATEAAERAGLAPIRVVEAVSSGEERR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 2 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 3 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 70 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 71 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 77 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 156 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 159 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 160 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 161 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 162 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 163 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 164 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 165 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 166 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 167 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 168 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 169 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 170 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 171 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 172 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 174 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 175 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 176 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 177 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 178 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 179 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 180 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 181 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 182 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 183 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 184 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 185 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 186 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 187 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 188 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 189 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 190 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 191 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 192 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 193 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 194 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 195 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 196 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 197 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 198 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 199 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 200 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 254 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 255 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 256 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 257 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 258 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 259 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 262 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 263 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 264 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 265 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 266 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 272 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 283 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.68 |
| Metatranscriptomes | 0.32 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.48 |
| Nodule | 0 |
| Rhizoplane | 11.94 |
| Rhizosphere | 86.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 25 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070682_101212651 | 3300005337 | Bacteria | 637 |
| 2 | JGI24747J21853_1045065 | 3300001978 | Unclassified | 529 |
| 3 | JGI24744J21845_10000410 | 3300002077 | Bacteria | 7442 |
| 4 | Ga0070658_10672549 | 3300005327 | Bacteria | 898 |
| 5 | Ga0070683_100006137 | 3300005329 | Bacteria | 10075 |
| 6 | Ga0070683_100272382 | 3300005329 | Bacteria | 1610 |
| 7 | Ga0070683_102408302 | 3300005329 | Bacteria | 504 |
| 8 | Ga0070690_100012069 | 3300005330 | Bacteria | 5074 |
| 9 | Ga0070690_100506397 | 3300005330 | Bacteria | 904 |
| 10 | Ga0070670_100693959 | 3300005331 | Unclassified | 915 |
| 11 | Ga0070680_100030305 | 3300005336 | Bacteria | 4346 |
| 12 | Ga0070682_100007934 | 3300005337 | Bacteria | 5972 |
| 13 | Ga0070682_100063983 | 3300005337 | Bacteria | 2334 |
| 14 | Ga0068868_100037618 | 3300005338 | Bacteria | 3753 |
| 15 | Ga0068868_100218460 | 3300005338 | Bacteria | 1595 |
| 16 | Ga0068868_101454104 | 3300005338 | Bacteria | 640 |
| 17 | Ga0068868_101994668 | 3300005338 | Bacteria | 551 |
| 18 | Ga0070660_100019684 | 3300005339 | Bacteria | 4950 |
| 19 | Ga0070660_100025989 | 3300005339 | Bacteria | 4357 |
| 20 | Ga0070660_100527460 | 3300005339 | Unclassified | 984 |
| 21 | Ga0070660_101296374 | 3300005339 | Unclassified | 618 |
| 22 | Ga0070689_100009699 | 3300005340 | Bacteria | 6831 |
| 23 | Ga0070691_10030950 | 3300005341 | Bacteria | 2508 |
| 24 | Ga0070691_10100035 | 3300005341 | Unclassified | 1439 |
| 25 | Ga0070691_10228038 | 3300005341 | Bacteria | 990 |
| 26 | Ga0070687_100005183 | 3300005343 | Bacteria | 5262 |
| 27 | Ga0070687_100226857 | 3300005343 | Bacteria | 1147 |
| 28 | Ga0070661_100511525 | 3300005344 | Unclassified | 962 |
| 29 | Ga0070661_100875713 | 3300005344 | Bacteria | 740 |
| 30 | Ga0070692_10027586 | 3300005345 | Bacteria | 2816 |
| 31 | Ga0070692_10279218 | 3300005345 | Unclassified | 1012 |
| 32 | Ga0070668_100013713 | 3300005347 | Bacteria | 6053 |
| 33 | Ga0070668_101141606 | 3300005347 | Unclassified | 704 |
| 34 | Ga0070669_101476916 | 3300005353 | Bacteria | 591 |
| 35 | Ga0070671_100530355 | 3300005355 | Bacteria | 1014 |
| 36 | Ga0070671_100819471 | 3300005355 | Bacteria | 811 |
| 37 | Ga0070671_101284930 | 3300005355 | Unclassified | 645 |
| 38 | Ga0070674_100004923 | 3300005356 | Bacteria | 7653 |
| 39 | Ga0070674_100123751 | 3300005356 | Bacteria | 1918 |
| 40 | Ga0070674_101470787 | 3300005356 | Unclassified | 612 |
| 41 | Ga0070674_101549292 | 3300005356 | Unclassified | 597 |
| 42 | Ga0070673_100637436 | 3300005364 | Bacteria | 974 |
| 43 | Ga0070688_100003350 | 3300005365 | Bacteria | 8215 |
| 44 | Ga0070659_100056777 | 3300005366 | Unclassified | 3087 |
| 45 | Ga0070659_100589886 | 3300005366 | Bacteria | 954 |
| 46 | Ga0070659_101671235 | 3300005366 | Bacteria | 569 |
| 47 | Ga0070667_100080041 | 3300005367 | Bacteria | 2794 |
| 48 | Ga0070703_10023309 | 3300005406 | Bacteria | 1822 |
| 49 | Ga0070709_10055623 | 3300005434 | Bacteria | 2499 |
| 50 | Ga0070714_100009128 | 3300005435 | Bacteria | 7779 |
| 51 | Ga0070710_10443987 | 3300005437 | Bacteria | 878 |
| 52 | Ga0070701_10002318 | 3300005438 | Bacteria | 7308 |
| 53 | Ga0070701_10422304 | 3300005438 | Bacteria | 850 |
| 54 | Ga0070711_100004585 | 3300005439 | Bacteria | 8177 |
| 55 | Ga0070711_101299750 | 3300005439 | Bacteria | 631 |
| 56 | Ga0070711_101858472 | 3300005439 | Bacteria | 529 |
| 57 | Ga0070705_100254000 | 3300005440 | Unclassified | 1235 |
| 58 | Ga0070705_101343263 | 3300005440 | Unclassified | 594 |
| 59 | Ga0070700_100000684 | 3300005441 | Bacteria | 16765 |
| 60 | Ga0070700_100425708 | 3300005441 | Unclassified | 1004 |
| 61 | Ga0070694_100025678 | 3300005444 | Bacteria | 3812 |
| 62 | Ga0070694_101155679 | 3300005444 | Bacteria | 647 |
| 63 | Ga0070708_101358568 | 3300005445 | Bacteria | 663 |
| 64 | Ga0070663_100350505 | 3300005455 | Bacteria | 1195 |
| 65 | Ga0070678_100011232 | 3300005456 | Bacteria | 5514 |
| 66 | Ga0070678_100018364 | 3300005456 | Bacteria | 4531 |
| 67 | Ga0070678_100150510 | 3300005456 | Unclassified | 1874 |
| 68 | Ga0070678_101012146 | 3300005456 | Bacteria | 764 |
| 69 | Ga0070662_100021355 | 3300005457 | Bacteria | 4420 |
| 70 | Ga0070662_100025079 | 3300005457 | Bacteria | 4115 |
| 71 | Ga0070662_100430348 | 3300005457 | Unclassified | 1093 |
| 72 | Ga0070662_100496269 | 3300005457 | Bacteria | 1018 |
| 73 | Ga0070681_10007772 | 3300005458 | Bacteria | 10482 |
| 74 | Ga0070681_10217719 | 3300005458 | Bacteria | 1825 |
| 75 | Ga0070681_10634274 | 3300005458 | Unclassified | 983 |
| 76 | Ga0070681_11012552 | 3300005458 | Unclassified | 751 |
| 77 | Ga0068867_100000986 | 3300005459 | Bacteria | 19422 |
| 78 | Ga0068867_102129086 | 3300005459 | Bacteria | 532 |
| 79 | Ga0070685_10053078 | 3300005466 | Bacteria | 2347 |
| 80 | Ga0070707_100039303 | 3300005468 | Bacteria | 4521 |
| 81 | Ga0070707_100387181 | 3300005468 | Bacteria | 1358 |
| 82 | Ga0070707_100555468 | 3300005468 | Unclassified | 1110 |
| 83 | Ga0070707_100661764 | 3300005468 | Bacteria | 1007 |
| 84 | Ga0070698_100125523 | 3300005471 | Unclassified | 2524 |
| 85 | Ga0070699_100041716 | 3300005518 | Bacteria | 3971 |
| 86 | Ga0070699_100120611 | 3300005518 | Bacteria | 2305 |
| 87 | Ga0070699_101995221 | 3300005518 | Unclassified | 530 |
| 88 | Ga0070679_100004971 | 3300005530 | Bacteria | 12270 |
| 89 | Ga0070679_100030308 | 3300005530 | Bacteria | 5342 |
| 90 | Ga0070679_100216519 | 3300005530 | Bacteria | 1877 |
| 91 | Ga0070684_100008974 | 3300005535 | Bacteria | 7854 |
| 92 | Ga0070684_100104520 | 3300005535 | Bacteria | 2534 |
| 93 | Ga0070684_101235465 | 3300005535 | Bacteria | 703 |
| 94 | Ga0070697_100144168 | 3300005536 | Unclassified | 2004 |
| 95 | Ga0070697_100215161 | 3300005536 | Bacteria | 1637 |
| 96 | Ga0068853_100034461 | 3300005539 | Bacteria | 4297 |
| 97 | Ga0068853_100997550 | 3300005539 | Bacteria | 806 |
| 98 | Ga0070672_100021126 | 3300005543 | Bacteria | 4759 |
| 99 | Ga0070672_100527137 | 3300005543 | Bacteria | 1024 |
| 100 | Ga0070686_100000523 | 3300005544 | Bacteria | 22983 |
| 101 | Ga0070686_100540515 | 3300005544 | Bacteria | 910 |
| 102 | Ga0070686_100936352 | 3300005544 | Bacteria | 707 |
| 103 | Ga0070695_100686423 | 3300005545 | Bacteria | 811 |
| 104 | Ga0070695_100936883 | 3300005545 | Unclassified | 701 |
| 105 | Ga0070696_100001749 | 3300005546 | Bacteria | 14248 |
| 106 | Ga0070696_100462458 | 3300005546 | Bacteria | 1003 |
| 107 | Ga0070696_101699421 | 3300005546 | Bacteria | 544 |
| 108 | Ga0070693_100034299 | 3300005547 | Bacteria | 2808 |
| 109 | Ga0070693_100068056 | 3300005547 | Bacteria | 2089 |
| 110 | Ga0070665_100057638 | 3300005548 | Bacteria | 3894 |
| 111 | Ga0070665_101469562 | 3300005548 | Unclassified | 690 |
| 112 | Ga0070704_100468730 | 3300005549 | Bacteria | 1088 |
| 113 | Ga0070704_100637239 | 3300005549 | Bacteria | 940 |
| 114 | Ga0070704_101789243 | 3300005549 | Bacteria | 568 |
| 115 | Ga0068855_100012336 | 3300005563 | Bacteria | 10323 |
| 116 | Ga0070664_100103297 | 3300005564 | Bacteria | 2481 |
| 117 | Ga0070664_100109531 | 3300005564 | Bacteria | 2409 |
| 118 | Ga0068857_100342218 | 3300005577 | Bacteria | 1384 |
| 119 | Ga0068854_100605057 | 3300005578 | Bacteria | 936 |
| 120 | Ga0068854_102050459 | 3300005578 | Unclassified | 528 |
| 121 | Ga0068856_100014810 | 3300005614 | Bacteria | 7529 |
| 122 | Ga0068856_100030731 | 3300005614 | Bacteria | 5251 |
| 123 | Ga0068856_100059750 | 3300005614 | Unclassified | 3765 |
| 124 | Ga0068856_100501038 | 3300005614 | Bacteria | 1235 |
| 125 | Ga0070702_100006305 | 3300005615 | Bacteria | 5604 |
| 126 | Ga0070702_100035408 | 3300005615 | Bacteria | 2758 |
| 127 | Ga0070702_100229291 | 3300005615 | Bacteria | 1247 |
| 128 | Ga0068852_100305044 | 3300005616 | Bacteria | 1542 |
| 129 | Ga0068852_100546967 | 3300005616 | Bacteria | 1158 |
| 130 | Ga0068852_100973099 | 3300005616 | Bacteria | 867 |
| 131 | Ga0068859_102505504 | 3300005617 | Unclassified | 568 |
| 132 | Ga0068864_100309030 | 3300005618 | Unclassified | 1482 |
| 133 | Ga0068866_10002569 | 3300005718 | Bacteria | 7489 |
| 134 | Ga0068866_10138400 | 3300005718 | Bacteria | 1394 |
| 135 | Ga0068861_100135858 | 3300005719 | Bacteria | 2001 |
| 136 | Ga0068858_100622056 | 3300005842 | Bacteria | 1048 |
| 137 | Ga0081455_10009763 | 3300005937 | Bacteria | 9828 |
| 138 | Ga0081455_10111753 | 3300005937 | Unclassified | 2170 |
| 139 | Ga0081455_10124371 | 3300005937 | Unclassified | 2027 |
| 140 | Ga0081455_10279425 | 3300005937 | Bacteria | 1207 |
| 141 | Ga0081538_10050214 | 3300005981 | Unclassified | 2521 |
| 142 | Ga0070717_10179498 | 3300006028 | Bacteria | 1845 |
| 143 | Ga0070717_10509348 | 3300006028 | Bacteria | 1088 |
| 144 | Ga0075365_10937759 | 3300006038 | Bacteria | 610 |
| 145 | Ga0075432_10034493 | 3300006058 | Bacteria | 1758 |
| 146 | Ga0070715_10677782 | 3300006163 | Bacteria | 613 |
| 147 | Ga0070712_100018552 | 3300006175 | Bacteria | 4522 |
| 148 | Ga0075362_10212789 | 3300006177 | Bacteria | 943 |
| 149 | Ga0097621_100018941 | 3300006237 | Bacteria | 5273 |
| 150 | Ga0097621_100142929 | 3300006237 | Bacteria | 2046 |
| 151 | Ga0097621_101385735 | 3300006237 | Unclassified | 665 |
| 152 | Ga0068871_100045220 | 3300006358 | Bacteria | 3543 |
| 153 | Ga0068871_100089661 | 3300006358 | Bacteria | 2560 |
| 154 | Ga0068871_101689656 | 3300006358 | Unclassified | 600 |
| 155 | Ga0075433_10176680 | 3300006852 | Unclassified | 1900 |
| 156 | Ga0075434_100060407 | 3300006871 | Bacteria | 3770 |
| 157 | Ga0068865_100000286 | 3300006881 | Bacteria | 27770 |
| 158 | Ga0068865_100548610 | 3300006881 | Bacteria | 970 |
| 159 | Ga0075436_101521976 | 3300006914 | Unclassified | 508 |
| 160 | Ga0097620_102506136 | 3300006931 | Unclassified | 568 |
| 161 | Ga0075435_100638105 | 3300007076 | Bacteria | 924 |
| 162 | Ga0075435_101070210 | 3300007076 | Bacteria | 705 |
| 163 | Ga0105240_10147746 | 3300009093 | Bacteria | 2803 |
| 164 | Ga0105240_12188349 | 3300009093 | Bacteria | 573 |
| 165 | Ga0111539_10082650 | 3300009094 | Bacteria | 3778 |
| 166 | Ga0105245_10012042 | 3300009098 | Bacteria | 7521 |
| 167 | Ga0105245_10046901 | 3300009098 | Bacteria | 3862 |
| 168 | Ga0105245_10613118 | 3300009098 | Bacteria | 1116 |
| 169 | Ga0105245_11440031 | 3300009098 | Bacteria | 739 |
| 170 | Ga0105245_11551381 | 3300009098 | Unclassified | 714 |
| 171 | Ga0105245_12096095 | 3300009098 | Unclassified | 619 |
| 172 | Ga0105245_12154029 | 3300009098 | Unclassified | 611 |
| 173 | Ga0114129_10043799 | 3300009147 | Bacteria | 6298 |
| 174 | Ga0114129_10100464 | 3300009147 | Bacteria | 4003 |
| 175 | Ga0114129_10236759 | 3300009147 | Bacteria | 2456 |
| 176 | Ga0114129_11512839 | 3300009147 | Unclassified | 824 |
| 177 | Ga0114129_13477749 | 3300009147 | Unclassified | 504 |
| 178 | Ga0105243_10003355 | 3300009148 | Bacteria | 12986 |
| 179 | Ga0105243_10079115 | 3300009148 | Bacteria | 2679 |
| 180 | Ga0105243_10226869 | 3300009148 | Bacteria | 1655 |
| 181 | Ga0105243_10317818 | 3300009148 | Bacteria | 1418 |
| 182 | Ga0105243_12590892 | 3300009148 | Bacteria | 547 |
| 183 | Ga0105241_12448238 | 3300009174 | Unclassified | 522 |
| 184 | Ga0105242_10005827 | 3300009176 | Bacteria | 9491 |
| 185 | Ga0105242_10124576 | 3300009176 | Bacteria | 2216 |
| 186 | Ga0105242_10338677 | 3300009176 | Bacteria | 1385 |
| 187 | Ga0105242_10396438 | 3300009176 | Bacteria | 1287 |
| 188 | Ga0105242_10933145 | 3300009176 | Bacteria | 871 |
| 189 | Ga0105242_12352098 | 3300009176 | Bacteria | 580 |
| 190 | Ga0105242_13047764 | 3300009176 | Bacteria | 519 |
| 191 | Ga0105248_10193901 | 3300009177 | Unclassified | 2289 |
| 192 | Ga0105248_10411428 | 3300009177 | Bacteria | 1523 |
| 193 | Ga0105248_10777686 | 3300009177 | Bacteria | 1080 |
| 194 | Ga0105238_10236880 | 3300009551 | Bacteria | 1802 |
| 195 | Ga0105238_10645273 | 3300009551 | Bacteria | 1068 |
| 196 | Ga0105238_11320163 | 3300009551 | Bacteria | 748 |
| 197 | Ga0105249_10004882 | 3300009553 | Bacteria | 11574 |
| 198 | Ga0105249_10641465 | 3300009553 | Bacteria | 1119 |
| 199 | Ga0105249_11321702 | 3300009553 | Unclassified | 793 |
| 200 | Ga0105249_11672961 | 3300009553 | Bacteria | 709 |
| 201 | Ga0105249_12003212 | 3300009553 | Unclassified | 652 |
| 202 | Ga0105239_10004320 | 3300010375 | Bacteria | 17037 |
| 203 | Ga0105239_10264646 | 3300010375 | Unclassified | 1933 |
| 204 | Ga0105239_10570940 | 3300010375 | Bacteria | 1289 |
| 205 | Ga0105239_11136654 | 3300010375 | Bacteria | 899 |
| 206 | Ga0157371_10298194 | 3300013102 | Bacteria | 1167 |
| 207 | Ga0157371_10543866 | 3300013102 | Unclassified | 860 |
| 208 | Ga0157370_10018418 | 3300013104 | Bacteria | 7024 |
| 209 | Ga0157369_10302486 | 3300013105 | Bacteria | 1663 |
| 210 | Ga0157369_10555127 | 3300013105 | Unclassified | 1187 |
| 211 | Ga0157374_10820952 | 3300013296 | Unclassified | 946 |
| 212 | Ga0157374_11201040 | 3300013296 | Unclassified | 780 |
| 213 | Ga0157374_11856567 | 3300013296 | Bacteria | 628 |
| 214 | Ga0157378_10004820 | 3300013297 | Bacteria | 11823 |
| 215 | Ga0157378_13135436 | 3300013297 | Bacteria | 513 |
| 216 | Ga0163162_10010276 | 3300013306 | Bacteria | 9096 |
| 217 | Ga0163162_13210420 | 3300013306 | Bacteria | 524 |
| 218 | Ga0157372_10103797 | 3300013307 | Bacteria | 3249 |
| 219 | Ga0157372_10955924 | 3300013307 | Bacteria | 993 |
| 220 | Ga0157372_12220660 | 3300013307 | Unclassified | 630 |
| 221 | Ga0157375_10010067 | 3300013308 | Bacteria | 8314 |
| 222 | Ga0157375_10751356 | 3300013308 | Bacteria | 1126 |
| 223 | Ga0163163_10267763 | 3300014325 | Bacteria | 1760 |
| 224 | Ga0157380_10039843 | 3300014326 | Bacteria | 3656 |
| 225 | Ga0157380_10596941 | 3300014326 | Bacteria | 1092 |
| 226 | Ga0157380_12859205 | 3300014326 | Bacteria | 549 |
| 227 | Ga0157380_13040250 | 3300014326 | Unclassified | 535 |
| 228 | Ga0157380_13203603 | 3300014326 | Bacteria | 523 |
| 229 | Ga0157377_10011422 | 3300014745 | Bacteria | 4433 |
| 230 | Ga0157377_10029870 | 3300014745 | Bacteria | 2948 |
| 231 | Ga0157377_10106494 | 3300014745 | Unclassified | 1679 |
| 232 | Ga0157377_10124075 | 3300014745 | Unclassified | 1569 |
| 233 | Ga0157379_10220463 | 3300014968 | Unclassified | 1718 |
| 234 | Ga0157376_10045663 | 3300014969 | Bacteria | 3608 |
| 235 | Ga0157376_10090003 | 3300014969 | Bacteria | 2655 |
| 236 | Ga0182007_10251746 | 3300015262 | Bacteria | 634 |
| 237 | Ga0163161_11056075 | 3300017792 | Unclassified | 696 |
| 238 | Ga0163161_11895532 | 3300017792 | Bacteria | 530 |
| 239 | Ga0206356_11500200 | 3300020070 | Bacteria | 1000 |
| 240 | Ga0206353_10197676 | 3300020082 | Bacteria | 1796 |
| 241 | Ga0207653_10362714 | 3300025885 | Bacteria | 567 |
| 242 | Ga0207642_10000768 | 3300025899 | Bacteria | 9921 |
| 243 | Ga0207680_10092189 | 3300025903 | Bacteria | 1930 |
| 244 | Ga0207699_10105056 | 3300025906 | Bacteria | 1800 |
| 245 | Ga0207684_10019221 | 3300025910 | Bacteria | 5845 |
| 246 | Ga0207654_10024204 | 3300025911 | Bacteria | 3262 |
| 247 | Ga0207707_10018166 | 3300025912 | Bacteria | 6128 |
| 248 | Ga0207707_10075070 | 3300025912 | Bacteria | 2949 |
| 249 | Ga0207707_10662861 | 3300025912 | Unclassified | 879 |
| 250 | Ga0207707_10813439 | 3300025912 | Unclassified | 778 |
| 251 | Ga0207695_10519927 | 3300025913 | Bacteria | 1072 |
| 252 | Ga0207693_10037975 | 3300025915 | Bacteria | 3794 |
| 253 | Ga0207663_10002331 | 3300025916 | Bacteria | 9117 |
| 254 | Ga0207663_10504026 | 3300025916 | Bacteria | 941 |
| 255 | Ga0207660_10012481 | 3300025917 | Bacteria | 5561 |
| 256 | Ga0207660_10034647 | 3300025917 | Bacteria | 3500 |
| 257 | Ga0207660_10085305 | 3300025917 | Bacteria | 2329 |
| 258 | Ga0207662_10076268 | 3300025918 | Unclassified | 2037 |
| 259 | Ga0207657_10000773 | 3300025919 | Bacteria | 33955 |
| 260 | Ga0207657_10035878 | 3300025919 | Bacteria | 4441 |
| 261 | Ga0207657_10174600 | 3300025919 | Bacteria | 1740 |
| 262 | Ga0207657_10494401 | 3300025919 | Unclassified | 958 |
| 263 | Ga0207652_10004716 | 3300025921 | Bacteria | 11055 |
| 264 | Ga0207652_10384469 | 3300025921 | Bacteria | 1267 |
| 265 | Ga0207646_10024074 | 3300025922 | Bacteria | 5582 |
| 266 | Ga0207646_10304374 | 3300025922 | Bacteria | 1440 |
| 267 | Ga0207681_11379416 | 3300025923 | Unclassified | 592 |
| 268 | Ga0207687_10013317 | 3300025927 | Bacteria | 5370 |
| 269 | Ga0207687_10020012 | 3300025927 | Bacteria | 4438 |
| 270 | Ga0207687_10315664 | 3300025927 | Unclassified | 1263 |
| 271 | Ga0207687_10315984 | 3300025927 | Bacteria | 1263 |
| 272 | Ga0207664_10000776 | 3300025929 | Bacteria | 21568 |
| 273 | Ga0207664_10714810 | 3300025929 | Unclassified | 901 |
| 274 | Ga0207664_10868636 | 3300025929 | Unclassified | 810 |
| 275 | Ga0207644_10390951 | 3300025931 | Bacteria | 1135 |
| 276 | Ga0207644_10885107 | 3300025931 | Bacteria | 748 |
| 277 | Ga0207644_11004827 | 3300025931 | Unclassified | 700 |
| 278 | Ga0207644_11588393 | 3300025931 | Unclassified | 549 |
| 279 | Ga0207690_10216314 | 3300025932 | Bacteria | 1464 |
| 280 | Ga0207690_10329120 | 3300025932 | Unclassified | 1203 |
| 281 | Ga0207706_10017269 | 3300025933 | Bacteria | 6502 |
| 282 | Ga0207706_10037817 | 3300025933 | Bacteria | 4283 |
| 283 | Ga0207706_10202201 | 3300025933 | Bacteria | 1742 |
| 284 | Ga0207706_11186675 | 3300025933 | Bacteria | 635 |
| 285 | Ga0207706_11516106 | 3300025933 | Bacteria | 546 |
| 286 | Ga0207686_10066287 | 3300025934 | Bacteria | 2305 |
| 287 | Ga0207686_10224314 | 3300025934 | Unclassified | 1359 |
| 288 | Ga0207686_10293493 | 3300025934 | Unclassified | 1205 |
| 289 | Ga0207686_10406996 | 3300025934 | Bacteria | 1038 |
| 290 | Ga0207686_10452261 | 3300025934 | Bacteria | 988 |
| 291 | Ga0207686_10827891 | 3300025934 | Bacteria | 743 |
| 292 | Ga0207709_10001144 | 3300025935 | Bacteria | 19343 |
| 293 | Ga0207709_10236093 | 3300025935 | Bacteria | 1327 |
| 294 | Ga0207709_10285277 | 3300025935 | Bacteria | 1221 |
| 295 | Ga0207709_10631359 | 3300025935 | Unclassified | 851 |
| 296 | Ga0207670_10015173 | 3300025936 | Bacteria | 4596 |
| 297 | Ga0207669_10002896 | 3300025937 | Bacteria | 7361 |
| 298 | Ga0207704_10004281 | 3300025938 | Bacteria | 6523 |
| 299 | Ga0207704_10770110 | 3300025938 | Bacteria | 802 |
| 300 | Ga0207704_11582192 | 3300025938 | Unclassified | 563 |
| 301 | Ga0207691_10045781 | 3300025940 | Bacteria | 4021 |
| 302 | Ga0207691_10189702 | 3300025940 | Unclassified | 1793 |
| 303 | Ga0207691_10292068 | 3300025940 | Bacteria | 1402 |
| 304 | Ga0207711_10489440 | 3300025941 | Bacteria | 1146 |
| 305 | Ga0207711_10724072 | 3300025941 | Bacteria | 928 |
| 306 | Ga0207711_10794358 | 3300025941 | Bacteria | 882 |
| 307 | Ga0207711_11789418 | 3300025941 | Bacteria | 557 |
| 308 | Ga0207689_10538311 | 3300025942 | Unclassified | 980 |
| 309 | Ga0207689_11565040 | 3300025942 | Bacteria | 549 |
| 310 | Ga0207661_10001854 | 3300025944 | Bacteria | 14466 |
| 311 | Ga0207661_10135798 | 3300025944 | Bacteria | 2112 |
| 312 | Ga0207661_10219974 | 3300025944 | Bacteria | 1678 |
| 313 | Ga0207679_10097319 | 3300025945 | Bacteria | 2292 |
| 314 | Ga0207679_10191020 | 3300025945 | Bacteria | 1703 |
| 315 | Ga0207667_11138237 | 3300025949 | Bacteria | 762 |
| 316 | Ga0207667_11143870 | 3300025949 | Bacteria | 760 |
| 317 | Ga0207712_10007418 | 3300025961 | Bacteria | 6926 |
| 318 | Ga0207712_11761050 | 3300025961 | Unclassified | 555 |
| 319 | Ga0207668_10106295 | 3300025972 | Bacteria | 2096 |
| 320 | Ga0207668_10928145 | 3300025972 | Unclassified | 776 |
| 321 | Ga0207640_10373228 | 3300025981 | Unclassified | 1153 |
| 322 | Ga0207640_10501779 | 3300025981 | Bacteria | 1011 |
| 323 | Ga0207640_10718881 | 3300025981 | Bacteria | 858 |
| 324 | Ga0207640_12168802 | 3300025981 | Unclassified | 504 |
| 325 | Ga0207677_10054113 | 3300026023 | Unclassified | 2736 |
| 326 | Ga0207677_10171903 | 3300026023 | Bacteria | 1695 |
| 327 | Ga0207677_10999300 | 3300026023 | Bacteria | 758 |
| 328 | Ga0207677_11493041 | 3300026023 | Unclassified | 624 |
| 329 | Ga0207639_10396460 | 3300026041 | Bacteria | 1243 |
| 330 | Ga0207639_10432840 | 3300026041 | Bacteria | 1191 |
| 331 | Ga0207639_11525321 | 3300026041 | Bacteria | 627 |
| 332 | Ga0207678_10202273 | 3300026067 | Bacteria | 1698 |
| 333 | Ga0207678_11869026 | 3300026067 | Unclassified | 524 |
| 334 | Ga0207708_10000370 | 3300026075 | Bacteria | 35189 |
| 335 | Ga0207708_10501713 | 3300026075 | Unclassified | 1017 |
| 336 | Ga0207702_10040004 | 3300026078 | Bacteria | 3930 |
| 337 | Ga0207702_10054630 | 3300026078 | Bacteria | 3385 |
| 338 | Ga0207702_10527968 | 3300026078 | Bacteria | 1153 |
| 339 | Ga0207702_12123639 | 3300026078 | Bacteria | 551 |
| 340 | Ga0207648_10002247 | 3300026089 | Bacteria | 20900 |
| 341 | Ga0207648_10089303 | 3300026089 | Bacteria | 2692 |
| 342 | Ga0207648_10130330 | 3300026089 | Bacteria | 2214 |
| 343 | Ga0207674_10344720 | 3300026116 | Bacteria | 1440 |
| 344 | Ga0207675_100084685 | 3300026118 | Bacteria | 2975 |
| 345 | Ga0207675_100116389 | 3300026118 | Bacteria | 2526 |
| 346 | Ga0207675_100335667 | 3300026118 | Bacteria | 1478 |
| 347 | Ga0207683_10001015 | 3300026121 | Bacteria | 25590 |
| 348 | Ga0207683_10031089 | 3300026121 | Bacteria | 4632 |
| 349 | Ga0207683_11927582 | 3300026121 | Bacteria | 539 |
| 350 | Ga0207698_10177735 | 3300026142 | Bacteria | 1881 |
| 351 | Ga0207428_10132846 | 3300027907 | Unclassified | 1904 |
| 352 | Ga0268266_10043992 | 3300028379 | Bacteria | 3817 |
| 353 | Ga0268266_12071057 | 3300028379 | Bacteria | 542 |
| 354 | Ga0268265_11042009 | 3300028380 | Unclassified | 810 |
| 355 | Ga0268265_11050525 | 3300028380 | Bacteria | 807 |
| 356 | Ga0307405_11464240 | 3300031731 | Unclassified | 599 |
| 357 | Ga0307413_11745798 | 3300031824 | Unclassified | 556 |
| 358 | Ga0307406_11673498 | 3300031901 | Unclassified | 563 |
| 359 | Ga0307409_100482118 | 3300031995 | Bacteria | 1204 |
| 360 | Ga0307409_101215963 | 3300031995 | Unclassified | 777 |
| 361 | Ga0307409_101315182 | 3300031995 | Bacteria | 748 |
| 362 | Ga0307416_100888041 | 3300032002 | Bacteria | 991 |
| 363 | Ga0307411_11971045 | 3300032005 | Unclassified | 545 |
| 364 | Ga0373943_0030324 | 3300035170 | Bacteria | 2558 |
| 365 | Ga0373946_0504353 | 3300035171 | Bacteria | 621 |
| 366 | Ga0373924_0240892 | 3300035410 | Bacteria | 800 |
| 367 | Ga0373931_0358219 | 3300035691 | Unclassified | 915 |
| 368 | Ga0373927_0032417 | 3300035695 | Bacteria | 3403 |
| 369 | Ga0373933_0435097 | 3300035724 | Bacteria | 857 |
| 370 | Ga0373947_0000750 | 3300035725 | Bacteria | 19442 |
| 371 | Ga0373937_0877241 | 3300036401 | Unclassified | 846 |
| 372 | Ga0373925_0031560 | 3300037068 | Bacteria | 3894 |
| 373 | Ga0373925_0739433 | 3300037068 | Bacteria | 811 |
| 374 | Ga0395899_0010490 | 3300037312 | Bacteria | 7095 |
| 375 | Ga0395899_0012927 | 3300037312 | Bacteria | 6389 |
| 376 | Ga0395899_0084844 | 3300037312 | Bacteria | 2302 |
| 377 | Ga0395899_0202531 | 3300037312 | Bacteria | 1383 |
| 378 | Ga0395899_0542972 | 3300037312 | Unclassified | 748 |
| 379 | Ga0395900_0031507 | 3300037418 | Bacteria | 5449 |
| 380 | Ga0395900_0052648 | 3300037418 | Bacteria | 4190 |
| 381 | Ga0395900_0087736 | 3300037418 | Bacteria | 3197 |
| 382 | Ga0395900_0108730 | 3300037418 | Bacteria | 2848 |
| 383 | Ga0395900_0126870 | 3300037418 | Unclassified | 2617 |
| 384 | Ga0395900_0199942 | 3300037418 | Unclassified | 2023 |
| 385 | Ga0395900_0228270 | 3300037418 | Bacteria | 1873 |
| 386 | Ga0395900_0591948 | 3300037418 | Unclassified | 1050 |
| 387 | Ga0395900_0897764 | 3300037418 | Bacteria | 810 |
| 388 | Ga0395900_1003527 | 3300037418 | Bacteria | 755 |
| 389 | Ga0395898_0003542 | 3300037466 | Bacteria | 17407 |
| 390 | Ga0395898_0003781 | 3300037466 | Bacteria | 16751 |
| 391 | Ga0395898_0012138 | 3300037466 | Bacteria | 8915 |
| 392 | Ga0395898_0040492 | 3300037466 | Bacteria | 4607 |
| 393 | Ga0395898_0529115 | 3300037466 | Bacteria | 1120 |
| 394 | Ga0395898_0568489 | 3300037466 | Unclassified | 1076 |
| 395 | Ga0395898_1373279 | 3300037466 | Bacteria | 634 |
| 396 | Ga0395898_1404753 | 3300037466 | Bacteria | 626 |
| 397 | Ga0395905_0008588 | 3300037471 | Bacteria | 10069 |
| 398 | Ga0395905_0018120 | 3300037471 | Bacteria | 6684 |
| 399 | Ga0395905_0023055 | 3300037471 | Bacteria | 5885 |
| 400 | Ga0395905_0034723 | 3300037471 | Bacteria | 4736 |
| 401 | Ga0395905_0037392 | 3300037471 | Bacteria | 4558 |
| 402 | Ga0395905_0047036 | 3300037471 | Bacteria | 4045 |
| 403 | Ga0395901_0001220 | 3300038443 | Bacteria | 27391 |
| 404 | Ga0395901_0015468 | 3300038443 | Bacteria | 7769 |
| 405 | Ga0395901_0026068 | 3300038443 | Bacteria | 6002 |
| 406 | Ga0395901_0027185 | 3300038443 | Bacteria | 5877 |
| 407 | Ga0395901_0071870 | 3300038443 | Bacteria | 3606 |
| 408 | Ga0395901_0826996 | 3300038443 | Unclassified | 913 |
| 409 | Ga0395901_1521765 | 3300038443 | Bacteria | 624 |
| 410 | Ga0439436_0149161 | 3300041404 | Bacteria | 659 |
| 411 | Ga0439447_087527 | 3300041407 | Bacteria | 717 |
| 412 | Ga0439453_0039286 | 3300041408 | Bacteria | 923 |
| 413 | Ga0439461_0004195 | 3300041410 | Bacteria | 2396 |
| 414 | Ga0451807_2706511 | 3300041486 | Bacteria | 992 |
| 415 | Ga0451835_0562485 | 3300041492 | Bacteria | 570 |
| 416 | Ga0451847_0748361 | 3300041503 | Unclassified | 539 |
| 417 | Ga0451851_0052068 | 3300041507 | Unclassified | 563 |
| 418 | Ga0451853_1372945 | 3300041512 | Bacteria | 820 |
| 419 | Ga0451853_2994250 | 3300041512 | Bacteria | 634 |
| 420 | Ga0451853_3609184 | 3300041512 | Bacteria | 732 |
| 421 | Ga0439441_010822 | 3300042001 | Bacteria | 1538 |
| 422 | Ga0439445_0028798 | 3300042004 | Bacteria | 1433 |
| 423 | Ga0439445_0121430 | 3300042004 | Unclassified | 750 |
| 424 | Ga0439451_057667 | 3300042009 | Bacteria | 777 |
| 425 | Ga0450920_003237 | 3300042122 | Bacteria | 2810 |
| 426 | Ga0450920_016222 | 3300042122 | Unclassified | 1419 |
| 427 | Ga0450907_056905 | 3300042146 | Unclassified | 674 |
| 428 | Ga0439446_0229588 | 3300042156 | Bacteria | 635 |
| 429 | Ga0439446_0231376 | 3300042156 | Bacteria | 632 |
| 430 | Ga0450908_051993 | 3300042184 | Unclassified | 714 |
| 431 | Ga0450909_035676 | 3300042185 | Unclassified | 760 |
| 432 | Ga0439434_0023797 | 3300042435 | Bacteria | 1845 |
| 433 | Ga0451577_0471418 | 3300042876 | Unclassified | 1140 |
| 434 | Ga0466966_0202891 | 3300044684 | Bacteria | 1199 |
| 435 | Ga0451576_0478706 | 3300045051 | Bacteria | 1308 |
| 436 | Ga0451576_0821809 | 3300045051 | Unclassified | 976 |
| 437 | Ga0466958_0817821 | 3300045836 | Unclassified | 608 |
| 438 | Ga0495603_0019923 | 3300046455 | Bacteria | 4063 |
| 439 | Ga0495603_0109033 | 3300046455 | Bacteria | 1615 |
| 440 | Ga0495603_0254908 | 3300046455 | Unclassified | 1010 |
| 441 | Ga0495603_0261612 | 3300046455 | Bacteria | 996 |
| 442 | Ga0495629_0002899 | 3300046459 | Bacteria | 13092 |
| 443 | Ga0495629_0036795 | 3300046459 | Bacteria | 3453 |
| 444 | Ga0495641_0078393 | 3300046461 | Bacteria | 1481 |
| 445 | Ga0495651_0016245 | 3300046462 | Bacteria | 5765 |
| 446 | Ga0495653_0089608 | 3300046463 | Bacteria | 2253 |
| 447 | Ga0495653_0681305 | 3300046463 | Unclassified | 626 |
| 448 | Ga0495582_0144308 | 3300046473 | Bacteria | 1350 |
| 449 | Ga0495582_0270376 | 3300046473 | Unclassified | 975 |
| 450 | Ga0495582_0375267 | 3300046473 | Bacteria | 819 |
| 451 | Ga0495582_0650289 | 3300046473 | Bacteria | 610 |
| 452 | Ga0495605_0446440 | 3300046474 | Unclassified | 533 |
| 453 | Ga0495639_0169474 | 3300046475 | Unclassified | 1059 |
| 454 | Ga0495664_0085930 | 3300046477 | Bacteria | 1889 |
| 455 | Ga0495664_0265164 | 3300046477 | Bacteria | 1038 |
| 456 | Ga0495664_0396666 | 3300046477 | Bacteria | 829 |
| 457 | Ga0495584_0068453 | 3300046491 | Bacteria | 1783 |
| 458 | Ga0495594_0142686 | 3300046499 | Unclassified | 1359 |
| 459 | Ga0495594_0717372 | 3300046499 | Unclassified | 565 |
| 460 | Ga0495596_0109550 | 3300046500 | Bacteria | 1072 |
| 461 | Ga0495607_0561538 | 3300046501 | Unclassified | 500 |
| 462 | Ga0495616_0098857 | 3300046513 | Bacteria | 1371 |
| 463 | Ga0495618_0075135 | 3300046514 | Bacteria | 2152 |
| 464 | Ga0495628_0040109 | 3300046516 | Bacteria | 3743 |
| 465 | Ga0495628_0240483 | 3300046516 | Bacteria | 1354 |
| 466 | Ga0495630_0009184 | 3300046517 | Bacteria | 7111 |
| 467 | Ga0495630_0128818 | 3300046517 | Unclassified | 1921 |
| 468 | Ga0495630_0304788 | 3300046517 | Bacteria | 1217 |
| 469 | Ga0495630_0618227 | 3300046517 | Bacteria | 830 |
| 470 | Ga0495630_0806157 | 3300046517 | Bacteria | 717 |
| 471 | Ga0495630_1389078 | 3300046517 | Bacteria | 528 |
| 472 | Ga0495644_0189253 | 3300046523 | Unclassified | 792 |
| 473 | Ga0495644_0210955 | 3300046523 | Unclassified | 750 |
| 474 | Ga0495663_0017803 | 3300046525 | Bacteria | 2019 |
| 475 | Ga0495663_0091510 | 3300046525 | Bacteria | 992 |
| 476 | Ga0495666_0272147 | 3300046526 | Bacteria | 769 |
| 477 | Ga0495642_0396798 | 3300046528 | Bacteria | 608 |
| 478 | Ga0495652_0064211 | 3300046529 | Bacteria | 3088 |
| 479 | Ga0495652_0290640 | 3300046529 | Bacteria | 1193 |
| 480 | Ga0495640_0034105 | 3300046533 | Bacteria | 3613 |
| 481 | Ga0495640_0269716 | 3300046533 | Bacteria | 1062 |
| 482 | Ga0495598_0153652 | 3300046537 | Bacteria | 805 |
| 483 | Ga0495645_0540215 | 3300046543 | Bacteria | 724 |
| 484 | Ga0495633_0189444 | 3300046558 | Bacteria | 946 |
| 485 | Ga0495667_0344454 | 3300046559 | Bacteria | 942 |
| 486 | Ga0495656_0585559 | 3300046615 | Unclassified | 596 |
| 487 | Ga0495634_0114196 | 3300046642 | Bacteria | 1734 |
| 488 | Ga0495634_0346799 | 3300046642 | Bacteria | 890 |
| 489 | Ga0495634_0446823 | 3300046642 | Bacteria | 763 |
| 490 | Ga0495611_0516656 | 3300046648 | Bacteria | 542 |
| 491 | Ga0495635_0239268 | 3300046663 | Bacteria | 1225 |
| 492 | Ga0495635_0250130 | 3300046663 | Bacteria | 1195 |
| 493 | Ga0495588_0247641 | 3300046674 | Unclassified | 940 |
| 494 | Ga0495588_0264245 | 3300046674 | Unclassified | 907 |
| 495 | Ga0495657_0111543 | 3300046675 | Bacteria | 1732 |
| 496 | Ga0495657_0370543 | 3300046675 | Bacteria | 845 |
| 497 | Ga0495599_0673543 | 3300046678 | Bacteria | 598 |
| 498 | Ga0495647_0103768 | 3300046681 | Bacteria | 1180 |
| 499 | Ga0495647_0634725 | 3300046681 | Unclassified | 502 |
| 500 | Ga0495658_0165817 | 3300046683 | Bacteria | 1365 |
| 501 | Ga0495658_0414643 | 3300046683 | Bacteria | 859 |
| 502 | Ga0495658_0502395 | 3300046683 | Bacteria | 776 |
| 503 | Ga0495658_0690998 | 3300046683 | Unclassified | 654 |
| 504 | Ga0495669_0235129 | 3300046684 | Bacteria | 879 |
| 505 | Ga0495613_0133825 | 3300046689 | Bacteria | 1775 |
| 506 | Ga0495613_0380051 | 3300046689 | Unclassified | 966 |
| 507 | Ga0495613_0601136 | 3300046689 | Bacteria | 732 |
| 508 | Ga0495624_0300842 | 3300046690 | Unclassified | 967 |
| 509 | Ga0495600_0227789 | 3300046809 | Bacteria | 1191 |
| 510 | Ga0495581_0092041 | 3300047315 | Bacteria | 1760 |
| 511 | Ga0495581_0179953 | 3300047315 | Unclassified | 1236 |
| 512 | Ga0495581_0393315 | 3300047315 | Bacteria | 809 |
| 513 | Ga0495604_0294286 | 3300047317 | Bacteria | 1092 |
| 514 | Ga0495674_0009324 | 3300047319 | Bacteria | 9331 |
| 515 | Ga0495674_0103168 | 3300047319 | Bacteria | 2425 |
| 516 | Ga0495674_0318022 | 3300047319 | Unclassified | 1269 |
| 517 | Ga0495674_0491221 | 3300047319 | Archaea | 983 |
| 518 | Ga0495674_0797275 | 3300047319 | Bacteria | 735 |
| 519 | Ga0495676_0066139 | 3300047321 | Unclassified | 2803 |
| 520 | Ga0495676_0212417 | 3300047321 | Bacteria | 1338 |
| 521 | Ga0495680_0005930 | 3300047322 | Bacteria | 11417 |
| 522 | Ga0495680_0669778 | 3300047322 | Bacteria | 688 |
| 523 | Ga0495675_0381074 | 3300047444 | Bacteria | 825 |
| 524 | Ga0495677_0237802 | 3300047445 | Unclassified | 711 |
| 525 | Ga0495684_0022218 | 3300047471 | Bacteria | 4885 |
| 526 | Ga0495684_0057195 | 3300047471 | Bacteria | 2973 |
| 527 | Ga0495684_0397777 | 3300047471 | Bacteria | 968 |
| 528 | Ga0495593_0102049 | 3300047673 | Bacteria | 1471 |
| 529 | Ga0495602_0183777 | 3300048088 | Unclassified | 1610 |
| 530 | Ga0495615_0251592 | 3300048090 | Unclassified | 560 |
| 531 | Ga0496100_0002185 | 3300048903 | Bacteria | 9870 |
| 532 | Ga0496100_0020706 | 3300048903 | Bacteria | 3948 |
| 533 | Ga0496100_0025887 | 3300048903 | Bacteria | 3591 |
| 534 | Ga0496100_0305948 | 3300048903 | Unclassified | 1191 |
| 535 | Ga0496100_0699457 | 3300048903 | Unclassified | 791 |
| 536 | Ga0496100_0817031 | 3300048903 | Bacteria | 731 |
| 537 | Ga0496100_0963270 | 3300048903 | Unclassified | 671 |
| 538 | Ga0496100_1039255 | 3300048903 | Unclassified | 645 |
| 539 | Ga0496101_0002439 | 3300048904 | Bacteria | 11431 |
| 540 | Ga0496101_0008696 | 3300048904 | Bacteria | 6640 |
| 541 | Ga0496101_0016853 | 3300048904 | Bacteria | 4946 |
| 542 | Ga0496101_0379540 | 3300048904 | Unclassified | 1112 |
| 543 | Ga0496101_0382242 | 3300048904 | Bacteria | 1108 |
| 544 | Ga0496101_0758989 | 3300048904 | Bacteria | 765 |
| 545 | Ga0496102_0021173 | 3300048905 | Bacteria | 5749 |
| 546 | Ga0496102_0548705 | 3300048905 | Bacteria | 1079 |
| 547 | Ga0496102_0834484 | 3300048905 | Unclassified | 844 |
| 548 | Ga0496102_0868282 | 3300048905 | Bacteria | 824 |
| 549 | Ga0496102_1550433 | 3300048905 | Bacteria | 581 |
| 550 | Ga0496103_0005429 | 3300048906 | Bacteria | 7630 |
| 551 | Ga0496103_0026543 | 3300048906 | Bacteria | 3505 |
| 552 | Ga0496104_0001048 | 3300048907 | Bacteria | 23633 |
| 553 | Ga0496104_0082104 | 3300048907 | Bacteria | 3074 |
| 554 | Ga0496104_0177193 | 3300048907 | Bacteria | 2042 |
| 555 | Ga0496104_0209737 | 3300048907 | Bacteria | 1860 |
| 556 | Ga0496104_0321021 | 3300048907 | Bacteria | 1461 |
| 557 | Ga0496104_1143534 | 3300048907 | Unclassified | 682 |
| 558 | Ga0496105_0000594 | 3300048908 | Bacteria | 24087 |
| 559 | Ga0496105_0099023 | 3300048908 | Bacteria | 2407 |
| 560 | Ga0496105_0144633 | 3300048908 | Bacteria | 1956 |
| 561 | Ga0496105_0472047 | 3300048908 | Bacteria | 988 |
| 562 | Ga0496105_1109397 | 3300048908 | Unclassified | 587 |
| 563 | Ga0496106_0036161 | 3300048909 | Bacteria | 3694 |
| 564 | Ga0496106_0118454 | 3300048909 | Unclassified | 2067 |
| 565 | Ga0496106_1401999 | 3300048909 | Unclassified | 540 |
| 566 | Ga0496106_1503968 | 3300048909 | Bacteria | 518 |
| 567 | Ga0496107_0000673 | 3300048910 | Bacteria | 19356 |
| 568 | Ga0496107_0008812 | 3300048910 | Bacteria | 6989 |
| 569 | Ga0496107_0066518 | 3300048910 | Unclassified | 2613 |
| 570 | Ga0496107_0257864 | 3300048910 | Unclassified | 1298 |
| 571 | Ga0496107_0540036 | 3300048910 | Bacteria | 864 |
| 572 | Ga0496108_0465257 | 3300048911 | Bacteria | 1105 |
| 573 | Ga0496108_0704571 | 3300048911 | Bacteria | 875 |
| 574 | Ga0496109_0000463 | 3300048912 | Bacteria | 34599 |
| 575 | Ga0496109_0049517 | 3300048912 | Bacteria | 3825 |
| 576 | Ga0496109_0359069 | 3300048912 | Bacteria | 1376 |
| 577 | Ga0496109_0378038 | 3300048912 | Unclassified | 1338 |
| 578 | Ga0496109_0519615 | 3300048912 | Bacteria | 1124 |
| 579 | Ga0496109_0668314 | 3300048912 | Unclassified | 976 |
| 580 | Ga0496109_0737544 | 3300048912 | Bacteria | 923 |
| 581 | Ga0496109_1071513 | 3300048912 | Bacteria | 743 |
| 582 | Ga0496110_0000563 | 3300048913 | Bacteria | 25359 |
| 583 | Ga0496110_0150252 | 3300048913 | Bacteria | 2109 |
| 584 | Ga0496110_0521296 | 3300048913 | Unclassified | 1081 |
| 585 | Ga0496110_1204639 | 3300048913 | Unclassified | 666 |
| 586 | Ga0496110_1708421 | 3300048913 | Bacteria | 540 |
| 587 | Ga0496111_0022674 | 3300048914 | Bacteria | 4398 |
| 588 | Ga0496111_0186381 | 3300048914 | Bacteria | 1543 |
| 589 | Ga0496111_0842352 | 3300048914 | Unclassified | 662 |
| 590 | Ga0496111_0851391 | 3300048914 | Unclassified | 658 |
| 591 | Ga0496112_0144311 | 3300048915 | Bacteria | 2349 |
| 592 | Ga0496112_0150553 | 3300048915 | Unclassified | 2294 |
| 593 | Ga0496112_0532657 | 3300048915 | Unclassified | 1109 |
| 594 | Ga0496114_0000690 | 3300048917 | Bacteria | 25130 |
| 595 | Ga0496114_0002459 | 3300048917 | Bacteria | 14136 |
| 596 | Ga0496114_0002627 | 3300048917 | Bacteria | 13713 |
| 597 | Ga0496114_0047191 | 3300048917 | Bacteria | 3582 |
| 598 | Ga0496114_0180097 | 3300048917 | Bacteria | 1845 |
| 599 | Ga0496114_0209512 | 3300048917 | Bacteria | 1709 |
| 600 | Ga0496114_0912086 | 3300048917 | Unclassified | 760 |
| 601 | Ga0496115_0000573 | 3300048918 | Bacteria | 28473 |
| 602 | Ga0496115_0043515 | 3300048918 | Unclassified | 3582 |
| 603 | Ga0496115_0406679 | 3300048918 | Bacteria | 1104 |
| 604 | Ga0496115_0911488 | 3300048918 | Bacteria | 677 |
| 605 | Ga0501040_0551565 | 3300049576 | Bacteria | 832 |
| 606 | Ga0501071_0379183 | 3300049587 | Unclassified | 1078 |
| 607 | Ga0501072_1426238 | 3300049588 | Archaea | 535 |
| 608 | Ga0501076_1079165 | 3300049592 | Bacteria | 661 |
| 609 | Ga0501077_0141386 | 3300049593 | Bacteria | 1527 |
| 610 | nmdc:mga04h51_471231_c1 | 3300050495 | Bacteria | 533 |
| 611 | nmdc:mga05p37_372337_c1 | 3300050507 | Bacteria | 1676 |
| 612 | nmdc:mga08y16_1179110_c1 | 3300050511 | Bacteria | 737 |
| 613 | nmdc:mga08y16_478539_c1 | 3300050511 | Bacteria | 1267 |
| 614 | nmdc:mga0n895_133995_c1 | 3300050512 | Bacteria | 2503 |
| 615 | nmdc:mga0n895_508479_c1 | 3300050512 | Bacteria | 1213 |
| 616 | nmdc:mga0n895_517606_c1 | 3300050512 | Bacteria | 1201 |
| 617 | nmdc:mga0rr50_1020707_c1 | 3300050513 | Bacteria | 704 |
| 618 | nmdc:mga0rr50_638978_c1 | 3300050513 | Unclassified | 908 |
| 619 | nmdc:mga0a205_341502_c1 | 3300050515 | Bacteria | 1366 |
| 620 | Ga0495601_0052472 | 3300053077 | Bacteria | 2575 |
| 621 | Ga0495601_0483968 | 3300053077 | Unclassified | 799 |
| 622 | Ga0495601_0694837 | 3300053077 | Bacteria | 649 |
| 623 | Ga0495612_0525702 | 3300053078 | Bacteria | 544 |
| 624 | Ga0495595_0332061 | 3300053084 | Bacteria | 766 |
| 625 | Ga0495619_0649684 | 3300053085 | Bacteria | 719 |
| 626 | Ga0501084_0764382 | 3300054114 | Bacteria | 814 |
| 627 | Ga0590074_128521 | 3300059423 | Unclassified | 508 |
| 628 | Ga0590075_090688 | 3300059424 | Bacteria | 793 |
| 629 | Ga0070682_101212651 | |||
| 630 | JGI24747J21853_1045065 | |||
| 631 | JGI24744J21845_10000410 | |||
| 632 | Ga0070658_10672549 | |||
| 633 | Ga0070683_100006137 | |||
| 634 | Ga0070683_100272382 | |||
| 635 | Ga0070683_102408302 | |||
| 636 | Ga0070690_100012069 | |||
| 637 | Ga0070690_100506397 | |||
| 638 | Ga0070670_100693959 | |||
| 639 | Ga0070680_100030305 | |||
| 640 | Ga0070682_100007934 | |||
| 641 | Ga0070682_100063983 | |||
| 642 | Ga0068868_100037618 | |||
| 643 | Ga0068868_100218460 | |||
| 644 | Ga0068868_101454104 | |||
| 645 | Ga0068868_101994668 | |||
| 646 | Ga0070660_100019684 | |||
| 647 | Ga0070660_100025989 | |||
| 648 | Ga0070660_100527460 | |||
| 649 | Ga0070660_101296374 | |||
| 650 | Ga0070689_100009699 | |||
| 651 | Ga0070691_10030950 | |||
| 652 | Ga0070691_10100035 | |||
| 653 | Ga0070691_10228038 | |||
| 654 | Ga0070687_100005183 | |||
| 655 | Ga0070687_100226857 | |||
| 656 | Ga0070661_100511525 | |||
| 657 | Ga0070661_100875713 | |||
| 658 | Ga0070692_10027586 | |||
| 659 | Ga0070692_10279218 | |||
| 660 | Ga0070668_100013713 | |||
| 661 | Ga0070668_101141606 | |||
| 662 | Ga0070669_101476916 | |||
| 663 | Ga0070671_100530355 | |||
| 664 | Ga0070671_100819471 | |||
| 665 | Ga0070671_101284930 | |||
| 666 | Ga0070674_100004923 | |||
| 667 | Ga0070674_100123751 | |||
| 668 | Ga0070674_101470787 | |||
| 669 | Ga0070674_101549292 | |||
| 670 | Ga0070673_100637436 | |||
| 671 | Ga0070688_100003350 | |||
| 672 | Ga0070659_100056777 | |||
| 673 | Ga0070659_100589886 | |||
| 674 | Ga0070659_101671235 | |||
| 675 | Ga0070667_100080041 | |||
| 676 | Ga0070703_10023309 | |||
| 677 | Ga0070709_10055623 | |||
| 678 | Ga0070714_100009128 | |||
| 679 | Ga0070710_10443987 | |||
| 680 | Ga0070701_10002318 | |||
| 681 | Ga0070701_10422304 | |||
| 682 | Ga0070711_100004585 | |||
| 683 | Ga0070711_101299750 | |||
| 684 | Ga0070711_101858472 | |||
| 685 | Ga0070705_100254000 | |||
| 686 | Ga0070705_101343263 | |||
| 687 | Ga0070700_100000684 | |||
| 688 | Ga0070700_100425708 | |||
| 689 | Ga0070694_100025678 | |||
| 690 | Ga0070694_101155679 | |||
| 691 | Ga0070708_101358568 | |||
| 692 | Ga0070663_100350505 | |||
| 693 | Ga0070678_100011232 | |||
| 694 | Ga0070678_100018364 | |||
| 695 | Ga0070678_100150510 | |||
| 696 | Ga0070678_101012146 | |||
| 697 | Ga0070662_100021355 | |||
| 698 | Ga0070662_100025079 | |||
| 699 | Ga0070662_100430348 | |||
| 700 | Ga0070662_100496269 | |||
| 701 | Ga0070681_10007772 | |||
| 702 | Ga0070681_10217719 | |||
| 703 | Ga0070681_10634274 | |||
| 704 | Ga0070681_11012552 | |||
| 705 | Ga0068867_100000986 | |||
| 706 | Ga0068867_102129086 | |||
| 707 | Ga0070685_10053078 | |||
| 708 | Ga0070707_100039303 | |||
| 709 | Ga0070707_100387181 | |||
| 710 | Ga0070707_100555468 | |||
| 711 | Ga0070707_100661764 | |||
| 712 | Ga0070698_100125523 | |||
| 713 | Ga0070699_100041716 | |||
| 714 | Ga0070699_100120611 | |||
| 715 | Ga0070699_101995221 | |||
| 716 | Ga0070679_100004971 | |||
| 717 | Ga0070679_100030308 | |||
| 718 | Ga0070679_100216519 | |||
| 719 | Ga0070684_100008974 | |||
| 720 | Ga0070684_100104520 | |||
| 721 | Ga0070684_101235465 | |||
| 722 | Ga0070697_100144168 | |||
| 723 | Ga0070697_100215161 | |||
| 724 | Ga0068853_100034461 | |||
| 725 | Ga0068853_100997550 | |||
| 726 | Ga0070672_100021126 | |||
| 727 | Ga0070672_100527137 | |||
| 728 | Ga0070686_100000523 | |||
| 729 | Ga0070686_100540515 | |||
| 730 | Ga0070686_100936352 | |||
| 731 | Ga0070695_100686423 | |||
| 732 | Ga0070695_100936883 | |||
| 733 | Ga0070696_100001749 | |||
| 734 | Ga0070696_100462458 | |||
| 735 | Ga0070696_101699421 | |||
| 736 | Ga0070693_100034299 | |||
| 737 | Ga0070693_100068056 | |||
| 738 | Ga0070665_100057638 | |||
| 739 | Ga0070665_101469562 | |||
| 740 | Ga0070704_100468730 | |||
| 741 | Ga0070704_100637239 | |||
| 742 | Ga0070704_101789243 | |||
| 743 | Ga0068855_100012336 | |||
| 744 | Ga0070664_100103297 | |||
| 745 | Ga0070664_100109531 | |||
| 746 | Ga0068857_100342218 | |||
| 747 | Ga0068854_100605057 | |||
| 748 | Ga0068854_102050459 | |||
| 749 | Ga0068856_100014810 | |||
| 750 | Ga0068856_100030731 | |||
| 751 | Ga0068856_100059750 | |||
| 752 | Ga0068856_100501038 | |||
| 753 | Ga0070702_100006305 | |||
| 754 | Ga0070702_100035408 | |||
| 755 | Ga0070702_100229291 | |||
| 756 | Ga0068852_100305044 | |||
| 757 | Ga0068852_100546967 | |||
| 758 | Ga0068852_100973099 | |||
| 759 | Ga0068859_102505504 | |||
| 760 | Ga0068864_100309030 | |||
| 761 | Ga0068866_10002569 | |||
| 762 | Ga0068866_10138400 | |||
| 763 | Ga0068861_100135858 | |||
| 764 | Ga0068858_100622056 | |||
| 765 | Ga0081455_10009763 | |||
| 766 | Ga0081455_10111753 | |||
| 767 | Ga0081455_10124371 | |||
| 768 | Ga0081455_10279425 | |||
| 769 | Ga0081538_10050214 | |||
| 770 | Ga0070717_10179498 | |||
| 771 | Ga0070717_10509348 | |||
| 772 | Ga0075365_10937759 | |||
| 773 | Ga0075432_10034493 | |||
| 774 | Ga0070715_10677782 | |||
| 775 | Ga0070712_100018552 | |||
| 776 | Ga0075362_10212789 | |||
| 777 | Ga0097621_100018941 | |||
| 778 | Ga0097621_100142929 | |||
| 779 | Ga0097621_101385735 | |||
| 780 | Ga0068871_100045220 | |||
| 781 | Ga0068871_100089661 | |||
| 782 | Ga0068871_101689656 | |||
| 783 | Ga0075433_10176680 | |||
| 784 | Ga0075434_100060407 | |||
| 785 | Ga0068865_100000286 | |||
| 786 | Ga0068865_100548610 | |||
| 787 | Ga0075436_101521976 | |||
| 788 | Ga0097620_102506136 | |||
| 789 | Ga0075435_100638105 | |||
| 790 | Ga0075435_101070210 | |||
| 791 | Ga0105240_10147746 | |||
| 792 | Ga0105240_12188349 | |||
| 793 | Ga0111539_10082650 | |||
| 794 | Ga0105245_10012042 | |||
| 795 | Ga0105245_10046901 | |||
| 796 | Ga0105245_10613118 | |||
| 797 | Ga0105245_11440031 | |||
| 798 | Ga0105245_11551381 | |||
| 799 | Ga0105245_12096095 | |||
| 800 | Ga0105245_12154029 | |||
| 801 | Ga0114129_10043799 | |||
| 802 | Ga0114129_10100464 | |||
| 803 | Ga0114129_10236759 | |||
| 804 | Ga0114129_11512839 | |||
| 805 | Ga0114129_13477749 | |||
| 806 | Ga0105243_10003355 | |||
| 807 | Ga0105243_10079115 | |||
| 808 | Ga0105243_10226869 | |||
| 809 | Ga0105243_10317818 | |||
| 810 | Ga0105243_12590892 | |||
| 811 | Ga0105241_12448238 | |||
| 812 | Ga0105242_10005827 | |||
| 813 | Ga0105242_10124576 | |||
| 814 | Ga0105242_10338677 | |||
| 815 | Ga0105242_10396438 | |||
| 816 | Ga0105242_10933145 | |||
| 817 | Ga0105242_12352098 | |||
| 818 | Ga0105242_13047764 | |||
| 819 | Ga0105248_10193901 | |||
| 820 | Ga0105248_10411428 | |||
| 821 | Ga0105248_10777686 | |||
| 822 | Ga0105238_10236880 | |||
| 823 | Ga0105238_10645273 | |||
| 824 | Ga0105238_11320163 | |||
| 825 | Ga0105249_10004882 | |||
| 826 | Ga0105249_10641465 | |||
| 827 | Ga0105249_11321702 | |||
| 828 | Ga0105249_11672961 | |||
| 829 | Ga0105249_12003212 | |||
| 830 | Ga0105239_10004320 | |||
| 831 | Ga0105239_10264646 | |||
| 832 | Ga0105239_10570940 | |||
| 833 | Ga0105239_11136654 | |||
| 834 | Ga0157371_10298194 | |||
| 835 | Ga0157371_10543866 | |||
| 836 | Ga0157370_10018418 | |||
| 837 | Ga0157369_10302486 | |||
| 838 | Ga0157369_10555127 | |||
| 839 | Ga0157374_10820952 | |||
| 840 | Ga0157374_11201040 | |||
| 841 | Ga0157374_11856567 | |||
| 842 | Ga0157378_10004820 | |||
| 843 | Ga0157378_13135436 | |||
| 844 | Ga0163162_10010276 | |||
| 845 | Ga0163162_13210420 | |||
| 846 | Ga0157372_10103797 | |||
| 847 | Ga0157372_10955924 | |||
| 848 | Ga0157372_12220660 | |||
| 849 | Ga0157375_10010067 | |||
| 850 | Ga0157375_10751356 | |||
| 851 | Ga0163163_10267763 | |||
| 852 | Ga0157380_10039843 | |||
| 853 | Ga0157380_10596941 | |||
| 854 | Ga0157380_12859205 | |||
| 855 | Ga0157380_13040250 | |||
| 856 | Ga0157380_13203603 | |||
| 857 | Ga0157377_10011422 | |||
| 858 | Ga0157377_10029870 | |||
| 859 | Ga0157377_10106494 | |||
| 860 | Ga0157377_10124075 | |||
| 861 | Ga0157379_10220463 | |||
| 862 | Ga0157376_10045663 | |||
| 863 | Ga0157376_10090003 | |||
| 864 | Ga0182007_10251746 | |||
| 865 | Ga0163161_11056075 | |||
| 866 | Ga0163161_11895532 | |||
| 867 | Ga0206356_11500200 | |||
| 868 | Ga0206353_10197676 | |||
| 869 | Ga0207653_10362714 | |||
| 870 | Ga0207642_10000768 | |||
| 871 | Ga0207680_10092189 | |||
| 872 | Ga0207699_10105056 | |||
| 873 | Ga0207684_10019221 | |||
| 874 | Ga0207654_10024204 | |||
| 875 | Ga0207707_10018166 | |||
| 876 | Ga0207707_10075070 | |||
| 877 | Ga0207707_10662861 | |||
| 878 | Ga0207707_10813439 | |||
| 879 | Ga0207695_10519927 | |||
| 880 | Ga0207693_10037975 | |||
| 881 | Ga0207663_10002331 | |||
| 882 | Ga0207663_10504026 | |||
| 883 | Ga0207660_10012481 | |||
| 884 | Ga0207660_10034647 | |||
| 885 | Ga0207660_10085305 | |||
| 886 | Ga0207662_10076268 | |||
| 887 | Ga0207657_10000773 | |||
| 888 | Ga0207657_10035878 | |||
| 889 | Ga0207657_10174600 | |||
| 890 | Ga0207657_10494401 | |||
| 891 | Ga0207652_10004716 | |||
| 892 | Ga0207652_10384469 | |||
| 893 | Ga0207646_10024074 | |||
| 894 | Ga0207646_10304374 | |||
| 895 | Ga0207681_11379416 | |||
| 896 | Ga0207687_10013317 | |||
| 897 | Ga0207687_10020012 | |||
| 898 | Ga0207687_10315664 | |||
| 899 | Ga0207687_10315984 | |||
| 900 | Ga0207664_10000776 | |||
| 901 | Ga0207664_10714810 | |||
| 902 | Ga0207664_10868636 | |||
| 903 | Ga0207644_10390951 | |||
| 904 | Ga0207644_10885107 | |||
| 905 | Ga0207644_11004827 | |||
| 906 | Ga0207644_11588393 | |||
| 907 | Ga0207690_10216314 | |||
| 908 | Ga0207690_10329120 | |||
| 909 | Ga0207706_10017269 | |||
| 910 | Ga0207706_10037817 | |||
| 911 | Ga0207706_10202201 | |||
| 912 | Ga0207706_11186675 | |||
| 913 | Ga0207706_11516106 | |||
| 914 | Ga0207686_10066287 | |||
| 915 | Ga0207686_10224314 | |||
| 916 | Ga0207686_10293493 | |||
| 917 | Ga0207686_10406996 | |||
| 918 | Ga0207686_10452261 | |||
| 919 | Ga0207686_10827891 | |||
| 920 | Ga0207709_10001144 | |||
| 921 | Ga0207709_10236093 | |||
| 922 | Ga0207709_10285277 | |||
| 923 | Ga0207709_10631359 | |||
| 924 | Ga0207670_10015173 | |||
| 925 | Ga0207669_10002896 | |||
| 926 | Ga0207704_10004281 | |||
| 927 | Ga0207704_10770110 | |||
| 928 | Ga0207704_11582192 | |||
| 929 | Ga0207691_10045781 | |||
| 930 | Ga0207691_10189702 | |||
| 931 | Ga0207691_10292068 | |||
| 932 | Ga0207711_10489440 | |||
| 933 | Ga0207711_10724072 | |||
| 934 | Ga0207711_10794358 | |||
| 935 | Ga0207711_11789418 | |||
| 936 | Ga0207689_10538311 | |||
| 937 | Ga0207689_11565040 | |||
| 938 | Ga0207661_10001854 | |||
| 939 | Ga0207661_10135798 | |||
| 940 | Ga0207661_10219974 | |||
| 941 | Ga0207679_10097319 | |||
| 942 | Ga0207679_10191020 | |||
| 943 | Ga0207667_11138237 | |||
| 944 | Ga0207667_11143870 | |||
| 945 | Ga0207712_10007418 | |||
| 946 | Ga0207712_11761050 | |||
| 947 | Ga0207668_10106295 | |||
| 948 | Ga0207668_10928145 | |||
| 949 | Ga0207640_10373228 | |||
| 950 | Ga0207640_10501779 | |||
| 951 | Ga0207640_10718881 | |||
| 952 | Ga0207640_12168802 | |||
| 953 | Ga0207677_10054113 | |||
| 954 | Ga0207677_10171903 | |||
| 955 | Ga0207677_10999300 | |||
| 956 | Ga0207677_11493041 | |||
| 957 | Ga0207639_10396460 | |||
| 958 | Ga0207639_10432840 | |||
| 959 | Ga0207639_11525321 | |||
| 960 | Ga0207678_10202273 | |||
| 961 | Ga0207678_11869026 | |||
| 962 | Ga0207708_10000370 | |||
| 963 | Ga0207708_10501713 | |||
| 964 | Ga0207702_10040004 | |||
| 965 | Ga0207702_10054630 | |||
| 966 | Ga0207702_10527968 | |||
| 967 | Ga0207702_12123639 | |||
| 968 | Ga0207648_10002247 | |||
| 969 | Ga0207648_10089303 | |||
| 970 | Ga0207648_10130330 | |||
| 971 | Ga0207674_10344720 | |||
| 972 | Ga0207675_100084685 | |||
| 973 | Ga0207675_100116389 | |||
| 974 | Ga0207675_100335667 | |||
| 975 | Ga0207683_10001015 | |||
| 976 | Ga0207683_10031089 | |||
| 977 | Ga0207683_11927582 | |||
| 978 | Ga0207698_10177735 | |||
| 979 | Ga0207428_10132846 | |||
| 980 | Ga0268266_10043992 | |||
| 981 | Ga0268266_12071057 | |||
| 982 | Ga0268265_11042009 | |||
| 983 | Ga0268265_11050525 | |||
| 984 | Ga0307405_11464240 | |||
| 985 | Ga0307413_11745798 | |||
| 986 | Ga0307406_11673498 | |||
| 987 | Ga0307409_100482118 | |||
| 988 | Ga0307409_101215963 | |||
| 989 | Ga0307409_101315182 | |||
| 990 | Ga0307416_100888041 | |||
| 991 | Ga0307411_11971045 | |||
| 992 | Ga0373943_0030324 | |||
| 993 | Ga0373946_0504353 | |||
| 994 | Ga0373924_0240892 | |||
| 995 | Ga0373931_0358219 | |||
| 996 | Ga0373927_0032417 | |||
| 997 | Ga0373933_0435097 | |||
| 998 | Ga0373947_0000750 | |||
| 999 | Ga0373937_0877241 | |||
| 1000 | Ga0373925_0031560 | |||
| 1001 | Ga0373925_0739433 | |||
| 1002 | Ga0395899_0010490 | |||
| 1003 | Ga0395899_0012927 | |||
| 1004 | Ga0395899_0084844 | |||
| 1005 | Ga0395899_0202531 | |||
| 1006 | Ga0395899_0542972 | |||
| 1007 | Ga0395900_0031507 | |||
| 1008 | Ga0395900_0052648 | |||
| 1009 | Ga0395900_0087736 | |||
| 1010 | Ga0395900_0108730 | |||
| 1011 | Ga0395900_0126870 | |||
| 1012 | Ga0395900_0199942 | |||
| 1013 | Ga0395900_0228270 | |||
| 1014 | Ga0395900_0591948 | |||
| 1015 | Ga0395900_0897764 | |||
| 1016 | Ga0395900_1003527 | |||
| 1017 | Ga0395898_0003542 | |||
| 1018 | Ga0395898_0003781 | |||
| 1019 | Ga0395898_0012138 | |||
| 1020 | Ga0395898_0040492 | |||
| 1021 | Ga0395898_0529115 | |||
| 1022 | Ga0395898_0568489 | |||
| 1023 | Ga0395898_1373279 | |||
| 1024 | Ga0395898_1404753 | |||
| 1025 | Ga0395905_0008588 | |||
| 1026 | Ga0395905_0018120 | |||
| 1027 | Ga0395905_0023055 | |||
| 1028 | Ga0395905_0034723 | |||
| 1029 | Ga0395905_0037392 | |||
| 1030 | Ga0395905_0047036 | |||
| 1031 | Ga0395901_0001220 | |||
| 1032 | Ga0395901_0015468 | |||
| 1033 | Ga0395901_0026068 | |||
| 1034 | Ga0395901_0027185 | |||
| 1035 | Ga0395901_0071870 | |||
| 1036 | Ga0395901_0826996 | |||
| 1037 | Ga0395901_1521765 | |||
| 1038 | Ga0439436_0149161 | |||
| 1039 | Ga0439447_087527 | |||
| 1040 | Ga0439453_0039286 | |||
| 1041 | Ga0439461_0004195 | |||
| 1042 | Ga0451807_2706511 | |||
| 1043 | Ga0451835_0562485 | |||
| 1044 | Ga0451847_0748361 | |||
| 1045 | Ga0451851_0052068 | |||
| 1046 | Ga0451853_1372945 | |||
| 1047 | Ga0451853_2994250 | |||
| 1048 | Ga0451853_3609184 | |||
| 1049 | Ga0439441_010822 | |||
| 1050 | Ga0439445_0028798 | |||
| 1051 | Ga0439445_0121430 | |||
| 1052 | Ga0439451_057667 | |||
| 1053 | Ga0450920_003237 | |||
| 1054 | Ga0450920_016222 | |||
| 1055 | Ga0450907_056905 | |||
| 1056 | Ga0439446_0229588 | |||
| 1057 | Ga0439446_0231376 | |||
| 1058 | Ga0450908_051993 | |||
| 1059 | Ga0450909_035676 | |||
| 1060 | Ga0439434_0023797 | |||
| 1061 | Ga0451577_0471418 | |||
| 1062 | Ga0466966_0202891 | |||
| 1063 | Ga0451576_0478706 | |||
| 1064 | Ga0451576_0821809 | |||
| 1065 | Ga0466958_0817821 | |||
| 1066 | Ga0495603_0019923 | |||
| 1067 | Ga0495603_0109033 | |||
| 1068 | Ga0495603_0254908 | |||
| 1069 | Ga0495603_0261612 | |||
| 1070 | Ga0495629_0002899 | |||
| 1071 | Ga0495629_0036795 | |||
| 1072 | Ga0495641_0078393 | |||
| 1073 | Ga0495651_0016245 | |||
| 1074 | Ga0495653_0089608 | |||
| 1075 | Ga0495653_0681305 | |||
| 1076 | Ga0495582_0144308 | |||
| 1077 | Ga0495582_0270376 | |||
| 1078 | Ga0495582_0375267 | |||
| 1079 | Ga0495582_0650289 | |||
| 1080 | Ga0495605_0446440 | |||
| 1081 | Ga0495639_0169474 | |||
| 1082 | Ga0495664_0085930 | |||
| 1083 | Ga0495664_0265164 | |||
| 1084 | Ga0495664_0396666 | |||
| 1085 | Ga0495584_0068453 | |||
| 1086 | Ga0495594_0142686 | |||
| 1087 | Ga0495594_0717372 | |||
| 1088 | Ga0495596_0109550 | |||
| 1089 | Ga0495607_0561538 | |||
| 1090 | Ga0495616_0098857 | |||
| 1091 | Ga0495618_0075135 | |||
| 1092 | Ga0495628_0040109 | |||
| 1093 | Ga0495628_0240483 | |||
| 1094 | Ga0495630_0009184 | |||
| 1095 | Ga0495630_0128818 | |||
| 1096 | Ga0495630_0304788 | |||
| 1097 | Ga0495630_0618227 | |||
| 1098 | Ga0495630_0806157 | |||
| 1099 | Ga0495630_1389078 | |||
| 1100 | Ga0495644_0189253 | |||
| 1101 | Ga0495644_0210955 | |||
| 1102 | Ga0495663_0017803 | |||
| 1103 | Ga0495663_0091510 | |||
| 1104 | Ga0495666_0272147 | |||
| 1105 | Ga0495642_0396798 | |||
| 1106 | Ga0495652_0064211 | |||
| 1107 | Ga0495652_0290640 | |||
| 1108 | Ga0495640_0034105 | |||
| 1109 | Ga0495640_0269716 | |||
| 1110 | Ga0495598_0153652 | |||
| 1111 | Ga0495645_0540215 | |||
| 1112 | Ga0495633_0189444 | |||
| 1113 | Ga0495667_0344454 | |||
| 1114 | Ga0495656_0585559 | |||
| 1115 | Ga0495634_0114196 | |||
| 1116 | Ga0495634_0346799 | |||
| 1117 | Ga0495634_0446823 | |||
| 1118 | Ga0495611_0516656 | |||
| 1119 | Ga0495635_0239268 | |||
| 1120 | Ga0495635_0250130 | |||
| 1121 | Ga0495588_0247641 | |||
| 1122 | Ga0495588_0264245 | |||
| 1123 | Ga0495657_0111543 | |||
| 1124 | Ga0495657_0370543 | |||
| 1125 | Ga0495599_0673543 | |||
| 1126 | Ga0495647_0103768 | |||
| 1127 | Ga0495647_0634725 | |||
| 1128 | Ga0495658_0165817 | |||
| 1129 | Ga0495658_0414643 | |||
| 1130 | Ga0495658_0502395 | |||
| 1131 | Ga0495658_0690998 | |||
| 1132 | Ga0495669_0235129 | |||
| 1133 | Ga0495613_0133825 | |||
| 1134 | Ga0495613_0380051 | |||
| 1135 | Ga0495613_0601136 | |||
| 1136 | Ga0495624_0300842 | |||
| 1137 | Ga0495600_0227789 | |||
| 1138 | Ga0495581_0092041 | |||
| 1139 | Ga0495581_0179953 | |||
| 1140 | Ga0495581_0393315 | |||
| 1141 | Ga0495604_0294286 | |||
| 1142 | Ga0495674_0009324 | |||
| 1143 | Ga0495674_0103168 | |||
| 1144 | Ga0495674_0318022 | |||
| 1145 | Ga0495674_0491221 | |||
| 1146 | Ga0495674_0797275 | |||
| 1147 | Ga0495676_0066139 | |||
| 1148 | Ga0495676_0212417 | |||
| 1149 | Ga0495680_0005930 | |||
| 1150 | Ga0495680_0669778 | |||
| 1151 | Ga0495675_0381074 | |||
| 1152 | Ga0495677_0237802 | |||
| 1153 | Ga0495684_0022218 | |||
| 1154 | Ga0495684_0057195 | |||
| 1155 | Ga0495684_0397777 | |||
| 1156 | Ga0495593_0102049 | |||
| 1157 | Ga0495602_0183777 | |||
| 1158 | Ga0495615_0251592 | |||
| 1159 | Ga0496100_0002185 | |||
| 1160 | Ga0496100_0020706 | |||
| 1161 | Ga0496100_0025887 | |||
| 1162 | Ga0496100_0305948 | |||
| 1163 | Ga0496100_0699457 | |||
| 1164 | Ga0496100_0817031 | |||
| 1165 | Ga0496100_0963270 | |||
| 1166 | Ga0496100_1039255 | |||
| 1167 | Ga0496101_0002439 | |||
| 1168 | Ga0496101_0008696 | |||
| 1169 | Ga0496101_0016853 | |||
| 1170 | Ga0496101_0379540 | |||
| 1171 | Ga0496101_0382242 | |||
| 1172 | Ga0496101_0758989 | |||
| 1173 | Ga0496102_0021173 | |||
| 1174 | Ga0496102_0548705 | |||
| 1175 | Ga0496102_0834484 | |||
| 1176 | Ga0496102_0868282 | |||
| 1177 | Ga0496102_1550433 | |||
| 1178 | Ga0496103_0005429 | |||
| 1179 | Ga0496103_0026543 | |||
| 1180 | Ga0496104_0001048 | |||
| 1181 | Ga0496104_0082104 | |||
| 1182 | Ga0496104_0177193 | |||
| 1183 | Ga0496104_0209737 | |||
| 1184 | Ga0496104_0321021 | |||
| 1185 | Ga0496104_1143534 | |||
| 1186 | Ga0496105_0000594 | |||
| 1187 | Ga0496105_0099023 | |||
| 1188 | Ga0496105_0144633 | |||
| 1189 | Ga0496105_0472047 | |||
| 1190 | Ga0496105_1109397 | |||
| 1191 | Ga0496106_0036161 | |||
| 1192 | Ga0496106_0118454 | |||
| 1193 | Ga0496106_1401999 | |||
| 1194 | Ga0496106_1503968 | |||
| 1195 | Ga0496107_0000673 | |||
| 1196 | Ga0496107_0008812 | |||
| 1197 | Ga0496107_0066518 | |||
| 1198 | Ga0496107_0257864 | |||
| 1199 | Ga0496107_0540036 | |||
| 1200 | Ga0496108_0465257 | |||
| 1201 | Ga0496108_0704571 | |||
| 1202 | Ga0496109_0000463 | |||
| 1203 | Ga0496109_0049517 | |||
| 1204 | Ga0496109_0359069 | |||
| 1205 | Ga0496109_0378038 | |||
| 1206 | Ga0496109_0519615 | |||
| 1207 | Ga0496109_0668314 | |||
| 1208 | Ga0496109_0737544 | |||
| 1209 | Ga0496109_1071513 | |||
| 1210 | Ga0496110_0000563 | |||
| 1211 | Ga0496110_0150252 | |||
| 1212 | Ga0496110_0521296 | |||
| 1213 | Ga0496110_1204639 | |||
| 1214 | Ga0496110_1708421 | |||
| 1215 | Ga0496111_0022674 | |||
| 1216 | Ga0496111_0186381 | |||
| 1217 | Ga0496111_0842352 | |||
| 1218 | Ga0496111_0851391 | |||
| 1219 | Ga0496112_0144311 | |||
| 1220 | Ga0496112_0150553 | |||
| 1221 | Ga0496112_0532657 | |||
| 1222 | Ga0496114_0000690 | |||
| 1223 | Ga0496114_0002459 | |||
| 1224 | Ga0496114_0002627 | |||
| 1225 | Ga0496114_0047191 | |||
| 1226 | Ga0496114_0180097 | |||
| 1227 | Ga0496114_0209512 | |||
| 1228 | Ga0496114_0912086 | |||
| 1229 | Ga0496115_0000573 | |||
| 1230 | Ga0496115_0043515 | |||
| 1231 | Ga0496115_0406679 | |||
| 1232 | Ga0496115_0911488 | |||
| 1233 | Ga0501040_0551565 | |||
| 1234 | Ga0501071_0379183 | |||
| 1235 | Ga0501072_1426238 | |||
| 1236 | Ga0501076_1079165 | |||
| 1237 | Ga0501077_0141386 | |||
| 1238 | nmdc:mga04h51_471231_c1 | |||
| 1239 | nmdc:mga05p37_372337_c1 | |||
| 1240 | nmdc:mga08y16_1179110_c1 | |||
| 1241 | nmdc:mga08y16_478539_c1 | |||
| 1242 | nmdc:mga0n895_133995_c1 | |||
| 1243 | nmdc:mga0n895_508479_c1 | |||
| 1244 | nmdc:mga0n895_517606_c1 | |||
| 1245 | nmdc:mga0rr50_1020707_c1 | |||
| 1246 | nmdc:mga0rr50_638978_c1 | |||
| 1247 | nmdc:mga0a205_341502_c1 | |||
| 1248 | Ga0495601_0052472 | |||
| 1249 | Ga0495601_0483968 | |||
| 1250 | Ga0495601_0694837 | |||
| 1251 | Ga0495612_0525702 | |||
| 1252 | Ga0495595_0332061 | |||
| 1253 | Ga0495619_0649684 | |||
| 1254 | Ga0501084_0764382 | |||
| 1255 | Ga0590074_128521 | |||
| 1256 | Ga0590075_090688 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4oi3-assembly1.cif.gz_B | crystal structure analysis of sco4226 from streptomyces coelicolor a3(2) | 0.7736 | 3 | 84 |
| 3rhu-assembly1.cif.gz_A | epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins | 0.7578 | 35 | 59 |
| 4oi3-assembly1.cif.gz_B | crystal structure analysis of sco4226 from streptomyces coelicolor a3(2) | 0.7499 | 3 | 84 |
| 3edd-assembly1.cif.gz_A | structural base for cyclodextrin hydrolysis | 0.7483 | 39 | 59 |
| 4x4p-assembly5.cif.gz_C | crystal structure of the a.fulgidus cca-adding enzyme in complex with a g70a arginyl-trna minihelix ending in ccac | 0.7316 | 2 | 60 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4DS91_59_305_1.10.510.10 | Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 | 0.8316 | 39 | 62 | 1.10.510.10 |
| af_E9AH80_569_880_1.10.510.10 | Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 | 0.8277 | 39 | 58 | 1.10.510.10 |
| 4oi3B00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer | 0.7854 | 4 | 84 | 3.30.70.3090 |
| af_Q559E5_5_168_3.30.980.10 | Alpha Beta;2-Layer Sandwich;Threonyl-tRNA Synthetase; Chain A, domain 2;Threonyl-trna Synthetase; Chain A, domain 2 | 0.7729 | 39 | 59 | 3.30.980.10 |
| 4oi3B00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer | 0.7601 | 4 | 84 | 3.30.70.3090 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A535A836-F1-model_v4 | DUF4242 domain-containing protein | 0.9837 | 1 | 84 |
|
| AF-A0A7W0NIG7-F1-model_v4 | DUF4242 domain-containing protein | 0.9834 | 1 | 83 |
|
| AF-A0A536GG11-F1-model_v4 | DUF4242 domain-containing protein | 0.9797 | 20 | 84 |
|
| AF-A0A7Y5XTQ4-F1-model_v4 | DUF4242 domain-containing protein | 0.9728 | 1 | 89 |
|
| AF-A0A7C2D9X3-F1-model_v4 | DUF4242 domain-containing protein | 0.9683 | 2 | 85 |
|