F470621

General Info

Members Datasets Scaffolds Average Seq Length
628 422 529 77

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100207073|Ga0070670_1002070732
Length 89
Sequence MIGQGQRAKGEPVMSVIEFDDATRPRIYDRTVLSNCPECGDDLTVVRVIGGRAGCEYWTMRCTGCGGIHLDILKPQRAAGDDEGPPPVA

Samples

Sample ID Description Type Environment
1 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
2 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
3 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
4 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
5 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
6 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
7 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
8 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
9 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
10 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
11 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
12 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
13 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
14 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
15 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
16 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
17 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
18 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
19 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
20 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
21 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
22 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
23 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
24 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
25 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
26 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
27 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
28 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
29 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
30 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
31 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
32 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
33 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
34 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
35 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
36 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
37 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
38 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
39 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
40 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
41 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
42 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
43 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
44 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
45 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
46 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
47 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
48 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
49 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
50 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
51 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
52 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
53 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
54 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
55 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
56 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
57 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
58 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
59 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
60 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
61 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
62 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
63 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
64 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
65 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
66 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
67 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
68 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
69 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
70 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
71 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
72 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
73 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
74 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
75 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
76 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
77 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
78 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
79 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
80 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
81 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
82 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
83 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
84 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
85 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
86 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
87 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
88 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
89 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
90 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
91 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
92 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
93 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
94 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
95 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
96 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
97 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
98 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
99 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
100 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
101 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
102 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
103 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
104 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
105 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
106 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
107 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
108 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
109 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
110 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
111 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
112 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
113 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
114 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
115 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
116 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
117 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
118 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
119 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
120 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
121 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
122 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
123 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
124 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
125 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
126 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
127 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
128 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
129 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
130 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
131 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
132 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
133 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
134 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
135 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
136 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
137 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
138 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
139 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
140 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
141 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
142 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
143 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
144 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
145 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
146 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
147 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
148 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
149 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
150 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
151 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
152 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
153 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
154 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
155 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
156 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
157 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
158 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
162 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
166 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
167 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
168 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
208 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
209 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
210 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
211 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
212 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
215 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
216 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
217 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
218 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
219 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
221 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
222 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
223 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
224 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
225 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
226 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
227 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
228 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
229 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
230 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
231 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
232 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
233 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
234 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
235 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
236 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
237 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
238 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
239 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
240 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
241 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
242 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
243 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
244 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
245 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
246 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
247 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
248 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
249 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
250 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
251 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
252 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
253 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
254 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
255 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
256 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
257 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
258 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
259 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
260 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
261 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
262 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
263 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
264 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
265 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
266 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
267 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
268 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
269 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
270 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
271 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
272 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
273 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
274 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
275 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
276 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
277 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
278 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
279 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
280 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
281 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
282 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
283 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
284 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
285 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
286 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
287 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
288 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
289 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
290 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
291 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
292 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
293 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
294 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
295 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
296 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
297 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
298 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
299 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
300 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
301 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
302 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
303 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
304 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
305 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
306 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
307 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
308 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
309 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
310 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
311 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
312 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
313 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
314 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
315 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
316 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
317 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
318 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
319 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
320 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
321 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
322 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
323 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
324 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
325 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
326 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
327 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
328 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
329 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
330 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
331 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
332 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
333 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
334 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
335 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
336 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
337 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
338 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
339 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
340 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
341 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
342 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
343 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
344 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
345 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
346 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
347 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
348 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
349 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
350 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
351 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
352 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
353 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
354 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
355 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
356 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
357 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
358 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
359 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
360 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
361 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
362 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
363 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
364 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
365 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
366 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
367 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
368 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
369 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
370 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
371 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
372 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
373 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
374 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
375 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
376 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
377 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
378 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
379 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
380 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
381 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
382 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
383 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
384 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
385 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
386 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
387 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
408 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
409 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
410 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
411 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
412 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
413 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
414 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
415 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
416 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
417 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
418 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
419 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
420 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
421 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
422 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80.86
Metatranscriptomes 3.51
Isolates 15.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.22
Nodule 16.08
Rhizoplane 6.85
Rhizosphere 48.89
Stem 0
Stem Tuber 0
Unclassified 7.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10006030 3300003215 Bacteria 6229
2 JGI25153J46596_10018982 3300003215 Bacteria 2648
3 JGI25153J46596_10052360 3300003215 Bacteria 1162
4 JGI25160J50197_1003029 3300003354 Bacteria 7660
5 JGI25160J50197_1064565 3300003354 Bacteria 718
6 Ga0055542_1012857 3300003762 Bacteria 1431
7 Ga0055529_1039578 3300003763 Bacteria 572
8 Ga0055526_1057686 3300003771 Bacteria 844
9 Ga0055531_10021797 3300003794 Bacteria 2470
10 Ga0055543_1008659 3300004625 Bacteria 2238
11 Ga0065165_1002424 3300005262 Bacteria 15862
12 Ga0065165_1009957 3300005262 Bacteria 4183
13 Ga0065165_1023460 3300005262 Bacteria 2092
14 Ga0070670_100207073 3300005331 Bacteria 1705
15 Ga0068869_100720895 3300005334 Bacteria 852
16 Ga0070666_10365929 3300005335 Bacteria 1033
17 Ga0068868_100112626 3300005338 Bacteria 2212
18 Ga0070660_100467994 3300005339 Bacteria 1047
19 Ga0070660_100703890 3300005339 Bacteria 847
20 Ga0070660_100849602 3300005339 Bacteria 769
21 Ga0070687_100667824 3300005343 Bacteria 722
22 Ga0070692_10264245 3300005345 Bacteria 1036
23 Ga0070668_100015332 3300005347 Bacteria 5727
24 Ga0070668_100216243 3300005347 Bacteria 1579
25 Ga0070669_100277883 3300005353 Bacteria 1341
26 Ga0070675_100506108 3300005354 Bacteria 1089
27 Ga0070674_100961833 3300005356 Bacteria 747
28 Ga0070673_100428666 3300005364 Bacteria 1187
29 Ga0070659_100132663 3300005366 Bacteria 2024
30 Ga0070659_100150624 3300005366 Bacteria 1898
31 Ga0070659_100519274 3300005366 Bacteria 1017
32 Ga0070663_100014841 3300005455 Bacteria 5009
33 Ga0070663_100919636 3300005455 Bacteria 757
34 Ga0070678_101782809 3300005456 Bacteria 580
35 Ga0070662_100423962 3300005457 Bacteria 1101
36 Ga0070662_101929831 3300005457 Bacteria 510
37 Ga0068867_100286053 3300005459 Bacteria 1354
38 Ga0070685_11043523 3300005466 Bacteria 615
39 Ga0068853_101112575 3300005539 Bacteria 762
40 Ga0070665_100457894 3300005548 Bacteria 1286
41 Ga0070665_100777323 3300005548 Bacteria 971
42 Ga0070665_101780091 3300005548 Bacteria 623
43 Ga0068855_100329880 3300005563 Bacteria 1685
44 Ga0068855_100588069 3300005563 Bacteria 1202
45 Ga0068855_100878046 3300005563 Bacteria 949
46 Ga0068855_102460756 3300005563 Bacteria 519
47 Ga0068857_101491277 3300005577 Bacteria 659
48 Ga0068856_100315530 3300005614 Bacteria 1581
49 Ga0068856_100396566 3300005614 Bacteria 1400
50 Ga0068856_100589697 3300005614 Bacteria 1133
51 Ga0068856_102213052 3300005614 Bacteria 559
52 Ga0068852_100215571 3300005616 Bacteria 1823
53 Ga0068852_100491755 3300005616 Bacteria 1220
54 Ga0068864_100289248 3300005618 Bacteria 1532
55 Ga0068861_100332851 3300005719 Bacteria 1326
56 Ga0068863_101126510 3300005841 Bacteria 790
57 Ga0068858_100411601 3300005842 Bacteria 1300
58 Ga0068858_101807790 3300005842 Bacteria 604
59 Ga0068860_100179290 3300005843 Bacteria 2048
60 Ga0068860_100929758 3300005843 Bacteria 886
61 Ga0068862_101877961 3300005844 Bacteria 609
62 Ga0075365_10271605 3300006038 Bacteria 1192
63 Ga0075368_10171309 3300006042 Bacteria 912
64 Ga0075363_100092451 3300006048 Bacteria 1666
65 Ga0075364_10050430 3300006051 Bacteria 2716
66 Ga0075364_10913167 3300006051 Bacteria 598
67 Ga0070715_10694842 3300006163 Bacteria 607
68 Ga0075367_10512155 3300006178 Bacteria 761
69 Ga0075367_10819545 3300006178 Bacteria 593
70 Ga0075369_10038554 3300006186 Bacteria 2039
71 Ga0075369_10130781 3300006186 Bacteria 1140
72 Ga0075366_10407851 3300006195 Bacteria 836
73 Ga0075370_10067526 3300006353 Bacteria 2041
74 Ga0075370_10095494 3300006353 Bacteria 1717
75 Ga0099822_1054949 3300006943 Bacteria 1496
76 Ga0099823_1004804 3300006944 Bacteria 13310
77 Ga0099823_1138967 3300006944 Bacteria 560
78 Ga0105240_10018456 3300009093 Bacteria 9366
79 Ga0105240_11060074 3300009093 Bacteria 864
80 Ga0105245_10126664 3300009098 Bacteria 2391
81 Ga0105247_10052525 3300009101 Bacteria 2513
82 Ga0105247_10202978 3300009101 Bacteria 1333
83 Ga0105243_10539995 3300009148 Bacteria 1112
84 Ga0105243_10645868 3300009148 Bacteria 1025
85 Ga0105241_10091961 3300009174 Bacteria 2395
86 Ga0105241_10190745 3300009174 Bacteria 1706
87 Ga0105241_10380463 3300009174 Bacteria 1233
88 Ga0105242_10086081 3300009176 Bacteria 2637
89 Ga0105248_10245311 3300009177 Bacteria 2016
90 Ga0105248_11678652 3300009177 Bacteria 720
91 Ga0105248_12194707 3300009177 Bacteria 628
92 Ga0105237_10136563 3300009545 Bacteria 2446
93 Ga0105237_10227409 3300009545 Bacteria 1866
94 Ga0105237_10407573 3300009545 Bacteria 1364
95 Ga0105237_10539323 3300009545 Bacteria 1173
96 Ga0105249_10301776 3300009553 Bacteria 1606
97 Ga0105239_10146107 3300010375 Bacteria 2637
98 Ga0105239_10162243 3300010375 Bacteria 2498
99 Ga0105239_10239350 3300010375 Bacteria 2037
100 Ga0105239_10348601 3300010375 Bacteria 1671
101 Ga0105239_10436710 3300010375 Bacteria 1484
102 Ga0105239_10557099 3300010375 Bacteria 1306
103 Ga0105246_10300605 3300011119 Bacteria 1295
104 Ga0157370_10507641 3300013104 Bacteria 1107
105 Ga0157369_11171509 3300013105 Bacteria 785
106 Ga0157374_11486668 3300013296 Bacteria 701
107 Ga0157378_10712333 3300013297 Bacteria 1024
108 Ga0157375_10405651 3300013308 Bacteria 1529
109 Ga0163163_10133068 3300014325 Bacteria 2527
110 Ga0163163_10720929 3300014325 Bacteria 1061
111 Ga0182008_10310352 3300014497 Bacteria 827
112 Ga0157377_10375108 3300014745 Bacteria 961
113 Ga0157379_10267196 3300014968 Bacteria 1555
114 Ga0157379_11315654 3300014968 Bacteria 698
115 Ga0157376_10181606 3300014969 Bacteria 1924
116 Ga0157376_10476849 3300014969 Bacteria 1222
117 Ga0157376_11853301 3300014969 Bacteria 640
118 Ga0157376_12610770 3300014969 Bacteria 545
119 Ga0182007_10171592 3300015262 Bacteria 746
120 Ga0206352_10062491 3300020078 Bacteria 587
121 Ga0214542_1000156 3300021321 Bacteria 101631
122 Ga0214545_1000078 3300021324 Bacteria 101631
123 Ga0214545_1014427 3300021324 Bacteria 9197
124 Ga0214543_1000136 3300021327 Bacteria 101629
125 Ga0214543_1037727 3300021327 Bacteria 1423
126 Ga0214543_1040129 3300021327 Bacteria 1262
127 Ga0214543_1041212 3300021327 Bacteria 1201
128 Ga0209563_103076 3300025230 Bacteria 3547
129 Ga0209677_100991 3300025253 Bacteria 13698
130 Ga0209148_1000232 3300025254 Bacteria 90923
131 Ga0209233_1011852 3300025261 Bacteria 2555
132 Ga0209233_1041370 3300025261 Bacteria 996
133 Ga0209455_1001882 3300025272 Bacteria 8741
134 Ga0209673_1027108 3300025273 Bacteria 1868
135 Ga0209564_1002450 3300025295 Bacteria 14636
136 Ga0209564_1017503 3300025295 Bacteria 2788
137 Ga0209758_1000705 3300025297 Bacteria 49585
138 Ga0209758_1000767 3300025297 Bacteria 46198
139 Ga0209758_1001616 3300025297 Bacteria 25709
140 Ga0209758_1008725 3300025297 Bacteria 6480
141 Ga0209758_1080863 3300025297 Bacteria 983
142 Ga0209256_1001558 3300025299 Bacteria 22669
143 Ga0209256_1019224 3300025299 Bacteria 2185
144 Ga0207426_1000857 3300025302 Bacteria 31897
145 Ga0207426_1010981 3300025302 Bacteria 3480
146 Ga0207426_1023543 3300025302 Bacteria 2100
147 Ga0207426_1090502 3300025302 Bacteria 811
148 Ga0209051_1061776 3300025303 Bacteria 1175
149 Ga0209257_1001185 3300025304 Bacteria 32850
150 Ga0209257_1083795 3300025304 Bacteria 811
151 Ga0207697_10185706 3300025315 Bacteria 912
152 Ga0207710_10054902 3300025900 Bacteria 1795
153 Ga0207647_10058350 3300025904 Bacteria 2364
154 Ga0207654_10318178 3300025911 Bacteria 1063
155 Ga0207695_10000123 3300025913 Bacteria 232059
156 Ga0207671_10003497 3300025914 Bacteria 15609
157 Ga0207671_10311429 3300025914 Bacteria 1245
158 Ga0207693_10280504 3300025915 Bacteria 1306
159 Ga0207657_10392998 3300025919 Bacteria 1091
160 Ga0207657_10610136 3300025919 Bacteria 851
161 Ga0207657_10947014 3300025919 Bacteria 662
162 Ga0207649_10359417 3300025920 Bacteria 1080
163 Ga0207694_10572186 3300025924 Bacteria 949
164 Ga0207650_10281801 3300025925 Bacteria 1353
165 Ga0207659_10512437 3300025926 Bacteria 1016
166 Ga0207687_10439877 3300025927 Bacteria 1080
167 Ga0207644_10083068 3300025931 Bacteria 2371
168 Ga0207644_10172008 3300025931 Bacteria 1692
169 Ga0207690_10067398 3300025932 Bacteria 2455
170 Ga0207706_10200570 3300025933 Bacteria 1750
171 Ga0207706_10501044 3300025933 Bacteria 1048
172 Ga0207706_11396665 3300025933 Bacteria 575
173 Ga0207686_10537352 3300025934 Bacteria 912
174 Ga0207709_10544111 3300025935 Bacteria 912
175 Ga0207709_10578349 3300025935 Bacteria 887
176 Ga0207711_10280878 3300025941 Bacteria 1533
177 Ga0207711_11879115 3300025941 Bacteria 542
178 Ga0207689_10776870 3300025942 Bacteria 808
179 Ga0207667_10156445 3300025949 Bacteria 2345
180 Ga0207667_10275164 3300025949 Bacteria 1721
181 Ga0207667_10998194 3300025949 Bacteria 824
182 Ga0207651_10526728 3300025960 Bacteria 1025
183 Ga0207712_10282869 3300025961 Bacteria 1354
184 Ga0207668_10012227 3300025972 Bacteria 5248
185 Ga0207668_10371566 3300025972 Bacteria 1201
186 Ga0207640_10430808 3300025981 Bacteria 1082
187 Ga0207640_10602072 3300025981 Bacteria 930
188 Ga0207658_10554848 3300025986 Bacteria 1028
189 Ga0207658_10634475 3300025986 Bacteria 962
190 Ga0207677_11069810 3300026023 Bacteria 734
191 Ga0207639_10629666 3300026041 Bacteria 991
192 Ga0207639_10956333 3300026041 Bacteria 802
193 Ga0207678_10030523 3300026067 Bacteria 4705
194 Ga0207678_10104496 3300026067 Bacteria 2417
195 Ga0207702_11079761 3300026078 Bacteria 796
196 Ga0207702_11339239 3300026078 Bacteria 710
197 Ga0207702_12362902 3300026078 Bacteria 519
198 Ga0207641_10282074 3300026088 Bacteria 1563
199 Ga0207648_10108970 3300026089 Bacteria 2431
200 Ga0207676_10889509 3300026095 Bacteria 873
201 Ga0207674_10067482 3300026116 Bacteria 3601
202 Ga0207674_11870415 3300026116 Bacteria 567
203 Ga0207675_100200838 3300026118 Bacteria 1915
204 Ga0207683_11416773 3300026121 Bacteria 642
205 Ga0207698_10869897 3300026142 Bacteria 907
206 Ga0209389_1000019 3300027296 Bacteria 172067
207 Ga0209389_1000070 3300027296 Bacteria 97498
208 Ga0209589_1000420 3300027357 Bacteria 58471
209 Ga0209489_100033 3300027361 Bacteria 172166
210 Ga0209489_100196 3300027361 Bacteria 97498
211 Ga0209700_100012 3300027363 Bacteria 357892
212 Ga0209813_10201060 3300027866 Bacteria 737
213 Ga0268266_10024242 3300028379 Bacteria 5163
214 Ga0268266_10387501 3300028379 Bacteria 1319
215 Ga0268266_10634165 3300028379 Bacteria 1028
216 Ga0268266_10772365 3300028379 Bacteria 928
217 Ga0268264_10616814 3300028381 Bacteria 1070
218 Ga0268264_11015220 3300028381 Bacteria 836
219 Ga0307517_10265645 3300028786 Bacteria 992
220 Ga0307517_10507948 3300028786 Bacteria 612
221 Ga0307514_10384114 3300031649 Bacteria 727
222 Ga0307518_10495474 3300031838 Bacteria 632
223 Ga0307510_10041777 3300033180 Bacteria 5007
224 Ga0373955_0315359 3300035172 Bacteria 944
225 Ga0373925_1332378 3300037068 Bacteria 589
226 Ga0395900_1342861 3300037418 Bacteria 628
227 Ga0395900_1343237 3300037418 Bacteria 628
228 Ga0395898_0441828 3300037466 Bacteria 1239
229 Ga0395898_1533097 3300037466 Bacteria 592
230 Ga0395905_0018783 3300037471 Bacteria 6557
231 Ga0395905_0241355 3300037471 Bacteria 1688
232 Ga0395901_0390143 3300038443 Bacteria 1432
233 Ga0395901_0561011 3300038443 Bacteria 1156
234 Ga0436365_0155674 3300039437 Bacteria 1517
235 Ga0451791_1228850 3300041451 Bacteria 796
236 Ga0451793_0789318 3300041452 Bacteria 688
237 Ga0451795_1357315 3300041456 Bacteria 697
238 Ga0451855_0383189 3300041511 Bacteria 634
239 Ga0466969_0054869 3300044656 Bacteria 1951
240 Ga0466969_0445598 3300044656 Bacteria 589
241 Ga0466972_0000164 3300044658 Bacteria 53019
242 Ga0466965_0398158 3300044683 Bacteria 760
243 Ga0466966_0014160 3300044684 Bacteria 5279
244 Ga0466961_0000192 3300044693 Bacteria 40922
245 Ga0466961_0282067 3300044693 Bacteria 1016
246 Ga0466964_0045199 3300044706 Bacteria 1792
247 Ga0466964_0201760 3300044706 Bacteria 955
248 Ga0466968_0140997 3300044735 Bacteria 1102
249 Ga0466968_0159236 3300044735 Bacteria 1041
250 Ga0466970_0535379 3300044765 Bacteria 676
251 Ga0466957_0406393 3300044842 Bacteria 932
252 Ga0466957_0883604 3300044842 Bacteria 638
253 Ga0466960_0158421 3300044901 Bacteria 1214
254 Ga0466960_0647438 3300044901 Bacteria 630
255 Ga0466959_0001746 3300045049 Bacteria 13533
256 Ga0466959_0917015 3300045049 Bacteria 584
257 Ga0495592_0119356 3300046454 Bacteria 1857
258 Ga0495603_0126422 3300046455 Bacteria 1490
259 Ga0495629_0001707 3300046459 Bacteria 17243
260 Ga0495629_0142373 3300046459 Bacteria 1668
261 Ga0495638_0002914 3300046460 Bacteria 13661
262 Ga0495651_0206029 3300046462 Bacteria 1372
263 Ga0495651_0603158 3300046462 Bacteria 692
264 Ga0495650_0289871 3300046471 Bacteria 550
265 Ga0495664_0032082 3300046477 Bacteria 3081
266 Ga0495584_0325117 3300046491 Bacteria 781
267 Ga0495584_0600489 3300046491 Bacteria 561
268 Ga0495594_0373774 3300046499 Bacteria 811
269 Ga0495596_0126695 3300046500 Bacteria 991
270 Ga0495607_0152613 3300046501 Bacteria 1181
271 Ga0495583_0058651 3300046506 Bacteria 1727
272 Ga0495608_0048816 3300046511 Bacteria 2811
273 Ga0495608_0077661 3300046511 Bacteria 2161
274 Ga0495610_0090607 3300046512 Bacteria 1387
275 Ga0495610_0117849 3300046512 Bacteria 1168
276 Ga0495616_0051067 3300046513 Bacteria 2064
277 Ga0495618_0527056 3300046514 Bacteria 710
278 Ga0495620_0394609 3300046515 Bacteria 524
279 Ga0495628_0241630 3300046516 Bacteria 1351
280 Ga0495628_0323782 3300046516 Bacteria 1137
281 Ga0495631_0046126 3300046518 Bacteria 1917
282 Ga0495632_0104426 3300046519 Bacteria 1334
283 Ga0495643_0062869 3300046522 Bacteria 1964
284 Ga0495643_0287615 3300046522 Bacteria 754
285 Ga0495648_0069673 3300046524 Bacteria 2046
286 Ga0495648_0082457 3300046524 Bacteria 1825
287 Ga0495648_0095469 3300046524 Bacteria 1654
288 Ga0495648_0172513 3300046524 Bacteria 1107
289 Ga0495648_0406231 3300046524 Bacteria 607
290 Ga0495652_0010890 3300046529 Bacteria 8239
291 Ga0495652_0112153 3300046529 Bacteria 2191
292 Ga0495640_0055223 3300046533 Bacteria 2717
293 Ga0495587_0014879 3300046536 Bacteria 4868
294 Ga0495587_0227592 3300046536 Bacteria 1051
295 Ga0495609_0123178 3300046538 Bacteria 1114
296 Ga0495645_0027684 3300046543 Bacteria 4118
297 Ga0495622_0019727 3300046557 Bacteria 3139
298 Ga0495622_0122756 3300046557 Bacteria 1185
299 Ga0495622_0164094 3300046557 Bacteria 1001
300 Ga0495667_0346667 3300046559 Bacteria 938
301 Ga0495656_0180364 3300046615 Bacteria 1038
302 Ga0495668_0047332 3300046616 Bacteria 2388
303 Ga0495668_0491180 3300046616 Bacteria 676
304 Ga0495668_0618151 3300046616 Bacteria 599
305 Ga0495634_0025688 3300046642 Bacteria 4115
306 Ga0495634_0194523 3300046642 Bacteria 1263
307 Ga0495611_0147139 3300046648 Bacteria 1100
308 Ga0495611_0527773 3300046648 Bacteria 535
309 Ga0495625_0089623 3300046660 Bacteria 2129
310 Ga0495625_0186644 3300046660 Bacteria 1376
311 Ga0495625_0384117 3300046660 Bacteria 880
312 Ga0495625_0817288 3300046660 Bacteria 541
313 Ga0495635_0010392 3300046663 Bacteria 6510
314 Ga0495635_0022586 3300046663 Bacteria 4384
315 Ga0495635_0565216 3300046663 Bacteria 745
316 Ga0495588_0152274 3300046674 Bacteria 1222
317 Ga0495657_0032748 3300046675 Bacteria 3625
318 Ga0495657_0044954 3300046675 Bacteria 2999
319 Ga0495599_0838272 3300046678 Bacteria 524
320 Ga0495623_0009655 3300046679 Bacteria 6265
321 Ga0495646_0014215 3300046680 Bacteria 5062
322 Ga0495646_0170562 3300046680 Bacteria 1199
323 Ga0495646_0265369 3300046680 Bacteria 916
324 Ga0495669_0258742 3300046684 Bacteria 836
325 Ga0495613_0060249 3300046689 Bacteria 2781
326 Ga0495613_0674977 3300046689 Bacteria 682
327 Ga0495624_0252542 3300046690 Bacteria 1066
328 Ga0495624_0943187 3300046690 Bacteria 507
329 Ga0495649_0023774 3300046694 Bacteria 3422
330 Ga0495649_0150434 3300046694 Bacteria 1223
331 Ga0495649_0162324 3300046694 Bacteria 1171
332 Ga0495649_0490582 3300046694 Bacteria 611
333 Ga0495600_0005782 3300046809 Bacteria 7472
334 Ga0495600_0116881 3300046809 Bacteria 1736
335 Ga0495660_0277363 3300046810 Bacteria 768
336 Ga0495581_0032716 3300047315 Bacteria 3011
337 Ga0495581_0174821 3300047315 Bacteria 1256
338 Ga0495604_0005334 3300047317 Bacteria 10192
339 Ga0495604_0075794 3300047317 Bacteria 2531
340 Ga0495674_0368598 3300047319 Bacteria 1163
341 Ga0495676_0099913 3300047321 Bacteria 2149
342 Ga0495680_0005028 3300047322 Bacteria 12500
343 Ga0495683_0144977 3300047323 Bacteria 1110
344 Ga0495683_0272745 3300047323 Bacteria 735
345 Ga0495683_0312483 3300047323 Bacteria 672
346 Ga0495687_103364 3300047443 Bacteria 1063
347 Ga0495675_0059833 3300047444 Bacteria 2415
348 Ga0495677_0152295 3300047445 Bacteria 891
349 Ga0495679_090769 3300047446 Bacteria 857
350 Ga0495673_0047286 3300047469 Bacteria 1902
351 Ga0495673_0095356 3300047469 Bacteria 1210
352 Ga0495673_0144217 3300047469 Bacteria 926
353 Ga0495686_0070363 3300047472 Bacteria 2156
354 Ga0495686_0127153 3300047472 Bacteria 1514
355 Ga0495686_0657987 3300047472 Bacteria 538
356 Ga0495602_0034441 3300048088 Bacteria 4737
357 Ga0495602_0072394 3300048088 Bacteria 2939
358 Ga0495614_0202802 3300048089 Bacteria 898
359 Ga0496100_0353934 3300048903 Bacteria 1109
360 Ga0496100_0941517 3300048903 Bacteria 679
361 Ga0496100_1555729 3300048903 Bacteria 522
362 Ga0496101_0488726 3300048904 Bacteria 972
363 Ga0496101_0583051 3300048904 Bacteria 884
364 Ga0496102_0187141 3300048905 Bacteria 1951
365 Ga0496102_0605818 3300048905 Bacteria 1018
366 Ga0496102_1133081 3300048905 Bacteria 702
367 Ga0496102_1407633 3300048905 Bacteria 616
368 Ga0496103_0107292 3300048906 Bacteria 1771
369 Ga0496103_0205310 3300048906 Bacteria 1267
370 Ga0496104_0003677 3300048907 Bacteria 13247
371 Ga0496104_0030189 3300048907 Bacteria 5035
372 Ga0496104_0306551 3300048907 Bacteria 1500
373 Ga0496104_0395247 3300048907 Bacteria 1295
374 Ga0496105_0002470 3300048908 Bacteria 13380
375 Ga0496105_0019150 3300048908 Bacteria 5518
376 Ga0496105_0187699 3300048908 Bacteria 1691
377 Ga0496106_0022614 3300048909 Bacteria 4673
378 Ga0496107_0166917 3300048910 Bacteria 1632
379 Ga0496107_0228698 3300048910 Bacteria 1384
380 Ga0496108_0187449 3300048911 Bacteria 1792
381 Ga0496108_1056783 3300048911 Bacteria 691
382 Ga0496109_0762904 3300048912 Bacteria 905
383 Ga0496110_0130025 3300048913 Bacteria 2273
384 Ga0496110_0250526 3300048913 Bacteria 1612
385 Ga0496110_0906588 3300048913 Bacteria 788
386 Ga0496111_0057391 3300048914 Bacteria 2819
387 Ga0496111_0345875 3300048914 Bacteria 1101
388 Ga0496112_0213724 3300048915 Bacteria 1885
389 Ga0496112_0831973 3300048915 Bacteria 847
390 Ga0496112_1323830 3300048915 Bacteria 636
391 Ga0496112_1585927 3300048915 Bacteria 568
392 Ga0496113_0011865 3300048916 Bacteria 5839
393 Ga0496113_0243138 3300048916 Bacteria 1436
394 Ga0496113_0559148 3300048916 Bacteria 917
395 Ga0496114_0083788 3300048917 Bacteria 2698
396 Ga0496115_0166200 3300048918 Bacteria 1824
397 Ga0496115_0243406 3300048918 Bacteria 1482
398 Ga0496115_0514257 3300048918 Bacteria 961
399 Ga0496116_0022320 3300048919 Bacteria 4746
400 Ga0496117_0231363 3300048920 Bacteria 1021
401 Ga0496117_0252770 3300048920 Bacteria 960
402 Ga0496117_0321731 3300048920 Bacteria 810
403 Ga0496118_0043083 3300048921 Bacteria 3553
404 Ga0496118_0099141 3300048921 Bacteria 1976
405 Ga0496118_0110487 3300048921 Bacteria 1826
406 Ga0496118_0132729 3300048921 Bacteria 1595
407 Ga0496119_0068166 3300048922 Bacteria 2095
408 Ga0496119_0225577 3300048922 Bacteria 956
409 Ga0496119_0250808 3300048922 Bacteria 892
410 Ga0496120_0044017 3300048923 Bacteria 2596
411 Ga0496120_0061207 3300048923 Bacteria 2102
412 Ga0496121_0016155 3300048924 Bacteria 7731
413 Ga0496121_0119729 3300048924 Bacteria 1990
414 Ga0496121_0184663 3300048924 Bacteria 1501
415 Ga0496122_0157772 3300048925 Bacteria 1389
416 Ga0496122_0323860 3300048925 Bacteria 818
417 Ga0496123_0130413 3300048926 Bacteria 1394
418 Ga0496124_0126828 3300048927 Bacteria 2032
419 Ga0496124_0335407 3300048927 Bacteria 1076
420 Ga0496124_0944911 3300048927 Bacteria 519
421 Ga0496125_0039775 3300048928 Bacteria 4043
422 Ga0496125_0072747 3300048928 Bacteria 2677
423 Ga0496125_0363644 3300048928 Bacteria 859
424 Ga0496126_0014768 3300048929 Bacteria 7878
425 Ga0496126_0097252 3300048929 Bacteria 2580
426 Ga0496126_0389602 3300048929 Bacteria 1132
427 Ga0496126_0616610 3300048929 Bacteria 853
428 Ga0496126_0696238 3300048929 Bacteria 790
429 Ga0495682_0309956 3300049460 Bacteria 557
430 nmdc:mga03n38_291688_c1 3300050490 Bacteria 874
431 nmdc:mga00v17_124473_c1 3300050491 Bacteria 1644
432 nmdc:mga0k408_104431_c1 3300050493 Bacteria 1672
433 nmdc:mga06z11_140137_c1 3300050494 Bacteria 1366
434 nmdc:mga04h51_392865_c1 3300050495 Bacteria 580
435 nmdc:mga07m45_33230_c1 3300050496 Bacteria 2864
436 nmdc:mga0sz30_36479_c1 3300050516 Bacteria 2055
437 nmdc:mga0sz30_41348_c1 3300050516 Bacteria 1938
438 nmdc:mga0sz30_501879_c1 3300050516 Bacteria 546
439 nmdc:mga0sz30_61091_c1 3300050516 Bacteria 1610
440 Ga0500610_0267602 3300053079 Bacteria 776
441 Ga0500635_0056317 3300053080 Bacteria 1360
442 Ga0495619_0089308 3300053085 Bacteria 2085
443 Ga0500578_0439047 3300053086 Bacteria 745
444 Ga0500644_0076519 3300053088 Bacteria 1220
445 Ga0500644_0255536 3300053088 Bacteria 740
446 Ga0500581_303976 3300053089 Bacteria 633
447 Ga0500583_0152953 3300053092 Bacteria 1148
448 Ga0500651_0100618 3300053093 Bacteria 1772
449 Ga0500651_0176557 3300053093 Bacteria 1270
450 Ga0500651_0776676 3300053093 Bacteria 507
451 Ga0500566_0001157 3300053094 Bacteria 15353
452 Ga0500566_0475490 3300053094 Bacteria 542
453 Ga0500640_046441 3300053095 Bacteria 1903
454 Ga0500641_0044627 3300053096 Bacteria 1803
455 Ga0500650_0077286 3300053098 Bacteria 1556
456 Ga0500554_137853 3300053102 Bacteria 825
457 Ga0500555_006517 3300053103 Bacteria 3318
458 Ga0500556_0170963 3300053104 Bacteria 858
459 Ga0500557_000077 3300053105 Bacteria 36950
460 Ga0500562_008443 3300053108 Bacteria 2602
461 Ga0500569_004124 3300053109 Bacteria 3032
462 Ga0500569_026426 3300053109 Bacteria 1591
463 Ga0500569_068209 3300053109 Bacteria 1114
464 Ga0500572_014786 3300053111 Bacteria 1956
465 Ga0500592_002785 3300053116 Bacteria 2815
466 Ga0500594_0020657 3300053118 Bacteria 1645
467 Ga0500595_015814 3300053119 Bacteria 2824
468 Ga0500607_004790 3300053121 Bacteria 9129
469 Ga0500608_030363 3300053122 Bacteria 2561
470 Ga0500614_076344 3300053123 Bacteria 929
471 Ga0500618_069291 3300053125 Bacteria 792
472 Ga0500621_126379 3300053126 Bacteria 985
473 Ga0500621_281479 3300053126 Bacteria 542
474 Ga0500642_0000155 3300053130 Bacteria 28326
475 Ga0500642_0135231 3300053130 Bacteria 1155
476 Ga0500642_0242264 3300053130 Bacteria 830
477 Ga0500655_052853 3300053133 Bacteria 811
478 Ga0500559_0565957 3300053136 Bacteria 517
479 Ga0500564_066019 3300053138 Bacteria 1636
480 Ga0500568_0044530 3300053139 Bacteria 1769
481 Ga0500577_0019365 3300053142 Bacteria 2206
482 Ga0500577_0521209 3300053142 Bacteria 519
483 Ga0500590_086798 3300053148 Bacteria 1525
484 Ga0500590_156074 3300053148 Bacteria 1023
485 Ga0500604_0069147 3300053151 Bacteria 1123
486 Ga0500616_0063545 3300053153 Bacteria 1903
487 Ga0500619_029933 3300053154 Bacteria 1650
488 Ga0500620_010398 3300053155 Bacteria 2447
489 Ga0500622_0118755 3300053156 Bacteria 1284
490 Ga0500624_039880 3300053157 Bacteria 840
491 Ga0500638_100272 3300053162 Bacteria 1351
492 Ga0500639_213906 3300053163 Bacteria 813
493 Ga0500639_241396 3300053163 Bacteria 733
494 Ga0500636_0001310 3300053177 Bacteria 13513
495 Ga0500636_0134832 3300053177 Bacteria 1372
496 Ga0500636_0237708 3300053177 Bacteria 938
497 Ga0500636_0346578 3300053177 Bacteria 711
498 Ga0500636_0453516 3300053177 Bacteria 579
499 Ga0500567_219284 3300053723 Bacteria 607
500 Ga0500611_150551 3300053727 Bacteria 639
501 Ga0500625_007389 3300053729 Bacteria 4775
502 Ga0500645_047532 3300053730 Bacteria 1257
503 Ga0500552_075557 3300053733 Bacteria 611
504 Ga0500596_016223 3300053735 Bacteria 1120
505 Ga0500599_001988 3300053736 Bacteria 2415
506 Ga0500601_000314 3300053737 Bacteria 9035
507 Ga0500601_015180 3300053737 Bacteria 875
508 Ga0500661_014216 3300055283 Bacteria 1432
509 Ga0587093_052242 3300059478 Bacteria 648
510 Ga0587066_097843 3300059490 Bacteria 662
511 Ga0587070_115134 3300059491 Bacteria 636
512 Ga0587073_0145057 3300059492 Bacteria 666
513 Ga0587080_045827 3300059503 Bacteria 811
514 Ga0587082_064362 3300059504 Bacteria 730
515 Ga0587082_168595 3300059504 Bacteria 529
516 Ga0587083_0225278 3300059505 Bacteria 547
517 Ga0587086_044381 3300059507 Bacteria 698
518 Ga0587090_054994 3300059510 Bacteria 740
519 Ga0587091_108242 3300059511 Bacteria 660
520 Ga0587092_083691 3300059512 Bacteria 634
521 Ga0587101_043075 3300059623 Bacteria 752
522 Ga0587115_051878 3300059626 Bacteria 668
523 Ga0587117_050154 3300059627 Bacteria 690
524 Ga0587068_088866 3300059641 Bacteria 634
525 Ga0587075_104449 3300059644 Bacteria 569
526 Ga0587076_070915 3300059645 Bacteria 723
527 Ga0587078_038655 3300059646 Bacteria 668
528 Ga0587071_162926 3300060344 Bacteria 562
529 Ga0587111_0258873 3300060346 Bacteria 518

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2511231028 2511395777 72
2 iso_pu_bacteria 2513237094 2513643285 72
3 iso_pu_bacteria 2513237095 2513651075 72
4 iso_pu_bacteria 2515154112 2515624690 72
5 iso_pu_bacteria 2517093001 2517104372 72
6 iso_pu_bacteria 2524023205 2524438340 72
7 iso_pu_bacteria 2528768022 2528854658 72
8 iso_pu_bacteria 2617270735 2617349650 72
9 iso_pu_bacteria 2744054633 2745078512 72
10 iso_pu_bacteria 2791355196 2793059611 72
11 iso_pu_bacteria 2816332527 2818242209 72
12 iso_pu_bacteria 2824661429 2824669952 72
13 iso_pu_bacteria 2824773399 2824776969 72
14 iso_pu_bacteria 2841957949 2841960938 72
15 iso_pu_bacteria 2844315083 2844321113 72
16 iso_pu_bacteria 2874590934 2874592278 72
17 iso_pu_bacteria 2874628541 2874630958 72
18 iso_pu_bacteria 2874645413 2874647394 72
19 iso_pu_bacteria 2876761206 2876767440 72
20 iso_pu_bacteria 2876771140 2876774805 72
21 iso_pu_bacteria 2876818435 2876819758 72
22 iso_pu_bacteria 2879074833 2879079373 72
23 iso_pu_bacteria 2879099564 2879101377 72
24 iso_pu_bacteria 2879127579 2879129106 72
25 iso_pu_bacteria 2879142872 2879144739 72
26 iso_pu_bacteria 2885366525 2885374041 72
27 iso_pu_bacteria 2888378607 2888387407 72
28 iso_pu_bacteria 2888388044 2888391792 72
29 iso_pu_bacteria 2903727486 2903728536 72
30 iso_pu_bacteria 2906602504 2906607728 72
31 iso_pu_bacteria 2906626472 2906627096 72
32 iso_pu_bacteria 2922368715 2922370536 72
33 iso_pu_bacteria 2929615660 2929620113 72
34 iso_pu_bacteria 2929624759 2929629426 72
35 iso_pu_bacteria 2932784394 2932791468 72
36 iso_pu_bacteria 2932794094 2932796868 72
37 iso_pu_bacteria 2932801729 2932802351 72
38 iso_pu_bacteria 2932809354 2932816724 72
39 iso_pu_bacteria 2932818245 2932824094 72
40 iso_pu_bacteria 2932828146 2932835370 72
41 iso_pu_bacteria 2933577622 2933582030 72
42 iso_pu_bacteria 2935608549 2935613457 72
43 iso_pu_bacteria 2935616580 2935621113 72
44 iso_pu_bacteria 2935638405 2935643580 72
45 iso_pu_bacteria 2935665750 2935671110 72
46 iso_pu_bacteria 2935675223 2935681284 72
47 iso_pu_bacteria 2935684952 2935689373 72
48 iso_pu_bacteria 2935694250 2935699948 72
49 iso_pu_bacteria 2935703347 2935712121 72
50 iso_pu_bacteria 2935713505 2935720319 72
51 iso_pu_bacteria 2935722832 2935728064 72
52 iso_pu_bacteria 2935732158 2935737339 72
53 iso_pu_bacteria 2935741537 2935746600 72
54 iso_pu_bacteria 2935750917 2935757567 72
55 iso_pu_bacteria 2935760218 2935763944 72
56 iso_pu_bacteria 2935801545 2935807921 72
57 iso_pu_bacteria 2935810662 2935818745 72
58 iso_pu_bacteria 2935819856 2935824690 72
59 iso_pu_bacteria 2935827899 2935833097 72
60 iso_pu_bacteria 2935837841 2935844247 72
61 iso_pu_bacteria 2935847175 2935851910 72
62 iso_pu_bacteria 2935855204 2935859694 72
63 iso_pu_bacteria 2935864058 2935872092 72
64 iso_pu_bacteria 2935873716 2935878984 72
65 iso_pu_bacteria 2935883170 2935887210 72
66 iso_pu_bacteria 2935908558 2935911257 72
67 iso_pu_bacteria 2935916978 2935920789 72
68 iso_pu_bacteria 2935926038 2935928286 72
69 iso_pu_bacteria 2935934488 2935937931 72
70 iso_pu_bacteria 2935942939 2935945213 72
71 iso_pu_bacteria 2935951376 2935954281 72
72 iso_pu_bacteria 2935959822 2935965641 72
73 iso_pu_bacteria 2935967501 2935971451 72
74 iso_pu_bacteria 2935975950 2935982071 72
75 iso_pu_bacteria 2935992306 2936000331 72
76 iso_pu_bacteria 2936002035 2936008489 72
77 iso_pu_bacteria 2936037263 2936045555 72
78 iso_pu_bacteria 2940556831 2940563611 72
79 iso_pu_bacteria 2941531003 2941537290 72
80 iso_pu_bacteria 2941538514 2941542579 72
81 iso_pu_bacteria 3005506211 3005506886 72
82 iso_pu_bacteria 3005594810 3005601456 72
83 iso_pu_bacteria 3005718088 3005724145 72
84 iso_pu_bacteria 8016511872 8016519464 72
85 iso_pu_bacteria 8016583857 8016588664 72
86 iso_pu_bacteria 8017057580 8017066056 72
87 iso_pu_bacteria 8019576017 8019578578 72
88 iso_pu_bacteria 8019586578 8019596628 72
89 iso_pu_bacteria 8019597564 8019605076 72
90 iso_pu_bacteria 8019608314 8019613458 72
91 iso_pu_bacteria 8019619141 8019624129 72
92 iso_pu_bacteria 8019629233 8019637899 72
93 iso_pu_bacteria 8019638758 8019641726 72
94 iso_pu_bacteria 8019648815 8019653647 72
95 iso_pu_bacteria 8019659431 8019665828 72
96 iso_pu_bacteria 8019678201 8019680753 72
97 iso_pu_bacteria 8019687851 8019695016 72
98 iso_pu_bacteria 8055742211 8055750134 72
99 iso_pu_bacteria 8056967851 8056975912 72
100 3300039437 Ga0436365_0155674 Ga0436365_0155674_185_406 73
101 3300006944 Ga0099823_1004804 Ga0099823_10048047 74
102 3300027296 Ga0209389_1000019 Ga0209389_100001986 74
103 3300027361 Ga0209489_100033 Ga0209489_10003385 74
104 3300027363 Ga0209700_100012 Ga0209700_100012283 74
105 3300003354 JGI25160J50197_1064565 JGI25160J50197_10645652 75
106 3300005262 Ga0065165_1009957 Ga0065165_10099573 75
107 3300005844 Ga0068862_101877961 Ga0068862_1018779611 75
108 3300006178 Ga0075367_10819545 Ga0075367_108195451 75
109 3300006943 Ga0099822_1054949 Ga0099822_10549492 75
110 3300006944 Ga0099823_1138967 Ga0099823_11389672 75
111 3300021321 Ga0214542_1000156 Ga0214542_100015612 75
112 3300021324 Ga0214545_1000078 Ga0214545_100007898 75
113 3300021324 Ga0214545_1014427 Ga0214545_101442712 75
114 3300021327 Ga0214543_1000136 Ga0214543_100013698 75
115 3300021327 Ga0214543_1037727 Ga0214543_10377272 75
116 3300021327 Ga0214543_1040129 Ga0214543_10401292 75
117 3300021327 Ga0214543_1041212 Ga0214543_10412122 75
118 3300025302 Ga0207426_1010981 Ga0207426_10109813 75
119 3300026116 Ga0207674_11870415 Ga0207674_118704151 75
120 3300027296 Ga0209389_1000070 Ga0209389_1000070106 75
121 3300027357 Ga0209589_1000420 Ga0209589_100042062 75
122 3300027361 Ga0209489_100196 Ga0209489_1001966 75
123 3300037418 Ga0395900_1342861 Ga0395900_1342861_67_294 75
124 3300037466 Ga0395898_1533097 Ga0395898_1533097_10_237 75
125 3300038443 Ga0395901_0561011 Ga0395901_0561011_101_328 75
126 3300046512 Ga0495610_0117849 Ga0495610_0117849_660_887 75
127 3300046524 Ga0495648_0406231 Ga0495648_0406231_285_512 75
128 3300047469 Ga0495673_0144217 Ga0495673_0144217_332_559 75
129 3300048915 Ga0496112_1585927 Ga0496112_1585927_142_369 75
130 3300053105 Ga0500557_000077 Ga0500557_000077_16574_16801 75
131 3300053109 Ga0500569_026426 Ga0500569_026426_294_521 75
132 3300053130 Ga0500642_0000155 Ga0500642_0000155_11768_11995 75
133 3300053177 Ga0500636_0134832 Ga0500636_0134832_507_734 75
134 3300053729 Ga0500625_007389 Ga0500625_007389_2814_3041 75
135 3300053737 Ga0500601_015180 Ga0500601_015180_228_455 75
136 3300059512 Ga0587092_083691 Ga0587092_083691_126_353 75
137 3300003215 JGI25153J46596_10006030 JGI25153J46596_100060308 76
138 3300003215 JGI25153J46596_10018982 JGI25153J46596_100189822 76
139 3300003215 JGI25153J46596_10052360 JGI25153J46596_100523603 76
140 3300003354 JGI25160J50197_1003029 JGI25160J50197_10030293 76
141 3300003762 Ga0055542_1012857 Ga0055542_10128572 76
142 3300003763 Ga0055529_1039578 Ga0055529_10395781 76
143 3300003771 Ga0055526_1057686 Ga0055526_10576863 76
144 3300003794 Ga0055531_10021797 Ga0055531_100217972 76
145 3300004625 Ga0055543_1008659 Ga0055543_10086593 76
146 3300005262 Ga0065165_1002424 Ga0065165_10024242 76
147 3300005262 Ga0065165_1023460 Ga0065165_10234603 76
148 3300005331 Ga0070670_100207073 Ga0070670_1002070732 76
149 3300005334 Ga0068869_100720895 Ga0068869_1007208952 76
150 3300005335 Ga0070666_10365929 Ga0070666_103659292 76
151 3300005338 Ga0068868_100112626 Ga0068868_1001126263 76
152 3300005339 Ga0070660_100467994 Ga0070660_1004679942 76
153 3300005339 Ga0070660_100703890 Ga0070660_1007038901 76
154 3300005339 Ga0070660_100849602 Ga0070660_1008496022 76
155 3300005343 Ga0070687_100667824 Ga0070687_1006678242 76
156 3300005345 Ga0070692_10264245 Ga0070692_102642451 76
157 3300005347 Ga0070668_100015332 Ga0070668_1000153324 76
158 3300005347 Ga0070668_100216243 Ga0070668_1002162432 76
159 3300005353 Ga0070669_100277883 Ga0070669_1002778832 76
160 3300005354 Ga0070675_100506108 Ga0070675_1005061082 76
161 3300005356 Ga0070674_100961833 Ga0070674_1009618331 76
162 3300005364 Ga0070673_100428666 Ga0070673_1004286662 76
163 3300005366 Ga0070659_100132663 Ga0070659_1001326632 76
164 3300005366 Ga0070659_100150624 Ga0070659_1001506243 76
165 3300005366 Ga0070659_100519274 Ga0070659_1005192742 76
166 3300005455 Ga0070663_100014841 Ga0070663_1000148414 76
167 3300005455 Ga0070663_100919636 Ga0070663_1009196362 76
168 3300005456 Ga0070678_101782809 Ga0070678_1017828091 76
169 3300005457 Ga0070662_100423962 Ga0070662_1004239622 76
170 3300005457 Ga0070662_101929831 Ga0070662_1019298311 76
171 3300005459 Ga0068867_100286053 Ga0068867_1002860531 76
172 3300005466 Ga0070685_11043523 Ga0070685_110435231 76
173 3300005539 Ga0068853_101112575 Ga0068853_1011125751 76
174 3300005548 Ga0070665_100457894 Ga0070665_1004578942 76
175 3300005548 Ga0070665_100777323 Ga0070665_1007773232 76
176 3300005548 Ga0070665_101780091 Ga0070665_1017800912 76
177 3300005563 Ga0068855_100329880 Ga0068855_1003298803 76
178 3300005563 Ga0068855_100588069 Ga0068855_1005880693 76
179 3300005563 Ga0068855_100878046 Ga0068855_1008780461 76
180 3300005563 Ga0068855_102460756 Ga0068855_1024607562 76
181 3300005577 Ga0068857_101491277 Ga0068857_1014912771 76
182 3300005614 Ga0068856_100315530 Ga0068856_1003155302 76
183 3300005614 Ga0068856_100396566 Ga0068856_1003965662 76
184 3300005614 Ga0068856_100589697 Ga0068856_1005896973 76
185 3300005614 Ga0068856_102213052 Ga0068856_1022130522 76
186 3300005616 Ga0068852_100215571 Ga0068852_1002155712 76
187 3300005616 Ga0068852_100491755 Ga0068852_1004917552 76
188 3300005618 Ga0068864_100289248 Ga0068864_1002892483 76
189 3300005719 Ga0068861_100332851 Ga0068861_1003328512 76
190 3300005841 Ga0068863_101126510 Ga0068863_1011265101 76
191 3300005842 Ga0068858_100411601 Ga0068858_1004116011 76
192 3300005842 Ga0068858_101807790 Ga0068858_1018077902 76
193 3300005843 Ga0068860_100179290 Ga0068860_1001792902 76
194 3300005843 Ga0068860_100929758 Ga0068860_1009297582 76
195 3300006038 Ga0075365_10271605 Ga0075365_102716052 76
196 3300006042 Ga0075368_10171309 Ga0075368_101713092 76
197 3300006048 Ga0075363_100092451 Ga0075363_1000924512 76
198 3300006051 Ga0075364_10050430 Ga0075364_100504303 76
199 3300006051 Ga0075364_10913167 Ga0075364_109131672 76
200 3300006163 Ga0070715_10694842 Ga0070715_106948422 76
201 3300006178 Ga0075367_10512155 Ga0075367_105121552 76
202 3300006186 Ga0075369_10038554 Ga0075369_100385543 76
203 3300006186 Ga0075369_10130781 Ga0075369_101307812 76
204 3300006195 Ga0075366_10407851 Ga0075366_104078513 76
205 3300006353 Ga0075370_10067526 Ga0075370_100675262 76
206 3300006353 Ga0075370_10095494 Ga0075370_100954942 76
207 3300009093 Ga0105240_10018456 Ga0105240_100184568 76
208 3300009093 Ga0105240_11060074 Ga0105240_110600743 76
209 3300009098 Ga0105245_10126664 Ga0105245_101266643 76
210 3300009101 Ga0105247_10052525 Ga0105247_100525253 76
211 3300009101 Ga0105247_10202978 Ga0105247_102029782 76
212 3300009148 Ga0105243_10539995 Ga0105243_105399953 76
213 3300009148 Ga0105243_10645868 Ga0105243_106458681 76
214 3300009174 Ga0105241_10091961 Ga0105241_100919612 76
215 3300009174 Ga0105241_10190745 Ga0105241_101907454 76
216 3300009174 Ga0105241_10380463 Ga0105241_103804632 76
217 3300009176 Ga0105242_10086081 Ga0105242_100860812 76
218 3300009177 Ga0105248_10245311 Ga0105248_102453113 76
219 3300009177 Ga0105248_11678652 Ga0105248_116786521 76
220 3300009177 Ga0105248_12194707 Ga0105248_121947072 76
221 3300009545 Ga0105237_10136563 Ga0105237_101365632 76
222 3300009545 Ga0105237_10227409 Ga0105237_102274093 76
223 3300009545 Ga0105237_10407573 Ga0105237_104075732 76
224 3300009545 Ga0105237_10539323 Ga0105237_105393232 76
225 3300009553 Ga0105249_10301776 Ga0105249_103017763 76
226 3300010375 Ga0105239_10146107 Ga0105239_101461072 76
227 3300010375 Ga0105239_10162243 Ga0105239_101622432 76
228 3300010375 Ga0105239_10239350 Ga0105239_102393503 76
229 3300010375 Ga0105239_10348601 Ga0105239_103486013 76
230 3300010375 Ga0105239_10436710 Ga0105239_104367103 76
231 3300010375 Ga0105239_10557099 Ga0105239_105570992 76
232 3300011119 Ga0105246_10300605 Ga0105246_103006053 76
233 3300013104 Ga0157370_10507641 Ga0157370_105076412 76
234 3300013105 Ga0157369_11171509 Ga0157369_111715092 76
235 3300013296 Ga0157374_11486668 Ga0157374_114866682 76
236 3300013297 Ga0157378_10712333 Ga0157378_107123332 76
237 3300013308 Ga0157375_10405651 Ga0157375_104056512 76
238 3300014325 Ga0163163_10133068 Ga0163163_101330683 76
239 3300014325 Ga0163163_10720929 Ga0163163_107209292 76
240 3300014497 Ga0182008_10310352 Ga0182008_103103522 76
241 3300014745 Ga0157377_10375108 Ga0157377_103751081 76
242 3300014968 Ga0157379_10267196 Ga0157379_102671963 76
243 3300014968 Ga0157379_11315654 Ga0157379_113156542 76
244 3300014969 Ga0157376_10181606 Ga0157376_101816063 76
245 3300014969 Ga0157376_10476849 Ga0157376_104768492 76
246 3300014969 Ga0157376_11853301 Ga0157376_118533012 76
247 3300014969 Ga0157376_12610770 Ga0157376_126107702 76
248 3300015262 Ga0182007_10171592 Ga0182007_101715921 76
249 3300020078 Ga0206352_10062491 Ga0206352_100624912 76
250 3300025230 Ga0209563_103076 Ga0209563_1030762 76
251 3300025253 Ga0209677_100991 Ga0209677_1009919 76
252 3300025254 Ga0209148_1000232 Ga0209148_100023240 76
253 3300025261 Ga0209233_1011852 Ga0209233_10118523 76
254 3300025261 Ga0209233_1041370 Ga0209233_10413702 76
255 3300025272 Ga0209455_1001882 Ga0209455_10018824 76
256 3300025273 Ga0209673_1027108 Ga0209673_10271083 76
257 3300025295 Ga0209564_1002450 Ga0209564_100245014 76
258 3300025295 Ga0209564_1017503 Ga0209564_10175034 76
259 3300025297 Ga0209758_1000705 Ga0209758_10007052 76
260 3300025297 Ga0209758_1000767 Ga0209758_100076752 76
261 3300025297 Ga0209758_1001616 Ga0209758_10016166 76
262 3300025297 Ga0209758_1008725 Ga0209758_10087252 76
263 3300025297 Ga0209758_1080863 Ga0209758_10808633 76
264 3300025299 Ga0209256_1001558 Ga0209256_100155824 76
265 3300025299 Ga0209256_1019224 Ga0209256_10192242 76
266 3300025302 Ga0207426_1000857 Ga0207426_100085719 76
267 3300025302 Ga0207426_1023543 Ga0207426_10235433 76
268 3300025302 Ga0207426_1090502 Ga0207426_10905022 76
269 3300025303 Ga0209051_1061776 Ga0209051_10617763 76
270 3300025304 Ga0209257_1001185 Ga0209257_100118510 76
271 3300025304 Ga0209257_1083795 Ga0209257_10837952 76
272 3300025315 Ga0207697_10185706 Ga0207697_101857062 76
273 3300025900 Ga0207710_10054902 Ga0207710_100549023 76
274 3300025904 Ga0207647_10058350 Ga0207647_100583504 76
275 3300025911 Ga0207654_10318178 Ga0207654_103181783 76
276 3300025913 Ga0207695_10000123 Ga0207695_1000012336 76
277 3300025914 Ga0207671_10003497 Ga0207671_1000349719 76
278 3300025914 Ga0207671_10311429 Ga0207671_103114292 76
279 3300025915 Ga0207693_10280504 Ga0207693_102805042 76
280 3300025919 Ga0207657_10392998 Ga0207657_103929982 76
281 3300025919 Ga0207657_10610136 Ga0207657_106101362 76
282 3300025919 Ga0207657_10947014 Ga0207657_109470142 76
283 3300025920 Ga0207649_10359417 Ga0207649_103594172 76
284 3300025924 Ga0207694_10572186 Ga0207694_105721863 76
285 3300025925 Ga0207650_10281801 Ga0207650_102818012 76
286 3300025926 Ga0207659_10512437 Ga0207659_105124372 76
287 3300025927 Ga0207687_10439877 Ga0207687_104398772 76
288 3300025931 Ga0207644_10083068 Ga0207644_100830683 76
289 3300025931 Ga0207644_10172008 Ga0207644_101720083 76
290 3300025932 Ga0207690_10067398 Ga0207690_100673982 76
291 3300025933 Ga0207706_10200570 Ga0207706_102005702 76
292 3300025933 Ga0207706_10501044 Ga0207706_105010442 76
293 3300025933 Ga0207706_11396665 Ga0207706_113966652 76
294 3300025934 Ga0207686_10537352 Ga0207686_105373522 76
295 3300025935 Ga0207709_10544111 Ga0207709_105441112 76
296 3300025935 Ga0207709_10578349 Ga0207709_105783491 76
297 3300025941 Ga0207711_10280878 Ga0207711_102808782 76
298 3300025941 Ga0207711_11879115 Ga0207711_118791151 76
299 3300025942 Ga0207689_10776870 Ga0207689_107768702 76
300 3300025949 Ga0207667_10156445 Ga0207667_101564454 76
301 3300025949 Ga0207667_10275164 Ga0207667_102751643 76
302 3300025949 Ga0207667_10998194 Ga0207667_109981941 76
303 3300025960 Ga0207651_10526728 Ga0207651_105267282 76
304 3300025961 Ga0207712_10282869 Ga0207712_102828692 76
305 3300025972 Ga0207668_10012227 Ga0207668_100122274 76
306 3300025972 Ga0207668_10371566 Ga0207668_103715662 76
307 3300025981 Ga0207640_10430808 Ga0207640_104308082 76
308 3300025981 Ga0207640_10602072 Ga0207640_106020723 76
309 3300025986 Ga0207658_10554848 Ga0207658_105548482 76
310 3300025986 Ga0207658_10634475 Ga0207658_106344752 76
311 3300026023 Ga0207677_11069810 Ga0207677_110698102 76
312 3300026041 Ga0207639_10629666 Ga0207639_106296661 76
313 3300026041 Ga0207639_10956333 Ga0207639_109563331 76
314 3300026067 Ga0207678_10030523 Ga0207678_100305233 76
315 3300026067 Ga0207678_10104496 Ga0207678_101044962 76
316 3300026078 Ga0207702_11079761 Ga0207702_110797612 76
317 3300026078 Ga0207702_11339239 Ga0207702_113392393 76
318 3300026078 Ga0207702_12362902 Ga0207702_123629021 76
319 3300026088 Ga0207641_10282074 Ga0207641_102820743 76
320 3300026089 Ga0207648_10108970 Ga0207648_101089702 76
321 3300026095 Ga0207676_10889509 Ga0207676_108895092 76
322 3300026116 Ga0207674_10067482 Ga0207674_100674824 76
323 3300026118 Ga0207675_100200838 Ga0207675_1002008382 76
324 3300026121 Ga0207683_11416773 Ga0207683_114167732 76
325 3300026142 Ga0207698_10869897 Ga0207698_108698972 76
326 3300027866 Ga0209813_10201060 Ga0209813_102010601 76
327 3300028379 Ga0268266_10024242 Ga0268266_100242428 76
328 3300028379 Ga0268266_10387501 Ga0268266_103875012 76
329 3300028379 Ga0268266_10634165 Ga0268266_106341652 76
330 3300028379 Ga0268266_10772365 Ga0268266_107723651 76
331 3300028381 Ga0268264_10616814 Ga0268264_106168142 76
332 3300028381 Ga0268264_11015220 Ga0268264_110152203 76
333 3300028786 Ga0307517_10265645 Ga0307517_102656452 76
334 3300028786 Ga0307517_10507948 Ga0307517_105079481 76
335 3300031649 Ga0307514_10384114 Ga0307514_103841142 76
336 3300031838 Ga0307518_10495474 Ga0307518_104954742 76
337 3300033180 Ga0307510_10041777 Ga0307510_100417777 76
338 3300035172 Ga0373955_0315359 Ga0373955_0315359_418_648 76
339 3300037068 Ga0373925_1332378 Ga0373925_1332378_142_372 76
340 3300037418 Ga0395900_1343237 Ga0395900_1343237_76_306 76
341 3300037466 Ga0395898_0441828 Ga0395898_0441828_571_801 76
342 3300037471 Ga0395905_0018783 Ga0395905_0018783_6168_6398 76
343 3300037471 Ga0395905_0241355 Ga0395905_0241355_1434_1664 76
344 3300038443 Ga0395901_0390143 Ga0395901_0390143_506_736 76
345 3300041451 Ga0451791_1228850 Ga0451791_1228850_38_268 76
346 3300041452 Ga0451793_0789318 Ga0451793_0789318_297_527 76
347 3300041456 Ga0451795_1357315 Ga0451795_1357315_42_272 76
348 3300041511 Ga0451855_0383189 Ga0451855_0383189_66_296 76
349 3300044656 Ga0466969_0054869 Ga0466969_0054869_1059_1289 76
350 3300044656 Ga0466969_0445598 Ga0466969_0445598_102_332 76
351 3300044658 Ga0466972_0000164 Ga0466972_0000164_10484_10714 76
352 3300044683 Ga0466965_0398158 Ga0466965_0398158_316_546 76
353 3300044684 Ga0466966_0014160 Ga0466966_0014160_4083_4313 76
354 3300044693 Ga0466961_0000192 Ga0466961_0000192_30857_31087 76
355 3300044693 Ga0466961_0282067 Ga0466961_0282067_516_746 76
356 3300044706 Ga0466964_0045199 Ga0466964_0045199_1007_1237 76
357 3300044706 Ga0466964_0201760 Ga0466964_0201760_245_475 76
358 3300044735 Ga0466968_0140997 Ga0466968_0140997_786_1016 76
359 3300044735 Ga0466968_0159236 Ga0466968_0159236_559_789 76
360 3300044765 Ga0466970_0535379 Ga0466970_0535379_208_438 76
361 3300044842 Ga0466957_0406393 Ga0466957_0406393_406_636 76
362 3300044842 Ga0466957_0883604 Ga0466957_0883604_88_318 76
363 3300044901 Ga0466960_0158421 Ga0466960_0158421_624_854 76
364 3300044901 Ga0466960_0647438 Ga0466960_0647438_377_607 76
365 3300045049 Ga0466959_0001746 Ga0466959_0001746_9994_10224 76
366 3300045049 Ga0466959_0917015 Ga0466959_0917015_80_310 76
367 3300046454 Ga0495592_0119356 Ga0495592_0119356_504_734 76
368 3300046455 Ga0495603_0126422 Ga0495603_0126422_354_584 76
369 3300046459 Ga0495629_0001707 Ga0495629_0001707_336_566 76
370 3300046459 Ga0495629_0142373 Ga0495629_0142373_1026_1256 76
371 3300046460 Ga0495638_0002914 Ga0495638_0002914_12560_12790 76
372 3300046462 Ga0495651_0206029 Ga0495651_0206029_887_1117 76
373 3300046462 Ga0495651_0603158 Ga0495651_0603158_240_470 76
374 3300046471 Ga0495650_0289871 Ga0495650_0289871_93_323 76
375 3300046477 Ga0495664_0032082 Ga0495664_0032082_1088_1318 76
376 3300046491 Ga0495584_0325117 Ga0495584_0325117_183_452 76
377 3300046491 Ga0495584_0600489 Ga0495584_0600489_85_315 76
378 3300046499 Ga0495594_0373774 Ga0495594_0373774_77_307 76
379 3300046500 Ga0495596_0126695 Ga0495596_0126695_704_934 76
380 3300046501 Ga0495607_0152613 Ga0495607_0152613_305_535 76
381 3300046506 Ga0495583_0058651 Ga0495583_0058651_31_261 76
382 3300046511 Ga0495608_0048816 Ga0495608_0048816_2382_2612 76
383 3300046511 Ga0495608_0077661 Ga0495608_0077661_767_997 76
384 3300046512 Ga0495610_0090607 Ga0495610_0090607_423_653 76
385 3300046513 Ga0495616_0051067 Ga0495616_0051067_1539_1808 76
386 3300046514 Ga0495618_0527056 Ga0495618_0527056_463_693 76
387 3300046515 Ga0495620_0394609 Ga0495620_0394609_26_256 76
388 3300046516 Ga0495628_0241630 Ga0495628_0241630_894_1124 76
389 3300046516 Ga0495628_0323782 Ga0495628_0323782_609_839 76
390 3300046518 Ga0495631_0046126 Ga0495631_0046126_1619_1849 76
391 3300046519 Ga0495632_0104426 Ga0495632_0104426_501_770 76
392 3300046522 Ga0495643_0062869 Ga0495643_0062869_734_1003 76
393 3300046522 Ga0495643_0287615 Ga0495643_0287615_86_319 76
394 3300046524 Ga0495648_0069673 Ga0495648_0069673_1499_1729 76
395 3300046524 Ga0495648_0082457 Ga0495648_0082457_1519_1749 76
396 3300046524 Ga0495648_0095469 Ga0495648_0095469_194_424 76
397 3300046524 Ga0495648_0172513 Ga0495648_0172513_702_932 76
398 3300046529 Ga0495652_0010890 Ga0495652_0010890_292_522 76
399 3300046529 Ga0495652_0112153 Ga0495652_0112153_280_510 76
400 3300046533 Ga0495640_0055223 Ga0495640_0055223_491_721 76
401 3300046536 Ga0495587_0014879 Ga0495587_0014879_410_640 76
402 3300046536 Ga0495587_0227592 Ga0495587_0227592_306_536 76
403 3300046538 Ga0495609_0123178 Ga0495609_0123178_372_602 76
404 3300046543 Ga0495645_0027684 Ga0495645_0027684_2332_2562 76
405 3300046557 Ga0495622_0019727 Ga0495622_0019727_1721_1951 76
406 3300046557 Ga0495622_0122756 Ga0495622_0122756_743_973 76
407 3300046557 Ga0495622_0164094 Ga0495622_0164094_42_272 76
408 3300046559 Ga0495667_0346667 Ga0495667_0346667_212_442 76
409 3300046615 Ga0495656_0180364 Ga0495656_0180364_363_593 76
410 3300046616 Ga0495668_0047332 Ga0495668_0047332_1654_1884 76
411 3300046616 Ga0495668_0491180 Ga0495668_0491180_17_286 76
412 3300046616 Ga0495668_0618151 Ga0495668_0618151_159_389 76
413 3300046642 Ga0495634_0025688 Ga0495634_0025688_2077_2307 76
414 3300046642 Ga0495634_0194523 Ga0495634_0194523_154_384 76
415 3300046648 Ga0495611_0147139 Ga0495611_0147139_851_1081 76
416 3300046648 Ga0495611_0527773 Ga0495611_0527773_235_465 76
417 3300046660 Ga0495625_0089623 Ga0495625_0089623_147_377 76
418 3300046660 Ga0495625_0186644 Ga0495625_0186644_307_537 76
419 3300046660 Ga0495625_0384117 Ga0495625_0384117_339_569 76
420 3300046660 Ga0495625_0817288 Ga0495625_0817288_26_256 76
421 3300046663 Ga0495635_0010392 Ga0495635_0010392_5763_5993 76
422 3300046663 Ga0495635_0022586 Ga0495635_0022586_221_451 76
423 3300046663 Ga0495635_0565216 Ga0495635_0565216_483_728 76
424 3300046674 Ga0495588_0152274 Ga0495588_0152274_907_1137 76
425 3300046675 Ga0495657_0032748 Ga0495657_0032748_2314_2544 76
426 3300046675 Ga0495657_0044954 Ga0495657_0044954_183_413 76
427 3300046678 Ga0495599_0838272 Ga0495599_0838272_134_364 76
428 3300046679 Ga0495623_0009655 Ga0495623_0009655_4370_4600 76
429 3300046680 Ga0495646_0014215 Ga0495646_0014215_930_1160 76
430 3300046680 Ga0495646_0170562 Ga0495646_0170562_240_470 76
431 3300046680 Ga0495646_0265369 Ga0495646_0265369_503_748 76
432 3300046684 Ga0495669_0258742 Ga0495669_0258742_267_497 76
433 3300046689 Ga0495613_0060249 Ga0495613_0060249_1046_1276 76
434 3300046689 Ga0495613_0674977 Ga0495613_0674977_132_362 76
435 3300046690 Ga0495624_0252542 Ga0495624_0252542_213_443 76
436 3300046690 Ga0495624_0943187 Ga0495624_0943187_240_485 76
437 3300046694 Ga0495649_0023774 Ga0495649_0023774_818_1048 76
438 3300046694 Ga0495649_0150434 Ga0495649_0150434_698_928 76
439 3300046694 Ga0495649_0162324 Ga0495649_0162324_249_518 76
440 3300046694 Ga0495649_0490582 Ga0495649_0490582_155_385 76
441 3300046809 Ga0495600_0005782 Ga0495600_0005782_6932_7162 76
442 3300046809 Ga0495600_0116881 Ga0495600_0116881_387_617 76
443 3300046810 Ga0495660_0277363 Ga0495660_0277363_131_361 76
444 3300047315 Ga0495581_0032716 Ga0495581_0032716_1496_1726 76
445 3300047315 Ga0495581_0174821 Ga0495581_0174821_470_700 76
446 3300047317 Ga0495604_0005334 Ga0495604_0005334_2029_2259 76
447 3300047317 Ga0495604_0075794 Ga0495604_0075794_1782_2012 76
448 3300047319 Ga0495674_0368598 Ga0495674_0368598_646_876 76
449 3300047321 Ga0495676_0099913 Ga0495676_0099913_251_481 76
450 3300047322 Ga0495680_0005028 Ga0495680_0005028_10124_10354 76
451 3300047323 Ga0495683_0144977 Ga0495683_0144977_92_322 76
452 3300047323 Ga0495683_0272745 Ga0495683_0272745_373_642 76
453 3300047323 Ga0495683_0312483 Ga0495683_0312483_36_266 76
454 3300047443 Ga0495687_103364 Ga0495687_103364_20_289 76
455 3300047444 Ga0495675_0059833 Ga0495675_0059833_1826_2056 76
456 3300047445 Ga0495677_0152295 Ga0495677_0152295_496_726 76
457 3300047446 Ga0495679_090769 Ga0495679_090769_17_247 76
458 3300047469 Ga0495673_0047286 Ga0495673_0047286_981_1211 76
459 3300047469 Ga0495673_0095356 Ga0495673_0095356_631_861 76
460 3300047472 Ga0495686_0070363 Ga0495686_0070363_436_666 76
461 3300047472 Ga0495686_0127153 Ga0495686_0127153_1031_1261 76
462 3300047472 Ga0495686_0657987 Ga0495686_0657987_89_319 76
463 3300048088 Ga0495602_0034441 Ga0495602_0034441_86_316 76
464 3300048088 Ga0495602_0072394 Ga0495602_0072394_1664_1894 76
465 3300048089 Ga0495614_0202802 Ga0495614_0202802_603_833 76
466 3300048903 Ga0496100_0353934 Ga0496100_0353934_859_1089 76
467 3300048903 Ga0496100_0941517 Ga0496100_0941517_228_458 76
468 3300048903 Ga0496100_1555729 Ga0496100_1555729_226_456 76
469 3300048904 Ga0496101_0488726 Ga0496101_0488726_396_626 76
470 3300048904 Ga0496101_0583051 Ga0496101_0583051_434_664 76
471 3300048905 Ga0496102_0187141 Ga0496102_0187141_1314_1583 76
472 3300048905 Ga0496102_0605818 Ga0496102_0605818_180_410 76
473 3300048905 Ga0496102_1133081 Ga0496102_1133081_245_475 76
474 3300048905 Ga0496102_1407633 Ga0496102_1407633_236_466 76
475 3300048906 Ga0496103_0107292 Ga0496103_0107292_532_801 76
476 3300048906 Ga0496103_0205310 Ga0496103_0205310_328_558 76
477 3300048907 Ga0496104_0003677 Ga0496104_0003677_1910_2140 76
478 3300048907 Ga0496104_0030189 Ga0496104_0030189_1764_1994 76
479 3300048907 Ga0496104_0306551 Ga0496104_0306551_933_1202 76
480 3300048907 Ga0496104_0395247 Ga0496104_0395247_760_990 76
481 3300048908 Ga0496105_0002470 Ga0496105_0002470_6163_6393 76
482 3300048908 Ga0496105_0019150 Ga0496105_0019150_1881_2111 76
483 3300048908 Ga0496105_0187699 Ga0496105_0187699_952_1182 76
484 3300048909 Ga0496106_0022614 Ga0496106_0022614_2087_2317 76
485 3300048910 Ga0496107_0166917 Ga0496107_0166917_203_433 76
486 3300048910 Ga0496107_0228698 Ga0496107_0228698_805_1035 76
487 3300048911 Ga0496108_0187449 Ga0496108_0187449_620_889 76
488 3300048911 Ga0496108_1056783 Ga0496108_1056783_153_383 76
489 3300048912 Ga0496109_0762904 Ga0496109_0762904_618_887 76
490 3300048913 Ga0496110_0130025 Ga0496110_0130025_973_1242 76
491 3300048913 Ga0496110_0250526 Ga0496110_0250526_666_896 76
492 3300048913 Ga0496110_0906588 Ga0496110_0906588_404_634 76
493 3300048914 Ga0496111_0057391 Ga0496111_0057391_1031_1261 76
494 3300048914 Ga0496111_0345875 Ga0496111_0345875_28_258 76
495 3300048915 Ga0496112_0213724 Ga0496112_0213724_921_1190 76
496 3300048915 Ga0496112_0831973 Ga0496112_0831973_244_474 76
497 3300048915 Ga0496112_1323830 Ga0496112_1323830_176_406 76
498 3300048916 Ga0496113_0011865 Ga0496113_0011865_1295_1525 76
499 3300048916 Ga0496113_0243138 Ga0496113_0243138_856_1086 76
500 3300048916 Ga0496113_0559148 Ga0496113_0559148_56_286 76
501 3300048917 Ga0496114_0083788 Ga0496114_0083788_1420_1650 76
502 3300048918 Ga0496115_0166200 Ga0496115_0166200_1191_1421 76
503 3300048918 Ga0496115_0243406 Ga0496115_0243406_196_426 76
504 3300048918 Ga0496115_0514257 Ga0496115_0514257_588_818 76
505 3300048919 Ga0496116_0022320 Ga0496116_0022320_1065_1295 76
506 3300048920 Ga0496117_0231363 Ga0496117_0231363_517_747 76
507 3300048920 Ga0496117_0252770 Ga0496117_0252770_340_570 76
508 3300048920 Ga0496117_0321731 Ga0496117_0321731_127_357 76
509 3300048921 Ga0496118_0043083 Ga0496118_0043083_2012_2242 76
510 3300048921 Ga0496118_0099141 Ga0496118_0099141_285_515 76
511 3300048921 Ga0496118_0110487 Ga0496118_0110487_802_1071 76
512 3300048921 Ga0496118_0132729 Ga0496118_0132729_1084_1314 76
513 3300048922 Ga0496119_0068166 Ga0496119_0068166_1782_2012 76
514 3300048922 Ga0496119_0225577 Ga0496119_0225577_446_676 76
515 3300048922 Ga0496119_0250808 Ga0496119_0250808_492_761 76
516 3300048923 Ga0496120_0044017 Ga0496120_0044017_1814_2044 76
517 3300048923 Ga0496120_0061207 Ga0496120_0061207_1520_1750 76
518 3300048924 Ga0496121_0016155 Ga0496121_0016155_1424_1654 76
519 3300048924 Ga0496121_0119729 Ga0496121_0119729_1693_1923 76
520 3300048924 Ga0496121_0184663 Ga0496121_0184663_687_917 76
521 3300048925 Ga0496122_0157772 Ga0496122_0157772_202_435 76
522 3300048925 Ga0496122_0323860 Ga0496122_0323860_532_801 76
523 3300048926 Ga0496123_0130413 Ga0496123_0130413_592_861 76
524 3300048927 Ga0496124_0126828 Ga0496124_0126828_925_1155 76
525 3300048927 Ga0496124_0335407 Ga0496124_0335407_479_748 76
526 3300048927 Ga0496124_0944911 Ga0496124_0944911_114_344 76
527 3300048928 Ga0496125_0039775 Ga0496125_0039775_1550_1783 76
528 3300048928 Ga0496125_0072747 Ga0496125_0072747_412_642 76
529 3300048928 Ga0496125_0363644 Ga0496125_0363644_189_425 76
530 3300048929 Ga0496126_0014768 Ga0496126_0014768_2546_2776 76
531 3300048929 Ga0496126_0097252 Ga0496126_0097252_872_1102 76
532 3300048929 Ga0496126_0389602 Ga0496126_0389602_25_255 76
533 3300048929 Ga0496126_0616610 Ga0496126_0616610_538_768 76
534 3300048929 Ga0496126_0696238 Ga0496126_0696238_342_572 76
535 3300049460 Ga0495682_0309956 Ga0495682_0309956_200_430 76
536 3300050490 nmdc:mga03n38_291688_c1 nmdc:mga03n38_291688_c1_479_748 76
537 3300050491 nmdc:mga00v17_124473_c1 nmdc:mga00v17_124473_c1_788_1057 76
538 3300050493 nmdc:mga0k408_104431_c1 nmdc:mga0k408_104431_c1_232_501 76
539 3300050494 nmdc:mga06z11_140137_c1 nmdc:mga06z11_140137_c1_589_819 76
540 3300050495 nmdc:mga04h51_392865_c1 nmdc:mga04h51_392865_c1_292_561 76
541 3300050496 nmdc:mga07m45_33230_c1 nmdc:mga07m45_33230_c1_129_398 76
542 3300050516 nmdc:mga0sz30_36479_c1 nmdc:mga0sz30_36479_c1_692_925 76
543 3300050516 nmdc:mga0sz30_41348_c1 nmdc:mga0sz30_41348_c1_193_426 76
544 3300050516 nmdc:mga0sz30_501879_c1 nmdc:mga0sz30_501879_c1_306_536 76
545 3300050516 nmdc:mga0sz30_61091_c1 nmdc:mga0sz30_61091_c1_869_1138 76
546 3300053079 Ga0500610_0267602 Ga0500610_0267602_163_393 76
547 3300053080 Ga0500635_0056317 Ga0500635_0056317_879_1109 76
548 3300053085 Ga0495619_0089308 Ga0495619_0089308_119_349 76
549 3300053086 Ga0500578_0439047 Ga0500578_0439047_182_412 76
550 3300053088 Ga0500644_0076519 Ga0500644_0076519_246_476 76
551 3300053088 Ga0500644_0255536 Ga0500644_0255536_414_644 76
552 3300053089 Ga0500581_303976 Ga0500581_303976_56_286 76
553 3300053092 Ga0500583_0152953 Ga0500583_0152953_294_524 76
554 3300053093 Ga0500651_0100618 Ga0500651_0100618_421_651 76
555 3300053093 Ga0500651_0176557 Ga0500651_0176557_868_1098 76
556 3300053093 Ga0500651_0776676 Ga0500651_0776676_221_451 76
557 3300053094 Ga0500566_0001157 Ga0500566_0001157_2692_2922 76
558 3300053094 Ga0500566_0475490 Ga0500566_0475490_226_456 76
559 3300053095 Ga0500640_046441 Ga0500640_046441_1303_1533 76
560 3300053096 Ga0500641_0044627 Ga0500641_0044627_717_947 76
561 3300053098 Ga0500650_0077286 Ga0500650_0077286_781_1011 76
562 3300053102 Ga0500554_137853 Ga0500554_137853_84_314 76
563 3300053103 Ga0500555_006517 Ga0500555_006517_1879_2109 76
564 3300053104 Ga0500556_0170963 Ga0500556_0170963_173_403 76
565 3300053108 Ga0500562_008443 Ga0500562_008443_1601_1831 76
566 3300053109 Ga0500569_004124 Ga0500569_004124_1426_1656 76
567 3300053109 Ga0500569_068209 Ga0500569_068209_436_666 76
568 3300053111 Ga0500572_014786 Ga0500572_014786_1619_1849 76
569 3300053116 Ga0500592_002785 Ga0500592_002785_1432_1662 76
570 3300053118 Ga0500594_0020657 Ga0500594_0020657_80_310 76
571 3300053119 Ga0500595_015814 Ga0500595_015814_1729_1959 76
572 3300053121 Ga0500607_004790 Ga0500607_004790_8161_8391 76
573 3300053122 Ga0500608_030363 Ga0500608_030363_1364_1594 76
574 3300053123 Ga0500614_076344 Ga0500614_076344_449_679 76
575 3300053125 Ga0500618_069291 Ga0500618_069291_474_704 76
576 3300053126 Ga0500621_126379 Ga0500621_126379_614_844 76
577 3300053126 Ga0500621_281479 Ga0500621_281479_136_366 76
578 3300053130 Ga0500642_0135231 Ga0500642_0135231_406_636 76
579 3300053130 Ga0500642_0242264 Ga0500642_0242264_312_542 76
580 3300053133 Ga0500655_052853 Ga0500655_052853_364_594 76
581 3300053136 Ga0500559_0565957 Ga0500559_0565957_227_457 76
582 3300053138 Ga0500564_066019 Ga0500564_066019_1031_1261 76
583 3300053139 Ga0500568_0044530 Ga0500568_0044530_58_288 76
584 3300053142 Ga0500577_0019365 Ga0500577_0019365_610_840 76
585 3300053142 Ga0500577_0521209 Ga0500577_0521209_176_406 76
586 3300053148 Ga0500590_086798 Ga0500590_086798_989_1219 76
587 3300053148 Ga0500590_156074 Ga0500590_156074_221_451 76
588 3300053151 Ga0500604_0069147 Ga0500604_0069147_825_1055 76
589 3300053153 Ga0500616_0063545 Ga0500616_0063545_850_1080 76
590 3300053154 Ga0500619_029933 Ga0500619_029933_47_277 76
591 3300053155 Ga0500620_010398 Ga0500620_010398_1869_2099 76
592 3300053156 Ga0500622_0118755 Ga0500622_0118755_691_921 76
593 3300053157 Ga0500624_039880 Ga0500624_039880_235_468 76
594 3300053162 Ga0500638_100272 Ga0500638_100272_879_1109 76
595 3300053163 Ga0500639_213906 Ga0500639_213906_145_375 76
596 3300053163 Ga0500639_241396 Ga0500639_241396_341_571 76
597 3300053177 Ga0500636_0001310 Ga0500636_0001310_3832_4062 76
598 3300053177 Ga0500636_0237708 Ga0500636_0237708_146_391 76
599 3300053177 Ga0500636_0346578 Ga0500636_0346578_36_266 76
600 3300053177 Ga0500636_0453516 Ga0500636_0453516_313_543 76
601 3300053723 Ga0500567_219284 Ga0500567_219284_85_315 76
602 3300053727 Ga0500611_150551 Ga0500611_150551_270_500 76
603 3300053730 Ga0500645_047532 Ga0500645_047532_361_627 76
604 3300053733 Ga0500552_075557 Ga0500552_075557_191_421 76
605 3300053735 Ga0500596_016223 Ga0500596_016223_85_315 76
606 3300053736 Ga0500599_001988 Ga0500599_001988_738_968 76
607 3300053737 Ga0500601_000314 Ga0500601_000314_1638_1871 76
608 3300055283 Ga0500661_014216 Ga0500661_014216_414_644 76
609 3300059478 Ga0587093_052242 Ga0587093_052242_296_535 76
610 3300059490 Ga0587066_097843 Ga0587066_097843_137_376 76
611 3300059491 Ga0587070_115134 Ga0587070_115134_111_350 76
612 3300059492 Ga0587073_0145057 Ga0587073_0145057_288_527 76
613 3300059503 Ga0587080_045827 Ga0587080_045827_296_535 76
614 3300059504 Ga0587082_064362 Ga0587082_064362_296_535 76
615 3300059504 Ga0587082_168595 Ga0587082_168595_15_245 76
616 3300059505 Ga0587083_0225278 Ga0587083_0225278_111_350 76
617 3300059507 Ga0587086_044381 Ga0587086_044381_174_413 76
618 3300059510 Ga0587090_054994 Ga0587090_054994_208_447 76
619 3300059511 Ga0587091_108242 Ga0587091_108242_291_530 76
620 3300059623 Ga0587101_043075 Ga0587101_043075_432_662 76
621 3300059626 Ga0587115_051878 Ga0587115_051878_116_355 76
622 3300059627 Ga0587117_050154 Ga0587117_050154_137_376 76
623 3300059641 Ga0587068_088866 Ga0587068_088866_109_348 76
624 3300059644 Ga0587075_104449 Ga0587075_104449_251_490 76
625 3300059645 Ga0587076_070915 Ga0587076_070915_297_536 76
626 3300059646 Ga0587078_038655 Ga0587078_038655_290_529 76
627 3300060344 Ga0587071_162926 Ga0587071_162926_110_340 76
628 3300060346 Ga0587111_0258873 Ga0587111_0258873_245_484 76

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hte-assembly1.cif.gz_A-2 recombinant bovine beta-lactoglobulin variant l1a/i2s (sblgb#2) 0.913 30 59
7s00-assembly1.cif.gz_C x-ray structure of the phage ar9 non-virion rna polymerase core 0.895 30 60
6ryt-assembly1.cif.gz_A engineered beta-lactoglobulin: variant m107l 0.8924 30 64
7q18-assembly1.cif.gz_BBB beta-lactoglobulin mutant faf (i56f/l39a/m107f), unliganded form 0.8815 30 64
6ryt-assembly1.cif.gz_B engineered beta-lactoglobulin: variant m107l 0.87 30 64
ID Description Score Start End Superfamily
af_Q54H02_2_246_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9433 30 60 3.50.50.60
af_Q9SVJ9_86_341_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.8936 34 59 2.120.10.80
af_Q19910_105_449_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8829 30 59 3.50.50.60
af_Q8III5_2_235_3.30.830.10 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.8764 30 59 3.30.830.10
1tkwB02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8716 32 63 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A7Y6PX91-F1-model_v4 Uncharacterized protein 0.9468 22 59
AF-A0A1H6BUU7-F1-model_v4 Transcriptional repressor NrdR-like N-terminal domain-containing protein 0.9439 22 59
AF-A0A1F8T3N3-F1-model_v4 Transcriptional regulator NrdR 0.9263 22 62 GO:0003677
GO:0005524
GO:0008270
GO:0045892
AF-A0A496QP86-F1-model_v4 Pyridine nucleotide-disulfide oxidoreductase 0.9208 30 60
AF-A0A849WZ07-F1-model_v4 Transcriptional repressor NrdR 0.9147 22 59 GO:0003677
GO:0005524
GO:0008270
GO:0045892

Feature Viewer

pLDDT pTM Quality
77.43 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map