F470621
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 628 | 422 | 529 | 77 |
Family's Representative Sequence
| Representative Sequence | 3300005331|Ga0070670_100207073|Ga0070670_1002070732 |
| Length | 89 |
| Sequence | MIGQGQRAKGEPVMSVIEFDDATRPRIYDRTVLSNCPECGDDLTVVRVIGGRAGCEYWTMRCTGCGGIHLDILKPQRAAGDDEGPPPVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 2 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 3 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 4 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 5 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 6 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 7 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 8 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 9 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 10 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 11 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 12 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 13 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 14 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 15 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 16 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 17 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 18 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 19 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 20 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 21 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 22 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 23 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 24 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 25 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 26 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 27 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 28 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 29 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 30 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 31 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 32 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 33 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 34 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 35 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 36 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 37 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 38 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 39 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 40 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 41 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 42 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 43 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 44 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 45 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 46 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 47 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 48 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 49 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 50 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 51 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 52 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 53 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 54 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 55 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 56 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 57 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 58 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 59 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 60 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 61 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 62 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 63 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 64 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 65 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 66 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 67 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 68 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 69 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 70 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 71 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 72 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 73 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 74 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 75 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 76 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 77 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 78 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 79 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 80 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 81 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 82 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 83 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 84 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 85 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 86 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 87 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 88 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 89 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 90 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 91 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 93 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 95 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 97 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 108 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 109 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 110 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 112 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 113 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 114 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 115 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 116 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 117 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 118 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 119 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 120 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 121 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 122 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 123 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 124 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 125 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 126 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 127 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 128 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 129 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 130 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 131 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 132 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 150 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 154 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 155 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 156 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 157 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 158 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 165 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 167 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 208 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 209 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 210 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 211 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 212 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 215 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 216 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 217 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 218 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 219 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 221 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 222 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 223 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 224 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 225 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 226 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 227 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 229 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 230 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 231 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 232 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 233 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 234 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 235 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 236 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 237 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 238 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 239 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 240 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 303 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 304 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 305 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 306 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 307 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 308 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 311 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 312 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 313 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 314 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 315 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 316 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 317 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 318 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 319 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 320 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 321 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 322 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 323 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 324 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 325 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 326 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 327 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 329 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 330 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 331 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 332 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 333 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 334 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 335 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 336 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 337 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 339 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 340 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 341 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 342 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 343 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 344 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 345 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 346 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 347 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 348 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 349 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 350 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 351 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 352 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 353 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 354 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 355 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 356 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 357 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 358 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 359 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 360 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 361 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 362 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 363 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 364 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 365 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 366 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 367 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 368 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 369 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 370 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 371 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 372 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 373 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 374 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 375 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 376 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 377 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 378 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 379 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 380 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 381 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 382 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 383 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 384 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 385 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 386 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 387 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 390 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 391 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 392 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 396 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 398 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 399 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 401 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 402 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 404 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 405 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 408 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 409 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 410 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 411 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 412 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 413 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 414 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 415 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 416 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 417 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 418 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 419 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 420 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 421 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 422 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 80.86 |
| Metatranscriptomes | 3.51 |
| Isolates | 15.63 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 20.22 |
| Nodule | 16.08 |
| Rhizoplane | 6.85 |
| Rhizosphere | 48.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.96 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10006030 | 3300003215 | Bacteria | 6229 |
| 2 | JGI25153J46596_10018982 | 3300003215 | Bacteria | 2648 |
| 3 | JGI25153J46596_10052360 | 3300003215 | Bacteria | 1162 |
| 4 | JGI25160J50197_1003029 | 3300003354 | Bacteria | 7660 |
| 5 | JGI25160J50197_1064565 | 3300003354 | Bacteria | 718 |
| 6 | Ga0055542_1012857 | 3300003762 | Bacteria | 1431 |
| 7 | Ga0055529_1039578 | 3300003763 | Bacteria | 572 |
| 8 | Ga0055526_1057686 | 3300003771 | Bacteria | 844 |
| 9 | Ga0055531_10021797 | 3300003794 | Bacteria | 2470 |
| 10 | Ga0055543_1008659 | 3300004625 | Bacteria | 2238 |
| 11 | Ga0065165_1002424 | 3300005262 | Bacteria | 15862 |
| 12 | Ga0065165_1009957 | 3300005262 | Bacteria | 4183 |
| 13 | Ga0065165_1023460 | 3300005262 | Bacteria | 2092 |
| 14 | Ga0070670_100207073 | 3300005331 | Bacteria | 1705 |
| 15 | Ga0068869_100720895 | 3300005334 | Bacteria | 852 |
| 16 | Ga0070666_10365929 | 3300005335 | Bacteria | 1033 |
| 17 | Ga0068868_100112626 | 3300005338 | Bacteria | 2212 |
| 18 | Ga0070660_100467994 | 3300005339 | Bacteria | 1047 |
| 19 | Ga0070660_100703890 | 3300005339 | Bacteria | 847 |
| 20 | Ga0070660_100849602 | 3300005339 | Bacteria | 769 |
| 21 | Ga0070687_100667824 | 3300005343 | Bacteria | 722 |
| 22 | Ga0070692_10264245 | 3300005345 | Bacteria | 1036 |
| 23 | Ga0070668_100015332 | 3300005347 | Bacteria | 5727 |
| 24 | Ga0070668_100216243 | 3300005347 | Bacteria | 1579 |
| 25 | Ga0070669_100277883 | 3300005353 | Bacteria | 1341 |
| 26 | Ga0070675_100506108 | 3300005354 | Bacteria | 1089 |
| 27 | Ga0070674_100961833 | 3300005356 | Bacteria | 747 |
| 28 | Ga0070673_100428666 | 3300005364 | Bacteria | 1187 |
| 29 | Ga0070659_100132663 | 3300005366 | Bacteria | 2024 |
| 30 | Ga0070659_100150624 | 3300005366 | Bacteria | 1898 |
| 31 | Ga0070659_100519274 | 3300005366 | Bacteria | 1017 |
| 32 | Ga0070663_100014841 | 3300005455 | Bacteria | 5009 |
| 33 | Ga0070663_100919636 | 3300005455 | Bacteria | 757 |
| 34 | Ga0070678_101782809 | 3300005456 | Bacteria | 580 |
| 35 | Ga0070662_100423962 | 3300005457 | Bacteria | 1101 |
| 36 | Ga0070662_101929831 | 3300005457 | Bacteria | 510 |
| 37 | Ga0068867_100286053 | 3300005459 | Bacteria | 1354 |
| 38 | Ga0070685_11043523 | 3300005466 | Bacteria | 615 |
| 39 | Ga0068853_101112575 | 3300005539 | Bacteria | 762 |
| 40 | Ga0070665_100457894 | 3300005548 | Bacteria | 1286 |
| 41 | Ga0070665_100777323 | 3300005548 | Bacteria | 971 |
| 42 | Ga0070665_101780091 | 3300005548 | Bacteria | 623 |
| 43 | Ga0068855_100329880 | 3300005563 | Bacteria | 1685 |
| 44 | Ga0068855_100588069 | 3300005563 | Bacteria | 1202 |
| 45 | Ga0068855_100878046 | 3300005563 | Bacteria | 949 |
| 46 | Ga0068855_102460756 | 3300005563 | Bacteria | 519 |
| 47 | Ga0068857_101491277 | 3300005577 | Bacteria | 659 |
| 48 | Ga0068856_100315530 | 3300005614 | Bacteria | 1581 |
| 49 | Ga0068856_100396566 | 3300005614 | Bacteria | 1400 |
| 50 | Ga0068856_100589697 | 3300005614 | Bacteria | 1133 |
| 51 | Ga0068856_102213052 | 3300005614 | Bacteria | 559 |
| 52 | Ga0068852_100215571 | 3300005616 | Bacteria | 1823 |
| 53 | Ga0068852_100491755 | 3300005616 | Bacteria | 1220 |
| 54 | Ga0068864_100289248 | 3300005618 | Bacteria | 1532 |
| 55 | Ga0068861_100332851 | 3300005719 | Bacteria | 1326 |
| 56 | Ga0068863_101126510 | 3300005841 | Bacteria | 790 |
| 57 | Ga0068858_100411601 | 3300005842 | Bacteria | 1300 |
| 58 | Ga0068858_101807790 | 3300005842 | Bacteria | 604 |
| 59 | Ga0068860_100179290 | 3300005843 | Bacteria | 2048 |
| 60 | Ga0068860_100929758 | 3300005843 | Bacteria | 886 |
| 61 | Ga0068862_101877961 | 3300005844 | Bacteria | 609 |
| 62 | Ga0075365_10271605 | 3300006038 | Bacteria | 1192 |
| 63 | Ga0075368_10171309 | 3300006042 | Bacteria | 912 |
| 64 | Ga0075363_100092451 | 3300006048 | Bacteria | 1666 |
| 65 | Ga0075364_10050430 | 3300006051 | Bacteria | 2716 |
| 66 | Ga0075364_10913167 | 3300006051 | Bacteria | 598 |
| 67 | Ga0070715_10694842 | 3300006163 | Bacteria | 607 |
| 68 | Ga0075367_10512155 | 3300006178 | Bacteria | 761 |
| 69 | Ga0075367_10819545 | 3300006178 | Bacteria | 593 |
| 70 | Ga0075369_10038554 | 3300006186 | Bacteria | 2039 |
| 71 | Ga0075369_10130781 | 3300006186 | Bacteria | 1140 |
| 72 | Ga0075366_10407851 | 3300006195 | Bacteria | 836 |
| 73 | Ga0075370_10067526 | 3300006353 | Bacteria | 2041 |
| 74 | Ga0075370_10095494 | 3300006353 | Bacteria | 1717 |
| 75 | Ga0099822_1054949 | 3300006943 | Bacteria | 1496 |
| 76 | Ga0099823_1004804 | 3300006944 | Bacteria | 13310 |
| 77 | Ga0099823_1138967 | 3300006944 | Bacteria | 560 |
| 78 | Ga0105240_10018456 | 3300009093 | Bacteria | 9366 |
| 79 | Ga0105240_11060074 | 3300009093 | Bacteria | 864 |
| 80 | Ga0105245_10126664 | 3300009098 | Bacteria | 2391 |
| 81 | Ga0105247_10052525 | 3300009101 | Bacteria | 2513 |
| 82 | Ga0105247_10202978 | 3300009101 | Bacteria | 1333 |
| 83 | Ga0105243_10539995 | 3300009148 | Bacteria | 1112 |
| 84 | Ga0105243_10645868 | 3300009148 | Bacteria | 1025 |
| 85 | Ga0105241_10091961 | 3300009174 | Bacteria | 2395 |
| 86 | Ga0105241_10190745 | 3300009174 | Bacteria | 1706 |
| 87 | Ga0105241_10380463 | 3300009174 | Bacteria | 1233 |
| 88 | Ga0105242_10086081 | 3300009176 | Bacteria | 2637 |
| 89 | Ga0105248_10245311 | 3300009177 | Bacteria | 2016 |
| 90 | Ga0105248_11678652 | 3300009177 | Bacteria | 720 |
| 91 | Ga0105248_12194707 | 3300009177 | Bacteria | 628 |
| 92 | Ga0105237_10136563 | 3300009545 | Bacteria | 2446 |
| 93 | Ga0105237_10227409 | 3300009545 | Bacteria | 1866 |
| 94 | Ga0105237_10407573 | 3300009545 | Bacteria | 1364 |
| 95 | Ga0105237_10539323 | 3300009545 | Bacteria | 1173 |
| 96 | Ga0105249_10301776 | 3300009553 | Bacteria | 1606 |
| 97 | Ga0105239_10146107 | 3300010375 | Bacteria | 2637 |
| 98 | Ga0105239_10162243 | 3300010375 | Bacteria | 2498 |
| 99 | Ga0105239_10239350 | 3300010375 | Bacteria | 2037 |
| 100 | Ga0105239_10348601 | 3300010375 | Bacteria | 1671 |
| 101 | Ga0105239_10436710 | 3300010375 | Bacteria | 1484 |
| 102 | Ga0105239_10557099 | 3300010375 | Bacteria | 1306 |
| 103 | Ga0105246_10300605 | 3300011119 | Bacteria | 1295 |
| 104 | Ga0157370_10507641 | 3300013104 | Bacteria | 1107 |
| 105 | Ga0157369_11171509 | 3300013105 | Bacteria | 785 |
| 106 | Ga0157374_11486668 | 3300013296 | Bacteria | 701 |
| 107 | Ga0157378_10712333 | 3300013297 | Bacteria | 1024 |
| 108 | Ga0157375_10405651 | 3300013308 | Bacteria | 1529 |
| 109 | Ga0163163_10133068 | 3300014325 | Bacteria | 2527 |
| 110 | Ga0163163_10720929 | 3300014325 | Bacteria | 1061 |
| 111 | Ga0182008_10310352 | 3300014497 | Bacteria | 827 |
| 112 | Ga0157377_10375108 | 3300014745 | Bacteria | 961 |
| 113 | Ga0157379_10267196 | 3300014968 | Bacteria | 1555 |
| 114 | Ga0157379_11315654 | 3300014968 | Bacteria | 698 |
| 115 | Ga0157376_10181606 | 3300014969 | Bacteria | 1924 |
| 116 | Ga0157376_10476849 | 3300014969 | Bacteria | 1222 |
| 117 | Ga0157376_11853301 | 3300014969 | Bacteria | 640 |
| 118 | Ga0157376_12610770 | 3300014969 | Bacteria | 545 |
| 119 | Ga0182007_10171592 | 3300015262 | Bacteria | 746 |
| 120 | Ga0206352_10062491 | 3300020078 | Bacteria | 587 |
| 121 | Ga0214542_1000156 | 3300021321 | Bacteria | 101631 |
| 122 | Ga0214545_1000078 | 3300021324 | Bacteria | 101631 |
| 123 | Ga0214545_1014427 | 3300021324 | Bacteria | 9197 |
| 124 | Ga0214543_1000136 | 3300021327 | Bacteria | 101629 |
| 125 | Ga0214543_1037727 | 3300021327 | Bacteria | 1423 |
| 126 | Ga0214543_1040129 | 3300021327 | Bacteria | 1262 |
| 127 | Ga0214543_1041212 | 3300021327 | Bacteria | 1201 |
| 128 | Ga0209563_103076 | 3300025230 | Bacteria | 3547 |
| 129 | Ga0209677_100991 | 3300025253 | Bacteria | 13698 |
| 130 | Ga0209148_1000232 | 3300025254 | Bacteria | 90923 |
| 131 | Ga0209233_1011852 | 3300025261 | Bacteria | 2555 |
| 132 | Ga0209233_1041370 | 3300025261 | Bacteria | 996 |
| 133 | Ga0209455_1001882 | 3300025272 | Bacteria | 8741 |
| 134 | Ga0209673_1027108 | 3300025273 | Bacteria | 1868 |
| 135 | Ga0209564_1002450 | 3300025295 | Bacteria | 14636 |
| 136 | Ga0209564_1017503 | 3300025295 | Bacteria | 2788 |
| 137 | Ga0209758_1000705 | 3300025297 | Bacteria | 49585 |
| 138 | Ga0209758_1000767 | 3300025297 | Bacteria | 46198 |
| 139 | Ga0209758_1001616 | 3300025297 | Bacteria | 25709 |
| 140 | Ga0209758_1008725 | 3300025297 | Bacteria | 6480 |
| 141 | Ga0209758_1080863 | 3300025297 | Bacteria | 983 |
| 142 | Ga0209256_1001558 | 3300025299 | Bacteria | 22669 |
| 143 | Ga0209256_1019224 | 3300025299 | Bacteria | 2185 |
| 144 | Ga0207426_1000857 | 3300025302 | Bacteria | 31897 |
| 145 | Ga0207426_1010981 | 3300025302 | Bacteria | 3480 |
| 146 | Ga0207426_1023543 | 3300025302 | Bacteria | 2100 |
| 147 | Ga0207426_1090502 | 3300025302 | Bacteria | 811 |
| 148 | Ga0209051_1061776 | 3300025303 | Bacteria | 1175 |
| 149 | Ga0209257_1001185 | 3300025304 | Bacteria | 32850 |
| 150 | Ga0209257_1083795 | 3300025304 | Bacteria | 811 |
| 151 | Ga0207697_10185706 | 3300025315 | Bacteria | 912 |
| 152 | Ga0207710_10054902 | 3300025900 | Bacteria | 1795 |
| 153 | Ga0207647_10058350 | 3300025904 | Bacteria | 2364 |
| 154 | Ga0207654_10318178 | 3300025911 | Bacteria | 1063 |
| 155 | Ga0207695_10000123 | 3300025913 | Bacteria | 232059 |
| 156 | Ga0207671_10003497 | 3300025914 | Bacteria | 15609 |
| 157 | Ga0207671_10311429 | 3300025914 | Bacteria | 1245 |
| 158 | Ga0207693_10280504 | 3300025915 | Bacteria | 1306 |
| 159 | Ga0207657_10392998 | 3300025919 | Bacteria | 1091 |
| 160 | Ga0207657_10610136 | 3300025919 | Bacteria | 851 |
| 161 | Ga0207657_10947014 | 3300025919 | Bacteria | 662 |
| 162 | Ga0207649_10359417 | 3300025920 | Bacteria | 1080 |
| 163 | Ga0207694_10572186 | 3300025924 | Bacteria | 949 |
| 164 | Ga0207650_10281801 | 3300025925 | Bacteria | 1353 |
| 165 | Ga0207659_10512437 | 3300025926 | Bacteria | 1016 |
| 166 | Ga0207687_10439877 | 3300025927 | Bacteria | 1080 |
| 167 | Ga0207644_10083068 | 3300025931 | Bacteria | 2371 |
| 168 | Ga0207644_10172008 | 3300025931 | Bacteria | 1692 |
| 169 | Ga0207690_10067398 | 3300025932 | Bacteria | 2455 |
| 170 | Ga0207706_10200570 | 3300025933 | Bacteria | 1750 |
| 171 | Ga0207706_10501044 | 3300025933 | Bacteria | 1048 |
| 172 | Ga0207706_11396665 | 3300025933 | Bacteria | 575 |
| 173 | Ga0207686_10537352 | 3300025934 | Bacteria | 912 |
| 174 | Ga0207709_10544111 | 3300025935 | Bacteria | 912 |
| 175 | Ga0207709_10578349 | 3300025935 | Bacteria | 887 |
| 176 | Ga0207711_10280878 | 3300025941 | Bacteria | 1533 |
| 177 | Ga0207711_11879115 | 3300025941 | Bacteria | 542 |
| 178 | Ga0207689_10776870 | 3300025942 | Bacteria | 808 |
| 179 | Ga0207667_10156445 | 3300025949 | Bacteria | 2345 |
| 180 | Ga0207667_10275164 | 3300025949 | Bacteria | 1721 |
| 181 | Ga0207667_10998194 | 3300025949 | Bacteria | 824 |
| 182 | Ga0207651_10526728 | 3300025960 | Bacteria | 1025 |
| 183 | Ga0207712_10282869 | 3300025961 | Bacteria | 1354 |
| 184 | Ga0207668_10012227 | 3300025972 | Bacteria | 5248 |
| 185 | Ga0207668_10371566 | 3300025972 | Bacteria | 1201 |
| 186 | Ga0207640_10430808 | 3300025981 | Bacteria | 1082 |
| 187 | Ga0207640_10602072 | 3300025981 | Bacteria | 930 |
| 188 | Ga0207658_10554848 | 3300025986 | Bacteria | 1028 |
| 189 | Ga0207658_10634475 | 3300025986 | Bacteria | 962 |
| 190 | Ga0207677_11069810 | 3300026023 | Bacteria | 734 |
| 191 | Ga0207639_10629666 | 3300026041 | Bacteria | 991 |
| 192 | Ga0207639_10956333 | 3300026041 | Bacteria | 802 |
| 193 | Ga0207678_10030523 | 3300026067 | Bacteria | 4705 |
| 194 | Ga0207678_10104496 | 3300026067 | Bacteria | 2417 |
| 195 | Ga0207702_11079761 | 3300026078 | Bacteria | 796 |
| 196 | Ga0207702_11339239 | 3300026078 | Bacteria | 710 |
| 197 | Ga0207702_12362902 | 3300026078 | Bacteria | 519 |
| 198 | Ga0207641_10282074 | 3300026088 | Bacteria | 1563 |
| 199 | Ga0207648_10108970 | 3300026089 | Bacteria | 2431 |
| 200 | Ga0207676_10889509 | 3300026095 | Bacteria | 873 |
| 201 | Ga0207674_10067482 | 3300026116 | Bacteria | 3601 |
| 202 | Ga0207674_11870415 | 3300026116 | Bacteria | 567 |
| 203 | Ga0207675_100200838 | 3300026118 | Bacteria | 1915 |
| 204 | Ga0207683_11416773 | 3300026121 | Bacteria | 642 |
| 205 | Ga0207698_10869897 | 3300026142 | Bacteria | 907 |
| 206 | Ga0209389_1000019 | 3300027296 | Bacteria | 172067 |
| 207 | Ga0209389_1000070 | 3300027296 | Bacteria | 97498 |
| 208 | Ga0209589_1000420 | 3300027357 | Bacteria | 58471 |
| 209 | Ga0209489_100033 | 3300027361 | Bacteria | 172166 |
| 210 | Ga0209489_100196 | 3300027361 | Bacteria | 97498 |
| 211 | Ga0209700_100012 | 3300027363 | Bacteria | 357892 |
| 212 | Ga0209813_10201060 | 3300027866 | Bacteria | 737 |
| 213 | Ga0268266_10024242 | 3300028379 | Bacteria | 5163 |
| 214 | Ga0268266_10387501 | 3300028379 | Bacteria | 1319 |
| 215 | Ga0268266_10634165 | 3300028379 | Bacteria | 1028 |
| 216 | Ga0268266_10772365 | 3300028379 | Bacteria | 928 |
| 217 | Ga0268264_10616814 | 3300028381 | Bacteria | 1070 |
| 218 | Ga0268264_11015220 | 3300028381 | Bacteria | 836 |
| 219 | Ga0307517_10265645 | 3300028786 | Bacteria | 992 |
| 220 | Ga0307517_10507948 | 3300028786 | Bacteria | 612 |
| 221 | Ga0307514_10384114 | 3300031649 | Bacteria | 727 |
| 222 | Ga0307518_10495474 | 3300031838 | Bacteria | 632 |
| 223 | Ga0307510_10041777 | 3300033180 | Bacteria | 5007 |
| 224 | Ga0373955_0315359 | 3300035172 | Bacteria | 944 |
| 225 | Ga0373925_1332378 | 3300037068 | Bacteria | 589 |
| 226 | Ga0395900_1342861 | 3300037418 | Bacteria | 628 |
| 227 | Ga0395900_1343237 | 3300037418 | Bacteria | 628 |
| 228 | Ga0395898_0441828 | 3300037466 | Bacteria | 1239 |
| 229 | Ga0395898_1533097 | 3300037466 | Bacteria | 592 |
| 230 | Ga0395905_0018783 | 3300037471 | Bacteria | 6557 |
| 231 | Ga0395905_0241355 | 3300037471 | Bacteria | 1688 |
| 232 | Ga0395901_0390143 | 3300038443 | Bacteria | 1432 |
| 233 | Ga0395901_0561011 | 3300038443 | Bacteria | 1156 |
| 234 | Ga0436365_0155674 | 3300039437 | Bacteria | 1517 |
| 235 | Ga0451791_1228850 | 3300041451 | Bacteria | 796 |
| 236 | Ga0451793_0789318 | 3300041452 | Bacteria | 688 |
| 237 | Ga0451795_1357315 | 3300041456 | Bacteria | 697 |
| 238 | Ga0451855_0383189 | 3300041511 | Bacteria | 634 |
| 239 | Ga0466969_0054869 | 3300044656 | Bacteria | 1951 |
| 240 | Ga0466969_0445598 | 3300044656 | Bacteria | 589 |
| 241 | Ga0466972_0000164 | 3300044658 | Bacteria | 53019 |
| 242 | Ga0466965_0398158 | 3300044683 | Bacteria | 760 |
| 243 | Ga0466966_0014160 | 3300044684 | Bacteria | 5279 |
| 244 | Ga0466961_0000192 | 3300044693 | Bacteria | 40922 |
| 245 | Ga0466961_0282067 | 3300044693 | Bacteria | 1016 |
| 246 | Ga0466964_0045199 | 3300044706 | Bacteria | 1792 |
| 247 | Ga0466964_0201760 | 3300044706 | Bacteria | 955 |
| 248 | Ga0466968_0140997 | 3300044735 | Bacteria | 1102 |
| 249 | Ga0466968_0159236 | 3300044735 | Bacteria | 1041 |
| 250 | Ga0466970_0535379 | 3300044765 | Bacteria | 676 |
| 251 | Ga0466957_0406393 | 3300044842 | Bacteria | 932 |
| 252 | Ga0466957_0883604 | 3300044842 | Bacteria | 638 |
| 253 | Ga0466960_0158421 | 3300044901 | Bacteria | 1214 |
| 254 | Ga0466960_0647438 | 3300044901 | Bacteria | 630 |
| 255 | Ga0466959_0001746 | 3300045049 | Bacteria | 13533 |
| 256 | Ga0466959_0917015 | 3300045049 | Bacteria | 584 |
| 257 | Ga0495592_0119356 | 3300046454 | Bacteria | 1857 |
| 258 | Ga0495603_0126422 | 3300046455 | Bacteria | 1490 |
| 259 | Ga0495629_0001707 | 3300046459 | Bacteria | 17243 |
| 260 | Ga0495629_0142373 | 3300046459 | Bacteria | 1668 |
| 261 | Ga0495638_0002914 | 3300046460 | Bacteria | 13661 |
| 262 | Ga0495651_0206029 | 3300046462 | Bacteria | 1372 |
| 263 | Ga0495651_0603158 | 3300046462 | Bacteria | 692 |
| 264 | Ga0495650_0289871 | 3300046471 | Bacteria | 550 |
| 265 | Ga0495664_0032082 | 3300046477 | Bacteria | 3081 |
| 266 | Ga0495584_0325117 | 3300046491 | Bacteria | 781 |
| 267 | Ga0495584_0600489 | 3300046491 | Bacteria | 561 |
| 268 | Ga0495594_0373774 | 3300046499 | Bacteria | 811 |
| 269 | Ga0495596_0126695 | 3300046500 | Bacteria | 991 |
| 270 | Ga0495607_0152613 | 3300046501 | Bacteria | 1181 |
| 271 | Ga0495583_0058651 | 3300046506 | Bacteria | 1727 |
| 272 | Ga0495608_0048816 | 3300046511 | Bacteria | 2811 |
| 273 | Ga0495608_0077661 | 3300046511 | Bacteria | 2161 |
| 274 | Ga0495610_0090607 | 3300046512 | Bacteria | 1387 |
| 275 | Ga0495610_0117849 | 3300046512 | Bacteria | 1168 |
| 276 | Ga0495616_0051067 | 3300046513 | Bacteria | 2064 |
| 277 | Ga0495618_0527056 | 3300046514 | Bacteria | 710 |
| 278 | Ga0495620_0394609 | 3300046515 | Bacteria | 524 |
| 279 | Ga0495628_0241630 | 3300046516 | Bacteria | 1351 |
| 280 | Ga0495628_0323782 | 3300046516 | Bacteria | 1137 |
| 281 | Ga0495631_0046126 | 3300046518 | Bacteria | 1917 |
| 282 | Ga0495632_0104426 | 3300046519 | Bacteria | 1334 |
| 283 | Ga0495643_0062869 | 3300046522 | Bacteria | 1964 |
| 284 | Ga0495643_0287615 | 3300046522 | Bacteria | 754 |
| 285 | Ga0495648_0069673 | 3300046524 | Bacteria | 2046 |
| 286 | Ga0495648_0082457 | 3300046524 | Bacteria | 1825 |
| 287 | Ga0495648_0095469 | 3300046524 | Bacteria | 1654 |
| 288 | Ga0495648_0172513 | 3300046524 | Bacteria | 1107 |
| 289 | Ga0495648_0406231 | 3300046524 | Bacteria | 607 |
| 290 | Ga0495652_0010890 | 3300046529 | Bacteria | 8239 |
| 291 | Ga0495652_0112153 | 3300046529 | Bacteria | 2191 |
| 292 | Ga0495640_0055223 | 3300046533 | Bacteria | 2717 |
| 293 | Ga0495587_0014879 | 3300046536 | Bacteria | 4868 |
| 294 | Ga0495587_0227592 | 3300046536 | Bacteria | 1051 |
| 295 | Ga0495609_0123178 | 3300046538 | Bacteria | 1114 |
| 296 | Ga0495645_0027684 | 3300046543 | Bacteria | 4118 |
| 297 | Ga0495622_0019727 | 3300046557 | Bacteria | 3139 |
| 298 | Ga0495622_0122756 | 3300046557 | Bacteria | 1185 |
| 299 | Ga0495622_0164094 | 3300046557 | Bacteria | 1001 |
| 300 | Ga0495667_0346667 | 3300046559 | Bacteria | 938 |
| 301 | Ga0495656_0180364 | 3300046615 | Bacteria | 1038 |
| 302 | Ga0495668_0047332 | 3300046616 | Bacteria | 2388 |
| 303 | Ga0495668_0491180 | 3300046616 | Bacteria | 676 |
| 304 | Ga0495668_0618151 | 3300046616 | Bacteria | 599 |
| 305 | Ga0495634_0025688 | 3300046642 | Bacteria | 4115 |
| 306 | Ga0495634_0194523 | 3300046642 | Bacteria | 1263 |
| 307 | Ga0495611_0147139 | 3300046648 | Bacteria | 1100 |
| 308 | Ga0495611_0527773 | 3300046648 | Bacteria | 535 |
| 309 | Ga0495625_0089623 | 3300046660 | Bacteria | 2129 |
| 310 | Ga0495625_0186644 | 3300046660 | Bacteria | 1376 |
| 311 | Ga0495625_0384117 | 3300046660 | Bacteria | 880 |
| 312 | Ga0495625_0817288 | 3300046660 | Bacteria | 541 |
| 313 | Ga0495635_0010392 | 3300046663 | Bacteria | 6510 |
| 314 | Ga0495635_0022586 | 3300046663 | Bacteria | 4384 |
| 315 | Ga0495635_0565216 | 3300046663 | Bacteria | 745 |
| 316 | Ga0495588_0152274 | 3300046674 | Bacteria | 1222 |
| 317 | Ga0495657_0032748 | 3300046675 | Bacteria | 3625 |
| 318 | Ga0495657_0044954 | 3300046675 | Bacteria | 2999 |
| 319 | Ga0495599_0838272 | 3300046678 | Bacteria | 524 |
| 320 | Ga0495623_0009655 | 3300046679 | Bacteria | 6265 |
| 321 | Ga0495646_0014215 | 3300046680 | Bacteria | 5062 |
| 322 | Ga0495646_0170562 | 3300046680 | Bacteria | 1199 |
| 323 | Ga0495646_0265369 | 3300046680 | Bacteria | 916 |
| 324 | Ga0495669_0258742 | 3300046684 | Bacteria | 836 |
| 325 | Ga0495613_0060249 | 3300046689 | Bacteria | 2781 |
| 326 | Ga0495613_0674977 | 3300046689 | Bacteria | 682 |
| 327 | Ga0495624_0252542 | 3300046690 | Bacteria | 1066 |
| 328 | Ga0495624_0943187 | 3300046690 | Bacteria | 507 |
| 329 | Ga0495649_0023774 | 3300046694 | Bacteria | 3422 |
| 330 | Ga0495649_0150434 | 3300046694 | Bacteria | 1223 |
| 331 | Ga0495649_0162324 | 3300046694 | Bacteria | 1171 |
| 332 | Ga0495649_0490582 | 3300046694 | Bacteria | 611 |
| 333 | Ga0495600_0005782 | 3300046809 | Bacteria | 7472 |
| 334 | Ga0495600_0116881 | 3300046809 | Bacteria | 1736 |
| 335 | Ga0495660_0277363 | 3300046810 | Bacteria | 768 |
| 336 | Ga0495581_0032716 | 3300047315 | Bacteria | 3011 |
| 337 | Ga0495581_0174821 | 3300047315 | Bacteria | 1256 |
| 338 | Ga0495604_0005334 | 3300047317 | Bacteria | 10192 |
| 339 | Ga0495604_0075794 | 3300047317 | Bacteria | 2531 |
| 340 | Ga0495674_0368598 | 3300047319 | Bacteria | 1163 |
| 341 | Ga0495676_0099913 | 3300047321 | Bacteria | 2149 |
| 342 | Ga0495680_0005028 | 3300047322 | Bacteria | 12500 |
| 343 | Ga0495683_0144977 | 3300047323 | Bacteria | 1110 |
| 344 | Ga0495683_0272745 | 3300047323 | Bacteria | 735 |
| 345 | Ga0495683_0312483 | 3300047323 | Bacteria | 672 |
| 346 | Ga0495687_103364 | 3300047443 | Bacteria | 1063 |
| 347 | Ga0495675_0059833 | 3300047444 | Bacteria | 2415 |
| 348 | Ga0495677_0152295 | 3300047445 | Bacteria | 891 |
| 349 | Ga0495679_090769 | 3300047446 | Bacteria | 857 |
| 350 | Ga0495673_0047286 | 3300047469 | Bacteria | 1902 |
| 351 | Ga0495673_0095356 | 3300047469 | Bacteria | 1210 |
| 352 | Ga0495673_0144217 | 3300047469 | Bacteria | 926 |
| 353 | Ga0495686_0070363 | 3300047472 | Bacteria | 2156 |
| 354 | Ga0495686_0127153 | 3300047472 | Bacteria | 1514 |
| 355 | Ga0495686_0657987 | 3300047472 | Bacteria | 538 |
| 356 | Ga0495602_0034441 | 3300048088 | Bacteria | 4737 |
| 357 | Ga0495602_0072394 | 3300048088 | Bacteria | 2939 |
| 358 | Ga0495614_0202802 | 3300048089 | Bacteria | 898 |
| 359 | Ga0496100_0353934 | 3300048903 | Bacteria | 1109 |
| 360 | Ga0496100_0941517 | 3300048903 | Bacteria | 679 |
| 361 | Ga0496100_1555729 | 3300048903 | Bacteria | 522 |
| 362 | Ga0496101_0488726 | 3300048904 | Bacteria | 972 |
| 363 | Ga0496101_0583051 | 3300048904 | Bacteria | 884 |
| 364 | Ga0496102_0187141 | 3300048905 | Bacteria | 1951 |
| 365 | Ga0496102_0605818 | 3300048905 | Bacteria | 1018 |
| 366 | Ga0496102_1133081 | 3300048905 | Bacteria | 702 |
| 367 | Ga0496102_1407633 | 3300048905 | Bacteria | 616 |
| 368 | Ga0496103_0107292 | 3300048906 | Bacteria | 1771 |
| 369 | Ga0496103_0205310 | 3300048906 | Bacteria | 1267 |
| 370 | Ga0496104_0003677 | 3300048907 | Bacteria | 13247 |
| 371 | Ga0496104_0030189 | 3300048907 | Bacteria | 5035 |
| 372 | Ga0496104_0306551 | 3300048907 | Bacteria | 1500 |
| 373 | Ga0496104_0395247 | 3300048907 | Bacteria | 1295 |
| 374 | Ga0496105_0002470 | 3300048908 | Bacteria | 13380 |
| 375 | Ga0496105_0019150 | 3300048908 | Bacteria | 5518 |
| 376 | Ga0496105_0187699 | 3300048908 | Bacteria | 1691 |
| 377 | Ga0496106_0022614 | 3300048909 | Bacteria | 4673 |
| 378 | Ga0496107_0166917 | 3300048910 | Bacteria | 1632 |
| 379 | Ga0496107_0228698 | 3300048910 | Bacteria | 1384 |
| 380 | Ga0496108_0187449 | 3300048911 | Bacteria | 1792 |
| 381 | Ga0496108_1056783 | 3300048911 | Bacteria | 691 |
| 382 | Ga0496109_0762904 | 3300048912 | Bacteria | 905 |
| 383 | Ga0496110_0130025 | 3300048913 | Bacteria | 2273 |
| 384 | Ga0496110_0250526 | 3300048913 | Bacteria | 1612 |
| 385 | Ga0496110_0906588 | 3300048913 | Bacteria | 788 |
| 386 | Ga0496111_0057391 | 3300048914 | Bacteria | 2819 |
| 387 | Ga0496111_0345875 | 3300048914 | Bacteria | 1101 |
| 388 | Ga0496112_0213724 | 3300048915 | Bacteria | 1885 |
| 389 | Ga0496112_0831973 | 3300048915 | Bacteria | 847 |
| 390 | Ga0496112_1323830 | 3300048915 | Bacteria | 636 |
| 391 | Ga0496112_1585927 | 3300048915 | Bacteria | 568 |
| 392 | Ga0496113_0011865 | 3300048916 | Bacteria | 5839 |
| 393 | Ga0496113_0243138 | 3300048916 | Bacteria | 1436 |
| 394 | Ga0496113_0559148 | 3300048916 | Bacteria | 917 |
| 395 | Ga0496114_0083788 | 3300048917 | Bacteria | 2698 |
| 396 | Ga0496115_0166200 | 3300048918 | Bacteria | 1824 |
| 397 | Ga0496115_0243406 | 3300048918 | Bacteria | 1482 |
| 398 | Ga0496115_0514257 | 3300048918 | Bacteria | 961 |
| 399 | Ga0496116_0022320 | 3300048919 | Bacteria | 4746 |
| 400 | Ga0496117_0231363 | 3300048920 | Bacteria | 1021 |
| 401 | Ga0496117_0252770 | 3300048920 | Bacteria | 960 |
| 402 | Ga0496117_0321731 | 3300048920 | Bacteria | 810 |
| 403 | Ga0496118_0043083 | 3300048921 | Bacteria | 3553 |
| 404 | Ga0496118_0099141 | 3300048921 | Bacteria | 1976 |
| 405 | Ga0496118_0110487 | 3300048921 | Bacteria | 1826 |
| 406 | Ga0496118_0132729 | 3300048921 | Bacteria | 1595 |
| 407 | Ga0496119_0068166 | 3300048922 | Bacteria | 2095 |
| 408 | Ga0496119_0225577 | 3300048922 | Bacteria | 956 |
| 409 | Ga0496119_0250808 | 3300048922 | Bacteria | 892 |
| 410 | Ga0496120_0044017 | 3300048923 | Bacteria | 2596 |
| 411 | Ga0496120_0061207 | 3300048923 | Bacteria | 2102 |
| 412 | Ga0496121_0016155 | 3300048924 | Bacteria | 7731 |
| 413 | Ga0496121_0119729 | 3300048924 | Bacteria | 1990 |
| 414 | Ga0496121_0184663 | 3300048924 | Bacteria | 1501 |
| 415 | Ga0496122_0157772 | 3300048925 | Bacteria | 1389 |
| 416 | Ga0496122_0323860 | 3300048925 | Bacteria | 818 |
| 417 | Ga0496123_0130413 | 3300048926 | Bacteria | 1394 |
| 418 | Ga0496124_0126828 | 3300048927 | Bacteria | 2032 |
| 419 | Ga0496124_0335407 | 3300048927 | Bacteria | 1076 |
| 420 | Ga0496124_0944911 | 3300048927 | Bacteria | 519 |
| 421 | Ga0496125_0039775 | 3300048928 | Bacteria | 4043 |
| 422 | Ga0496125_0072747 | 3300048928 | Bacteria | 2677 |
| 423 | Ga0496125_0363644 | 3300048928 | Bacteria | 859 |
| 424 | Ga0496126_0014768 | 3300048929 | Bacteria | 7878 |
| 425 | Ga0496126_0097252 | 3300048929 | Bacteria | 2580 |
| 426 | Ga0496126_0389602 | 3300048929 | Bacteria | 1132 |
| 427 | Ga0496126_0616610 | 3300048929 | Bacteria | 853 |
| 428 | Ga0496126_0696238 | 3300048929 | Bacteria | 790 |
| 429 | Ga0495682_0309956 | 3300049460 | Bacteria | 557 |
| 430 | nmdc:mga03n38_291688_c1 | 3300050490 | Bacteria | 874 |
| 431 | nmdc:mga00v17_124473_c1 | 3300050491 | Bacteria | 1644 |
| 432 | nmdc:mga0k408_104431_c1 | 3300050493 | Bacteria | 1672 |
| 433 | nmdc:mga06z11_140137_c1 | 3300050494 | Bacteria | 1366 |
| 434 | nmdc:mga04h51_392865_c1 | 3300050495 | Bacteria | 580 |
| 435 | nmdc:mga07m45_33230_c1 | 3300050496 | Bacteria | 2864 |
| 436 | nmdc:mga0sz30_36479_c1 | 3300050516 | Bacteria | 2055 |
| 437 | nmdc:mga0sz30_41348_c1 | 3300050516 | Bacteria | 1938 |
| 438 | nmdc:mga0sz30_501879_c1 | 3300050516 | Bacteria | 546 |
| 439 | nmdc:mga0sz30_61091_c1 | 3300050516 | Bacteria | 1610 |
| 440 | Ga0500610_0267602 | 3300053079 | Bacteria | 776 |
| 441 | Ga0500635_0056317 | 3300053080 | Bacteria | 1360 |
| 442 | Ga0495619_0089308 | 3300053085 | Bacteria | 2085 |
| 443 | Ga0500578_0439047 | 3300053086 | Bacteria | 745 |
| 444 | Ga0500644_0076519 | 3300053088 | Bacteria | 1220 |
| 445 | Ga0500644_0255536 | 3300053088 | Bacteria | 740 |
| 446 | Ga0500581_303976 | 3300053089 | Bacteria | 633 |
| 447 | Ga0500583_0152953 | 3300053092 | Bacteria | 1148 |
| 448 | Ga0500651_0100618 | 3300053093 | Bacteria | 1772 |
| 449 | Ga0500651_0176557 | 3300053093 | Bacteria | 1270 |
| 450 | Ga0500651_0776676 | 3300053093 | Bacteria | 507 |
| 451 | Ga0500566_0001157 | 3300053094 | Bacteria | 15353 |
| 452 | Ga0500566_0475490 | 3300053094 | Bacteria | 542 |
| 453 | Ga0500640_046441 | 3300053095 | Bacteria | 1903 |
| 454 | Ga0500641_0044627 | 3300053096 | Bacteria | 1803 |
| 455 | Ga0500650_0077286 | 3300053098 | Bacteria | 1556 |
| 456 | Ga0500554_137853 | 3300053102 | Bacteria | 825 |
| 457 | Ga0500555_006517 | 3300053103 | Bacteria | 3318 |
| 458 | Ga0500556_0170963 | 3300053104 | Bacteria | 858 |
| 459 | Ga0500557_000077 | 3300053105 | Bacteria | 36950 |
| 460 | Ga0500562_008443 | 3300053108 | Bacteria | 2602 |
| 461 | Ga0500569_004124 | 3300053109 | Bacteria | 3032 |
| 462 | Ga0500569_026426 | 3300053109 | Bacteria | 1591 |
| 463 | Ga0500569_068209 | 3300053109 | Bacteria | 1114 |
| 464 | Ga0500572_014786 | 3300053111 | Bacteria | 1956 |
| 465 | Ga0500592_002785 | 3300053116 | Bacteria | 2815 |
| 466 | Ga0500594_0020657 | 3300053118 | Bacteria | 1645 |
| 467 | Ga0500595_015814 | 3300053119 | Bacteria | 2824 |
| 468 | Ga0500607_004790 | 3300053121 | Bacteria | 9129 |
| 469 | Ga0500608_030363 | 3300053122 | Bacteria | 2561 |
| 470 | Ga0500614_076344 | 3300053123 | Bacteria | 929 |
| 471 | Ga0500618_069291 | 3300053125 | Bacteria | 792 |
| 472 | Ga0500621_126379 | 3300053126 | Bacteria | 985 |
| 473 | Ga0500621_281479 | 3300053126 | Bacteria | 542 |
| 474 | Ga0500642_0000155 | 3300053130 | Bacteria | 28326 |
| 475 | Ga0500642_0135231 | 3300053130 | Bacteria | 1155 |
| 476 | Ga0500642_0242264 | 3300053130 | Bacteria | 830 |
| 477 | Ga0500655_052853 | 3300053133 | Bacteria | 811 |
| 478 | Ga0500559_0565957 | 3300053136 | Bacteria | 517 |
| 479 | Ga0500564_066019 | 3300053138 | Bacteria | 1636 |
| 480 | Ga0500568_0044530 | 3300053139 | Bacteria | 1769 |
| 481 | Ga0500577_0019365 | 3300053142 | Bacteria | 2206 |
| 482 | Ga0500577_0521209 | 3300053142 | Bacteria | 519 |
| 483 | Ga0500590_086798 | 3300053148 | Bacteria | 1525 |
| 484 | Ga0500590_156074 | 3300053148 | Bacteria | 1023 |
| 485 | Ga0500604_0069147 | 3300053151 | Bacteria | 1123 |
| 486 | Ga0500616_0063545 | 3300053153 | Bacteria | 1903 |
| 487 | Ga0500619_029933 | 3300053154 | Bacteria | 1650 |
| 488 | Ga0500620_010398 | 3300053155 | Bacteria | 2447 |
| 489 | Ga0500622_0118755 | 3300053156 | Bacteria | 1284 |
| 490 | Ga0500624_039880 | 3300053157 | Bacteria | 840 |
| 491 | Ga0500638_100272 | 3300053162 | Bacteria | 1351 |
| 492 | Ga0500639_213906 | 3300053163 | Bacteria | 813 |
| 493 | Ga0500639_241396 | 3300053163 | Bacteria | 733 |
| 494 | Ga0500636_0001310 | 3300053177 | Bacteria | 13513 |
| 495 | Ga0500636_0134832 | 3300053177 | Bacteria | 1372 |
| 496 | Ga0500636_0237708 | 3300053177 | Bacteria | 938 |
| 497 | Ga0500636_0346578 | 3300053177 | Bacteria | 711 |
| 498 | Ga0500636_0453516 | 3300053177 | Bacteria | 579 |
| 499 | Ga0500567_219284 | 3300053723 | Bacteria | 607 |
| 500 | Ga0500611_150551 | 3300053727 | Bacteria | 639 |
| 501 | Ga0500625_007389 | 3300053729 | Bacteria | 4775 |
| 502 | Ga0500645_047532 | 3300053730 | Bacteria | 1257 |
| 503 | Ga0500552_075557 | 3300053733 | Bacteria | 611 |
| 504 | Ga0500596_016223 | 3300053735 | Bacteria | 1120 |
| 505 | Ga0500599_001988 | 3300053736 | Bacteria | 2415 |
| 506 | Ga0500601_000314 | 3300053737 | Bacteria | 9035 |
| 507 | Ga0500601_015180 | 3300053737 | Bacteria | 875 |
| 508 | Ga0500661_014216 | 3300055283 | Bacteria | 1432 |
| 509 | Ga0587093_052242 | 3300059478 | Bacteria | 648 |
| 510 | Ga0587066_097843 | 3300059490 | Bacteria | 662 |
| 511 | Ga0587070_115134 | 3300059491 | Bacteria | 636 |
| 512 | Ga0587073_0145057 | 3300059492 | Bacteria | 666 |
| 513 | Ga0587080_045827 | 3300059503 | Bacteria | 811 |
| 514 | Ga0587082_064362 | 3300059504 | Bacteria | 730 |
| 515 | Ga0587082_168595 | 3300059504 | Bacteria | 529 |
| 516 | Ga0587083_0225278 | 3300059505 | Bacteria | 547 |
| 517 | Ga0587086_044381 | 3300059507 | Bacteria | 698 |
| 518 | Ga0587090_054994 | 3300059510 | Bacteria | 740 |
| 519 | Ga0587091_108242 | 3300059511 | Bacteria | 660 |
| 520 | Ga0587092_083691 | 3300059512 | Bacteria | 634 |
| 521 | Ga0587101_043075 | 3300059623 | Bacteria | 752 |
| 522 | Ga0587115_051878 | 3300059626 | Bacteria | 668 |
| 523 | Ga0587117_050154 | 3300059627 | Bacteria | 690 |
| 524 | Ga0587068_088866 | 3300059641 | Bacteria | 634 |
| 525 | Ga0587075_104449 | 3300059644 | Bacteria | 569 |
| 526 | Ga0587076_070915 | 3300059645 | Bacteria | 723 |
| 527 | Ga0587078_038655 | 3300059646 | Bacteria | 668 |
| 528 | Ga0587071_162926 | 3300060344 | Bacteria | 562 |
| 529 | Ga0587111_0258873 | 3300060346 | Bacteria | 518 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2511231028 | 2511395777 | 72 |
| 2 | iso_pu_bacteria | 2513237094 | 2513643285 | 72 |
| 3 | iso_pu_bacteria | 2513237095 | 2513651075 | 72 |
| 4 | iso_pu_bacteria | 2515154112 | 2515624690 | 72 |
| 5 | iso_pu_bacteria | 2517093001 | 2517104372 | 72 |
| 6 | iso_pu_bacteria | 2524023205 | 2524438340 | 72 |
| 7 | iso_pu_bacteria | 2528768022 | 2528854658 | 72 |
| 8 | iso_pu_bacteria | 2617270735 | 2617349650 | 72 |
| 9 | iso_pu_bacteria | 2744054633 | 2745078512 | 72 |
| 10 | iso_pu_bacteria | 2791355196 | 2793059611 | 72 |
| 11 | iso_pu_bacteria | 2816332527 | 2818242209 | 72 |
| 12 | iso_pu_bacteria | 2824661429 | 2824669952 | 72 |
| 13 | iso_pu_bacteria | 2824773399 | 2824776969 | 72 |
| 14 | iso_pu_bacteria | 2841957949 | 2841960938 | 72 |
| 15 | iso_pu_bacteria | 2844315083 | 2844321113 | 72 |
| 16 | iso_pu_bacteria | 2874590934 | 2874592278 | 72 |
| 17 | iso_pu_bacteria | 2874628541 | 2874630958 | 72 |
| 18 | iso_pu_bacteria | 2874645413 | 2874647394 | 72 |
| 19 | iso_pu_bacteria | 2876761206 | 2876767440 | 72 |
| 20 | iso_pu_bacteria | 2876771140 | 2876774805 | 72 |
| 21 | iso_pu_bacteria | 2876818435 | 2876819758 | 72 |
| 22 | iso_pu_bacteria | 2879074833 | 2879079373 | 72 |
| 23 | iso_pu_bacteria | 2879099564 | 2879101377 | 72 |
| 24 | iso_pu_bacteria | 2879127579 | 2879129106 | 72 |
| 25 | iso_pu_bacteria | 2879142872 | 2879144739 | 72 |
| 26 | iso_pu_bacteria | 2885366525 | 2885374041 | 72 |
| 27 | iso_pu_bacteria | 2888378607 | 2888387407 | 72 |
| 28 | iso_pu_bacteria | 2888388044 | 2888391792 | 72 |
| 29 | iso_pu_bacteria | 2903727486 | 2903728536 | 72 |
| 30 | iso_pu_bacteria | 2906602504 | 2906607728 | 72 |
| 31 | iso_pu_bacteria | 2906626472 | 2906627096 | 72 |
| 32 | iso_pu_bacteria | 2922368715 | 2922370536 | 72 |
| 33 | iso_pu_bacteria | 2929615660 | 2929620113 | 72 |
| 34 | iso_pu_bacteria | 2929624759 | 2929629426 | 72 |
| 35 | iso_pu_bacteria | 2932784394 | 2932791468 | 72 |
| 36 | iso_pu_bacteria | 2932794094 | 2932796868 | 72 |
| 37 | iso_pu_bacteria | 2932801729 | 2932802351 | 72 |
| 38 | iso_pu_bacteria | 2932809354 | 2932816724 | 72 |
| 39 | iso_pu_bacteria | 2932818245 | 2932824094 | 72 |
| 40 | iso_pu_bacteria | 2932828146 | 2932835370 | 72 |
| 41 | iso_pu_bacteria | 2933577622 | 2933582030 | 72 |
| 42 | iso_pu_bacteria | 2935608549 | 2935613457 | 72 |
| 43 | iso_pu_bacteria | 2935616580 | 2935621113 | 72 |
| 44 | iso_pu_bacteria | 2935638405 | 2935643580 | 72 |
| 45 | iso_pu_bacteria | 2935665750 | 2935671110 | 72 |
| 46 | iso_pu_bacteria | 2935675223 | 2935681284 | 72 |
| 47 | iso_pu_bacteria | 2935684952 | 2935689373 | 72 |
| 48 | iso_pu_bacteria | 2935694250 | 2935699948 | 72 |
| 49 | iso_pu_bacteria | 2935703347 | 2935712121 | 72 |
| 50 | iso_pu_bacteria | 2935713505 | 2935720319 | 72 |
| 51 | iso_pu_bacteria | 2935722832 | 2935728064 | 72 |
| 52 | iso_pu_bacteria | 2935732158 | 2935737339 | 72 |
| 53 | iso_pu_bacteria | 2935741537 | 2935746600 | 72 |
| 54 | iso_pu_bacteria | 2935750917 | 2935757567 | 72 |
| 55 | iso_pu_bacteria | 2935760218 | 2935763944 | 72 |
| 56 | iso_pu_bacteria | 2935801545 | 2935807921 | 72 |
| 57 | iso_pu_bacteria | 2935810662 | 2935818745 | 72 |
| 58 | iso_pu_bacteria | 2935819856 | 2935824690 | 72 |
| 59 | iso_pu_bacteria | 2935827899 | 2935833097 | 72 |
| 60 | iso_pu_bacteria | 2935837841 | 2935844247 | 72 |
| 61 | iso_pu_bacteria | 2935847175 | 2935851910 | 72 |
| 62 | iso_pu_bacteria | 2935855204 | 2935859694 | 72 |
| 63 | iso_pu_bacteria | 2935864058 | 2935872092 | 72 |
| 64 | iso_pu_bacteria | 2935873716 | 2935878984 | 72 |
| 65 | iso_pu_bacteria | 2935883170 | 2935887210 | 72 |
| 66 | iso_pu_bacteria | 2935908558 | 2935911257 | 72 |
| 67 | iso_pu_bacteria | 2935916978 | 2935920789 | 72 |
| 68 | iso_pu_bacteria | 2935926038 | 2935928286 | 72 |
| 69 | iso_pu_bacteria | 2935934488 | 2935937931 | 72 |
| 70 | iso_pu_bacteria | 2935942939 | 2935945213 | 72 |
| 71 | iso_pu_bacteria | 2935951376 | 2935954281 | 72 |
| 72 | iso_pu_bacteria | 2935959822 | 2935965641 | 72 |
| 73 | iso_pu_bacteria | 2935967501 | 2935971451 | 72 |
| 74 | iso_pu_bacteria | 2935975950 | 2935982071 | 72 |
| 75 | iso_pu_bacteria | 2935992306 | 2936000331 | 72 |
| 76 | iso_pu_bacteria | 2936002035 | 2936008489 | 72 |
| 77 | iso_pu_bacteria | 2936037263 | 2936045555 | 72 |
| 78 | iso_pu_bacteria | 2940556831 | 2940563611 | 72 |
| 79 | iso_pu_bacteria | 2941531003 | 2941537290 | 72 |
| 80 | iso_pu_bacteria | 2941538514 | 2941542579 | 72 |
| 81 | iso_pu_bacteria | 3005506211 | 3005506886 | 72 |
| 82 | iso_pu_bacteria | 3005594810 | 3005601456 | 72 |
| 83 | iso_pu_bacteria | 3005718088 | 3005724145 | 72 |
| 84 | iso_pu_bacteria | 8016511872 | 8016519464 | 72 |
| 85 | iso_pu_bacteria | 8016583857 | 8016588664 | 72 |
| 86 | iso_pu_bacteria | 8017057580 | 8017066056 | 72 |
| 87 | iso_pu_bacteria | 8019576017 | 8019578578 | 72 |
| 88 | iso_pu_bacteria | 8019586578 | 8019596628 | 72 |
| 89 | iso_pu_bacteria | 8019597564 | 8019605076 | 72 |
| 90 | iso_pu_bacteria | 8019608314 | 8019613458 | 72 |
| 91 | iso_pu_bacteria | 8019619141 | 8019624129 | 72 |
| 92 | iso_pu_bacteria | 8019629233 | 8019637899 | 72 |
| 93 | iso_pu_bacteria | 8019638758 | 8019641726 | 72 |
| 94 | iso_pu_bacteria | 8019648815 | 8019653647 | 72 |
| 95 | iso_pu_bacteria | 8019659431 | 8019665828 | 72 |
| 96 | iso_pu_bacteria | 8019678201 | 8019680753 | 72 |
| 97 | iso_pu_bacteria | 8019687851 | 8019695016 | 72 |
| 98 | iso_pu_bacteria | 8055742211 | 8055750134 | 72 |
| 99 | iso_pu_bacteria | 8056967851 | 8056975912 | 72 |
| 100 | 3300039437 | Ga0436365_0155674 | Ga0436365_0155674_185_406 | 73 |
| 101 | 3300006944 | Ga0099823_1004804 | Ga0099823_10048047 | 74 |
| 102 | 3300027296 | Ga0209389_1000019 | Ga0209389_100001986 | 74 |
| 103 | 3300027361 | Ga0209489_100033 | Ga0209489_10003385 | 74 |
| 104 | 3300027363 | Ga0209700_100012 | Ga0209700_100012283 | 74 |
| 105 | 3300003354 | JGI25160J50197_1064565 | JGI25160J50197_10645652 | 75 |
| 106 | 3300005262 | Ga0065165_1009957 | Ga0065165_10099573 | 75 |
| 107 | 3300005844 | Ga0068862_101877961 | Ga0068862_1018779611 | 75 |
| 108 | 3300006178 | Ga0075367_10819545 | Ga0075367_108195451 | 75 |
| 109 | 3300006943 | Ga0099822_1054949 | Ga0099822_10549492 | 75 |
| 110 | 3300006944 | Ga0099823_1138967 | Ga0099823_11389672 | 75 |
| 111 | 3300021321 | Ga0214542_1000156 | Ga0214542_100015612 | 75 |
| 112 | 3300021324 | Ga0214545_1000078 | Ga0214545_100007898 | 75 |
| 113 | 3300021324 | Ga0214545_1014427 | Ga0214545_101442712 | 75 |
| 114 | 3300021327 | Ga0214543_1000136 | Ga0214543_100013698 | 75 |
| 115 | 3300021327 | Ga0214543_1037727 | Ga0214543_10377272 | 75 |
| 116 | 3300021327 | Ga0214543_1040129 | Ga0214543_10401292 | 75 |
| 117 | 3300021327 | Ga0214543_1041212 | Ga0214543_10412122 | 75 |
| 118 | 3300025302 | Ga0207426_1010981 | Ga0207426_10109813 | 75 |
| 119 | 3300026116 | Ga0207674_11870415 | Ga0207674_118704151 | 75 |
| 120 | 3300027296 | Ga0209389_1000070 | Ga0209389_1000070106 | 75 |
| 121 | 3300027357 | Ga0209589_1000420 | Ga0209589_100042062 | 75 |
| 122 | 3300027361 | Ga0209489_100196 | Ga0209489_1001966 | 75 |
| 123 | 3300037418 | Ga0395900_1342861 | Ga0395900_1342861_67_294 | 75 |
| 124 | 3300037466 | Ga0395898_1533097 | Ga0395898_1533097_10_237 | 75 |
| 125 | 3300038443 | Ga0395901_0561011 | Ga0395901_0561011_101_328 | 75 |
| 126 | 3300046512 | Ga0495610_0117849 | Ga0495610_0117849_660_887 | 75 |
| 127 | 3300046524 | Ga0495648_0406231 | Ga0495648_0406231_285_512 | 75 |
| 128 | 3300047469 | Ga0495673_0144217 | Ga0495673_0144217_332_559 | 75 |
| 129 | 3300048915 | Ga0496112_1585927 | Ga0496112_1585927_142_369 | 75 |
| 130 | 3300053105 | Ga0500557_000077 | Ga0500557_000077_16574_16801 | 75 |
| 131 | 3300053109 | Ga0500569_026426 | Ga0500569_026426_294_521 | 75 |
| 132 | 3300053130 | Ga0500642_0000155 | Ga0500642_0000155_11768_11995 | 75 |
| 133 | 3300053177 | Ga0500636_0134832 | Ga0500636_0134832_507_734 | 75 |
| 134 | 3300053729 | Ga0500625_007389 | Ga0500625_007389_2814_3041 | 75 |
| 135 | 3300053737 | Ga0500601_015180 | Ga0500601_015180_228_455 | 75 |
| 136 | 3300059512 | Ga0587092_083691 | Ga0587092_083691_126_353 | 75 |
| 137 | 3300003215 | JGI25153J46596_10006030 | JGI25153J46596_100060308 | 76 |
| 138 | 3300003215 | JGI25153J46596_10018982 | JGI25153J46596_100189822 | 76 |
| 139 | 3300003215 | JGI25153J46596_10052360 | JGI25153J46596_100523603 | 76 |
| 140 | 3300003354 | JGI25160J50197_1003029 | JGI25160J50197_10030293 | 76 |
| 141 | 3300003762 | Ga0055542_1012857 | Ga0055542_10128572 | 76 |
| 142 | 3300003763 | Ga0055529_1039578 | Ga0055529_10395781 | 76 |
| 143 | 3300003771 | Ga0055526_1057686 | Ga0055526_10576863 | 76 |
| 144 | 3300003794 | Ga0055531_10021797 | Ga0055531_100217972 | 76 |
| 145 | 3300004625 | Ga0055543_1008659 | Ga0055543_10086593 | 76 |
| 146 | 3300005262 | Ga0065165_1002424 | Ga0065165_10024242 | 76 |
| 147 | 3300005262 | Ga0065165_1023460 | Ga0065165_10234603 | 76 |
| 148 | 3300005331 | Ga0070670_100207073 | Ga0070670_1002070732 | 76 |
| 149 | 3300005334 | Ga0068869_100720895 | Ga0068869_1007208952 | 76 |
| 150 | 3300005335 | Ga0070666_10365929 | Ga0070666_103659292 | 76 |
| 151 | 3300005338 | Ga0068868_100112626 | Ga0068868_1001126263 | 76 |
| 152 | 3300005339 | Ga0070660_100467994 | Ga0070660_1004679942 | 76 |
| 153 | 3300005339 | Ga0070660_100703890 | Ga0070660_1007038901 | 76 |
| 154 | 3300005339 | Ga0070660_100849602 | Ga0070660_1008496022 | 76 |
| 155 | 3300005343 | Ga0070687_100667824 | Ga0070687_1006678242 | 76 |
| 156 | 3300005345 | Ga0070692_10264245 | Ga0070692_102642451 | 76 |
| 157 | 3300005347 | Ga0070668_100015332 | Ga0070668_1000153324 | 76 |
| 158 | 3300005347 | Ga0070668_100216243 | Ga0070668_1002162432 | 76 |
| 159 | 3300005353 | Ga0070669_100277883 | Ga0070669_1002778832 | 76 |
| 160 | 3300005354 | Ga0070675_100506108 | Ga0070675_1005061082 | 76 |
| 161 | 3300005356 | Ga0070674_100961833 | Ga0070674_1009618331 | 76 |
| 162 | 3300005364 | Ga0070673_100428666 | Ga0070673_1004286662 | 76 |
| 163 | 3300005366 | Ga0070659_100132663 | Ga0070659_1001326632 | 76 |
| 164 | 3300005366 | Ga0070659_100150624 | Ga0070659_1001506243 | 76 |
| 165 | 3300005366 | Ga0070659_100519274 | Ga0070659_1005192742 | 76 |
| 166 | 3300005455 | Ga0070663_100014841 | Ga0070663_1000148414 | 76 |
| 167 | 3300005455 | Ga0070663_100919636 | Ga0070663_1009196362 | 76 |
| 168 | 3300005456 | Ga0070678_101782809 | Ga0070678_1017828091 | 76 |
| 169 | 3300005457 | Ga0070662_100423962 | Ga0070662_1004239622 | 76 |
| 170 | 3300005457 | Ga0070662_101929831 | Ga0070662_1019298311 | 76 |
| 171 | 3300005459 | Ga0068867_100286053 | Ga0068867_1002860531 | 76 |
| 172 | 3300005466 | Ga0070685_11043523 | Ga0070685_110435231 | 76 |
| 173 | 3300005539 | Ga0068853_101112575 | Ga0068853_1011125751 | 76 |
| 174 | 3300005548 | Ga0070665_100457894 | Ga0070665_1004578942 | 76 |
| 175 | 3300005548 | Ga0070665_100777323 | Ga0070665_1007773232 | 76 |
| 176 | 3300005548 | Ga0070665_101780091 | Ga0070665_1017800912 | 76 |
| 177 | 3300005563 | Ga0068855_100329880 | Ga0068855_1003298803 | 76 |
| 178 | 3300005563 | Ga0068855_100588069 | Ga0068855_1005880693 | 76 |
| 179 | 3300005563 | Ga0068855_100878046 | Ga0068855_1008780461 | 76 |
| 180 | 3300005563 | Ga0068855_102460756 | Ga0068855_1024607562 | 76 |
| 181 | 3300005577 | Ga0068857_101491277 | Ga0068857_1014912771 | 76 |
| 182 | 3300005614 | Ga0068856_100315530 | Ga0068856_1003155302 | 76 |
| 183 | 3300005614 | Ga0068856_100396566 | Ga0068856_1003965662 | 76 |
| 184 | 3300005614 | Ga0068856_100589697 | Ga0068856_1005896973 | 76 |
| 185 | 3300005614 | Ga0068856_102213052 | Ga0068856_1022130522 | 76 |
| 186 | 3300005616 | Ga0068852_100215571 | Ga0068852_1002155712 | 76 |
| 187 | 3300005616 | Ga0068852_100491755 | Ga0068852_1004917552 | 76 |
| 188 | 3300005618 | Ga0068864_100289248 | Ga0068864_1002892483 | 76 |
| 189 | 3300005719 | Ga0068861_100332851 | Ga0068861_1003328512 | 76 |
| 190 | 3300005841 | Ga0068863_101126510 | Ga0068863_1011265101 | 76 |
| 191 | 3300005842 | Ga0068858_100411601 | Ga0068858_1004116011 | 76 |
| 192 | 3300005842 | Ga0068858_101807790 | Ga0068858_1018077902 | 76 |
| 193 | 3300005843 | Ga0068860_100179290 | Ga0068860_1001792902 | 76 |
| 194 | 3300005843 | Ga0068860_100929758 | Ga0068860_1009297582 | 76 |
| 195 | 3300006038 | Ga0075365_10271605 | Ga0075365_102716052 | 76 |
| 196 | 3300006042 | Ga0075368_10171309 | Ga0075368_101713092 | 76 |
| 197 | 3300006048 | Ga0075363_100092451 | Ga0075363_1000924512 | 76 |
| 198 | 3300006051 | Ga0075364_10050430 | Ga0075364_100504303 | 76 |
| 199 | 3300006051 | Ga0075364_10913167 | Ga0075364_109131672 | 76 |
| 200 | 3300006163 | Ga0070715_10694842 | Ga0070715_106948422 | 76 |
| 201 | 3300006178 | Ga0075367_10512155 | Ga0075367_105121552 | 76 |
| 202 | 3300006186 | Ga0075369_10038554 | Ga0075369_100385543 | 76 |
| 203 | 3300006186 | Ga0075369_10130781 | Ga0075369_101307812 | 76 |
| 204 | 3300006195 | Ga0075366_10407851 | Ga0075366_104078513 | 76 |
| 205 | 3300006353 | Ga0075370_10067526 | Ga0075370_100675262 | 76 |
| 206 | 3300006353 | Ga0075370_10095494 | Ga0075370_100954942 | 76 |
| 207 | 3300009093 | Ga0105240_10018456 | Ga0105240_100184568 | 76 |
| 208 | 3300009093 | Ga0105240_11060074 | Ga0105240_110600743 | 76 |
| 209 | 3300009098 | Ga0105245_10126664 | Ga0105245_101266643 | 76 |
| 210 | 3300009101 | Ga0105247_10052525 | Ga0105247_100525253 | 76 |
| 211 | 3300009101 | Ga0105247_10202978 | Ga0105247_102029782 | 76 |
| 212 | 3300009148 | Ga0105243_10539995 | Ga0105243_105399953 | 76 |
| 213 | 3300009148 | Ga0105243_10645868 | Ga0105243_106458681 | 76 |
| 214 | 3300009174 | Ga0105241_10091961 | Ga0105241_100919612 | 76 |
| 215 | 3300009174 | Ga0105241_10190745 | Ga0105241_101907454 | 76 |
| 216 | 3300009174 | Ga0105241_10380463 | Ga0105241_103804632 | 76 |
| 217 | 3300009176 | Ga0105242_10086081 | Ga0105242_100860812 | 76 |
| 218 | 3300009177 | Ga0105248_10245311 | Ga0105248_102453113 | 76 |
| 219 | 3300009177 | Ga0105248_11678652 | Ga0105248_116786521 | 76 |
| 220 | 3300009177 | Ga0105248_12194707 | Ga0105248_121947072 | 76 |
| 221 | 3300009545 | Ga0105237_10136563 | Ga0105237_101365632 | 76 |
| 222 | 3300009545 | Ga0105237_10227409 | Ga0105237_102274093 | 76 |
| 223 | 3300009545 | Ga0105237_10407573 | Ga0105237_104075732 | 76 |
| 224 | 3300009545 | Ga0105237_10539323 | Ga0105237_105393232 | 76 |
| 225 | 3300009553 | Ga0105249_10301776 | Ga0105249_103017763 | 76 |
| 226 | 3300010375 | Ga0105239_10146107 | Ga0105239_101461072 | 76 |
| 227 | 3300010375 | Ga0105239_10162243 | Ga0105239_101622432 | 76 |
| 228 | 3300010375 | Ga0105239_10239350 | Ga0105239_102393503 | 76 |
| 229 | 3300010375 | Ga0105239_10348601 | Ga0105239_103486013 | 76 |
| 230 | 3300010375 | Ga0105239_10436710 | Ga0105239_104367103 | 76 |
| 231 | 3300010375 | Ga0105239_10557099 | Ga0105239_105570992 | 76 |
| 232 | 3300011119 | Ga0105246_10300605 | Ga0105246_103006053 | 76 |
| 233 | 3300013104 | Ga0157370_10507641 | Ga0157370_105076412 | 76 |
| 234 | 3300013105 | Ga0157369_11171509 | Ga0157369_111715092 | 76 |
| 235 | 3300013296 | Ga0157374_11486668 | Ga0157374_114866682 | 76 |
| 236 | 3300013297 | Ga0157378_10712333 | Ga0157378_107123332 | 76 |
| 237 | 3300013308 | Ga0157375_10405651 | Ga0157375_104056512 | 76 |
| 238 | 3300014325 | Ga0163163_10133068 | Ga0163163_101330683 | 76 |
| 239 | 3300014325 | Ga0163163_10720929 | Ga0163163_107209292 | 76 |
| 240 | 3300014497 | Ga0182008_10310352 | Ga0182008_103103522 | 76 |
| 241 | 3300014745 | Ga0157377_10375108 | Ga0157377_103751081 | 76 |
| 242 | 3300014968 | Ga0157379_10267196 | Ga0157379_102671963 | 76 |
| 243 | 3300014968 | Ga0157379_11315654 | Ga0157379_113156542 | 76 |
| 244 | 3300014969 | Ga0157376_10181606 | Ga0157376_101816063 | 76 |
| 245 | 3300014969 | Ga0157376_10476849 | Ga0157376_104768492 | 76 |
| 246 | 3300014969 | Ga0157376_11853301 | Ga0157376_118533012 | 76 |
| 247 | 3300014969 | Ga0157376_12610770 | Ga0157376_126107702 | 76 |
| 248 | 3300015262 | Ga0182007_10171592 | Ga0182007_101715921 | 76 |
| 249 | 3300020078 | Ga0206352_10062491 | Ga0206352_100624912 | 76 |
| 250 | 3300025230 | Ga0209563_103076 | Ga0209563_1030762 | 76 |
| 251 | 3300025253 | Ga0209677_100991 | Ga0209677_1009919 | 76 |
| 252 | 3300025254 | Ga0209148_1000232 | Ga0209148_100023240 | 76 |
| 253 | 3300025261 | Ga0209233_1011852 | Ga0209233_10118523 | 76 |
| 254 | 3300025261 | Ga0209233_1041370 | Ga0209233_10413702 | 76 |
| 255 | 3300025272 | Ga0209455_1001882 | Ga0209455_10018824 | 76 |
| 256 | 3300025273 | Ga0209673_1027108 | Ga0209673_10271083 | 76 |
| 257 | 3300025295 | Ga0209564_1002450 | Ga0209564_100245014 | 76 |
| 258 | 3300025295 | Ga0209564_1017503 | Ga0209564_10175034 | 76 |
| 259 | 3300025297 | Ga0209758_1000705 | Ga0209758_10007052 | 76 |
| 260 | 3300025297 | Ga0209758_1000767 | Ga0209758_100076752 | 76 |
| 261 | 3300025297 | Ga0209758_1001616 | Ga0209758_10016166 | 76 |
| 262 | 3300025297 | Ga0209758_1008725 | Ga0209758_10087252 | 76 |
| 263 | 3300025297 | Ga0209758_1080863 | Ga0209758_10808633 | 76 |
| 264 | 3300025299 | Ga0209256_1001558 | Ga0209256_100155824 | 76 |
| 265 | 3300025299 | Ga0209256_1019224 | Ga0209256_10192242 | 76 |
| 266 | 3300025302 | Ga0207426_1000857 | Ga0207426_100085719 | 76 |
| 267 | 3300025302 | Ga0207426_1023543 | Ga0207426_10235433 | 76 |
| 268 | 3300025302 | Ga0207426_1090502 | Ga0207426_10905022 | 76 |
| 269 | 3300025303 | Ga0209051_1061776 | Ga0209051_10617763 | 76 |
| 270 | 3300025304 | Ga0209257_1001185 | Ga0209257_100118510 | 76 |
| 271 | 3300025304 | Ga0209257_1083795 | Ga0209257_10837952 | 76 |
| 272 | 3300025315 | Ga0207697_10185706 | Ga0207697_101857062 | 76 |
| 273 | 3300025900 | Ga0207710_10054902 | Ga0207710_100549023 | 76 |
| 274 | 3300025904 | Ga0207647_10058350 | Ga0207647_100583504 | 76 |
| 275 | 3300025911 | Ga0207654_10318178 | Ga0207654_103181783 | 76 |
| 276 | 3300025913 | Ga0207695_10000123 | Ga0207695_1000012336 | 76 |
| 277 | 3300025914 | Ga0207671_10003497 | Ga0207671_1000349719 | 76 |
| 278 | 3300025914 | Ga0207671_10311429 | Ga0207671_103114292 | 76 |
| 279 | 3300025915 | Ga0207693_10280504 | Ga0207693_102805042 | 76 |
| 280 | 3300025919 | Ga0207657_10392998 | Ga0207657_103929982 | 76 |
| 281 | 3300025919 | Ga0207657_10610136 | Ga0207657_106101362 | 76 |
| 282 | 3300025919 | Ga0207657_10947014 | Ga0207657_109470142 | 76 |
| 283 | 3300025920 | Ga0207649_10359417 | Ga0207649_103594172 | 76 |
| 284 | 3300025924 | Ga0207694_10572186 | Ga0207694_105721863 | 76 |
| 285 | 3300025925 | Ga0207650_10281801 | Ga0207650_102818012 | 76 |
| 286 | 3300025926 | Ga0207659_10512437 | Ga0207659_105124372 | 76 |
| 287 | 3300025927 | Ga0207687_10439877 | Ga0207687_104398772 | 76 |
| 288 | 3300025931 | Ga0207644_10083068 | Ga0207644_100830683 | 76 |
| 289 | 3300025931 | Ga0207644_10172008 | Ga0207644_101720083 | 76 |
| 290 | 3300025932 | Ga0207690_10067398 | Ga0207690_100673982 | 76 |
| 291 | 3300025933 | Ga0207706_10200570 | Ga0207706_102005702 | 76 |
| 292 | 3300025933 | Ga0207706_10501044 | Ga0207706_105010442 | 76 |
| 293 | 3300025933 | Ga0207706_11396665 | Ga0207706_113966652 | 76 |
| 294 | 3300025934 | Ga0207686_10537352 | Ga0207686_105373522 | 76 |
| 295 | 3300025935 | Ga0207709_10544111 | Ga0207709_105441112 | 76 |
| 296 | 3300025935 | Ga0207709_10578349 | Ga0207709_105783491 | 76 |
| 297 | 3300025941 | Ga0207711_10280878 | Ga0207711_102808782 | 76 |
| 298 | 3300025941 | Ga0207711_11879115 | Ga0207711_118791151 | 76 |
| 299 | 3300025942 | Ga0207689_10776870 | Ga0207689_107768702 | 76 |
| 300 | 3300025949 | Ga0207667_10156445 | Ga0207667_101564454 | 76 |
| 301 | 3300025949 | Ga0207667_10275164 | Ga0207667_102751643 | 76 |
| 302 | 3300025949 | Ga0207667_10998194 | Ga0207667_109981941 | 76 |
| 303 | 3300025960 | Ga0207651_10526728 | Ga0207651_105267282 | 76 |
| 304 | 3300025961 | Ga0207712_10282869 | Ga0207712_102828692 | 76 |
| 305 | 3300025972 | Ga0207668_10012227 | Ga0207668_100122274 | 76 |
| 306 | 3300025972 | Ga0207668_10371566 | Ga0207668_103715662 | 76 |
| 307 | 3300025981 | Ga0207640_10430808 | Ga0207640_104308082 | 76 |
| 308 | 3300025981 | Ga0207640_10602072 | Ga0207640_106020723 | 76 |
| 309 | 3300025986 | Ga0207658_10554848 | Ga0207658_105548482 | 76 |
| 310 | 3300025986 | Ga0207658_10634475 | Ga0207658_106344752 | 76 |
| 311 | 3300026023 | Ga0207677_11069810 | Ga0207677_110698102 | 76 |
| 312 | 3300026041 | Ga0207639_10629666 | Ga0207639_106296661 | 76 |
| 313 | 3300026041 | Ga0207639_10956333 | Ga0207639_109563331 | 76 |
| 314 | 3300026067 | Ga0207678_10030523 | Ga0207678_100305233 | 76 |
| 315 | 3300026067 | Ga0207678_10104496 | Ga0207678_101044962 | 76 |
| 316 | 3300026078 | Ga0207702_11079761 | Ga0207702_110797612 | 76 |
| 317 | 3300026078 | Ga0207702_11339239 | Ga0207702_113392393 | 76 |
| 318 | 3300026078 | Ga0207702_12362902 | Ga0207702_123629021 | 76 |
| 319 | 3300026088 | Ga0207641_10282074 | Ga0207641_102820743 | 76 |
| 320 | 3300026089 | Ga0207648_10108970 | Ga0207648_101089702 | 76 |
| 321 | 3300026095 | Ga0207676_10889509 | Ga0207676_108895092 | 76 |
| 322 | 3300026116 | Ga0207674_10067482 | Ga0207674_100674824 | 76 |
| 323 | 3300026118 | Ga0207675_100200838 | Ga0207675_1002008382 | 76 |
| 324 | 3300026121 | Ga0207683_11416773 | Ga0207683_114167732 | 76 |
| 325 | 3300026142 | Ga0207698_10869897 | Ga0207698_108698972 | 76 |
| 326 | 3300027866 | Ga0209813_10201060 | Ga0209813_102010601 | 76 |
| 327 | 3300028379 | Ga0268266_10024242 | Ga0268266_100242428 | 76 |
| 328 | 3300028379 | Ga0268266_10387501 | Ga0268266_103875012 | 76 |
| 329 | 3300028379 | Ga0268266_10634165 | Ga0268266_106341652 | 76 |
| 330 | 3300028379 | Ga0268266_10772365 | Ga0268266_107723651 | 76 |
| 331 | 3300028381 | Ga0268264_10616814 | Ga0268264_106168142 | 76 |
| 332 | 3300028381 | Ga0268264_11015220 | Ga0268264_110152203 | 76 |
| 333 | 3300028786 | Ga0307517_10265645 | Ga0307517_102656452 | 76 |
| 334 | 3300028786 | Ga0307517_10507948 | Ga0307517_105079481 | 76 |
| 335 | 3300031649 | Ga0307514_10384114 | Ga0307514_103841142 | 76 |
| 336 | 3300031838 | Ga0307518_10495474 | Ga0307518_104954742 | 76 |
| 337 | 3300033180 | Ga0307510_10041777 | Ga0307510_100417777 | 76 |
| 338 | 3300035172 | Ga0373955_0315359 | Ga0373955_0315359_418_648 | 76 |
| 339 | 3300037068 | Ga0373925_1332378 | Ga0373925_1332378_142_372 | 76 |
| 340 | 3300037418 | Ga0395900_1343237 | Ga0395900_1343237_76_306 | 76 |
| 341 | 3300037466 | Ga0395898_0441828 | Ga0395898_0441828_571_801 | 76 |
| 342 | 3300037471 | Ga0395905_0018783 | Ga0395905_0018783_6168_6398 | 76 |
| 343 | 3300037471 | Ga0395905_0241355 | Ga0395905_0241355_1434_1664 | 76 |
| 344 | 3300038443 | Ga0395901_0390143 | Ga0395901_0390143_506_736 | 76 |
| 345 | 3300041451 | Ga0451791_1228850 | Ga0451791_1228850_38_268 | 76 |
| 346 | 3300041452 | Ga0451793_0789318 | Ga0451793_0789318_297_527 | 76 |
| 347 | 3300041456 | Ga0451795_1357315 | Ga0451795_1357315_42_272 | 76 |
| 348 | 3300041511 | Ga0451855_0383189 | Ga0451855_0383189_66_296 | 76 |
| 349 | 3300044656 | Ga0466969_0054869 | Ga0466969_0054869_1059_1289 | 76 |
| 350 | 3300044656 | Ga0466969_0445598 | Ga0466969_0445598_102_332 | 76 |
| 351 | 3300044658 | Ga0466972_0000164 | Ga0466972_0000164_10484_10714 | 76 |
| 352 | 3300044683 | Ga0466965_0398158 | Ga0466965_0398158_316_546 | 76 |
| 353 | 3300044684 | Ga0466966_0014160 | Ga0466966_0014160_4083_4313 | 76 |
| 354 | 3300044693 | Ga0466961_0000192 | Ga0466961_0000192_30857_31087 | 76 |
| 355 | 3300044693 | Ga0466961_0282067 | Ga0466961_0282067_516_746 | 76 |
| 356 | 3300044706 | Ga0466964_0045199 | Ga0466964_0045199_1007_1237 | 76 |
| 357 | 3300044706 | Ga0466964_0201760 | Ga0466964_0201760_245_475 | 76 |
| 358 | 3300044735 | Ga0466968_0140997 | Ga0466968_0140997_786_1016 | 76 |
| 359 | 3300044735 | Ga0466968_0159236 | Ga0466968_0159236_559_789 | 76 |
| 360 | 3300044765 | Ga0466970_0535379 | Ga0466970_0535379_208_438 | 76 |
| 361 | 3300044842 | Ga0466957_0406393 | Ga0466957_0406393_406_636 | 76 |
| 362 | 3300044842 | Ga0466957_0883604 | Ga0466957_0883604_88_318 | 76 |
| 363 | 3300044901 | Ga0466960_0158421 | Ga0466960_0158421_624_854 | 76 |
| 364 | 3300044901 | Ga0466960_0647438 | Ga0466960_0647438_377_607 | 76 |
| 365 | 3300045049 | Ga0466959_0001746 | Ga0466959_0001746_9994_10224 | 76 |
| 366 | 3300045049 | Ga0466959_0917015 | Ga0466959_0917015_80_310 | 76 |
| 367 | 3300046454 | Ga0495592_0119356 | Ga0495592_0119356_504_734 | 76 |
| 368 | 3300046455 | Ga0495603_0126422 | Ga0495603_0126422_354_584 | 76 |
| 369 | 3300046459 | Ga0495629_0001707 | Ga0495629_0001707_336_566 | 76 |
| 370 | 3300046459 | Ga0495629_0142373 | Ga0495629_0142373_1026_1256 | 76 |
| 371 | 3300046460 | Ga0495638_0002914 | Ga0495638_0002914_12560_12790 | 76 |
| 372 | 3300046462 | Ga0495651_0206029 | Ga0495651_0206029_887_1117 | 76 |
| 373 | 3300046462 | Ga0495651_0603158 | Ga0495651_0603158_240_470 | 76 |
| 374 | 3300046471 | Ga0495650_0289871 | Ga0495650_0289871_93_323 | 76 |
| 375 | 3300046477 | Ga0495664_0032082 | Ga0495664_0032082_1088_1318 | 76 |
| 376 | 3300046491 | Ga0495584_0325117 | Ga0495584_0325117_183_452 | 76 |
| 377 | 3300046491 | Ga0495584_0600489 | Ga0495584_0600489_85_315 | 76 |
| 378 | 3300046499 | Ga0495594_0373774 | Ga0495594_0373774_77_307 | 76 |
| 379 | 3300046500 | Ga0495596_0126695 | Ga0495596_0126695_704_934 | 76 |
| 380 | 3300046501 | Ga0495607_0152613 | Ga0495607_0152613_305_535 | 76 |
| 381 | 3300046506 | Ga0495583_0058651 | Ga0495583_0058651_31_261 | 76 |
| 382 | 3300046511 | Ga0495608_0048816 | Ga0495608_0048816_2382_2612 | 76 |
| 383 | 3300046511 | Ga0495608_0077661 | Ga0495608_0077661_767_997 | 76 |
| 384 | 3300046512 | Ga0495610_0090607 | Ga0495610_0090607_423_653 | 76 |
| 385 | 3300046513 | Ga0495616_0051067 | Ga0495616_0051067_1539_1808 | 76 |
| 386 | 3300046514 | Ga0495618_0527056 | Ga0495618_0527056_463_693 | 76 |
| 387 | 3300046515 | Ga0495620_0394609 | Ga0495620_0394609_26_256 | 76 |
| 388 | 3300046516 | Ga0495628_0241630 | Ga0495628_0241630_894_1124 | 76 |
| 389 | 3300046516 | Ga0495628_0323782 | Ga0495628_0323782_609_839 | 76 |
| 390 | 3300046518 | Ga0495631_0046126 | Ga0495631_0046126_1619_1849 | 76 |
| 391 | 3300046519 | Ga0495632_0104426 | Ga0495632_0104426_501_770 | 76 |
| 392 | 3300046522 | Ga0495643_0062869 | Ga0495643_0062869_734_1003 | 76 |
| 393 | 3300046522 | Ga0495643_0287615 | Ga0495643_0287615_86_319 | 76 |
| 394 | 3300046524 | Ga0495648_0069673 | Ga0495648_0069673_1499_1729 | 76 |
| 395 | 3300046524 | Ga0495648_0082457 | Ga0495648_0082457_1519_1749 | 76 |
| 396 | 3300046524 | Ga0495648_0095469 | Ga0495648_0095469_194_424 | 76 |
| 397 | 3300046524 | Ga0495648_0172513 | Ga0495648_0172513_702_932 | 76 |
| 398 | 3300046529 | Ga0495652_0010890 | Ga0495652_0010890_292_522 | 76 |
| 399 | 3300046529 | Ga0495652_0112153 | Ga0495652_0112153_280_510 | 76 |
| 400 | 3300046533 | Ga0495640_0055223 | Ga0495640_0055223_491_721 | 76 |
| 401 | 3300046536 | Ga0495587_0014879 | Ga0495587_0014879_410_640 | 76 |
| 402 | 3300046536 | Ga0495587_0227592 | Ga0495587_0227592_306_536 | 76 |
| 403 | 3300046538 | Ga0495609_0123178 | Ga0495609_0123178_372_602 | 76 |
| 404 | 3300046543 | Ga0495645_0027684 | Ga0495645_0027684_2332_2562 | 76 |
| 405 | 3300046557 | Ga0495622_0019727 | Ga0495622_0019727_1721_1951 | 76 |
| 406 | 3300046557 | Ga0495622_0122756 | Ga0495622_0122756_743_973 | 76 |
| 407 | 3300046557 | Ga0495622_0164094 | Ga0495622_0164094_42_272 | 76 |
| 408 | 3300046559 | Ga0495667_0346667 | Ga0495667_0346667_212_442 | 76 |
| 409 | 3300046615 | Ga0495656_0180364 | Ga0495656_0180364_363_593 | 76 |
| 410 | 3300046616 | Ga0495668_0047332 | Ga0495668_0047332_1654_1884 | 76 |
| 411 | 3300046616 | Ga0495668_0491180 | Ga0495668_0491180_17_286 | 76 |
| 412 | 3300046616 | Ga0495668_0618151 | Ga0495668_0618151_159_389 | 76 |
| 413 | 3300046642 | Ga0495634_0025688 | Ga0495634_0025688_2077_2307 | 76 |
| 414 | 3300046642 | Ga0495634_0194523 | Ga0495634_0194523_154_384 | 76 |
| 415 | 3300046648 | Ga0495611_0147139 | Ga0495611_0147139_851_1081 | 76 |
| 416 | 3300046648 | Ga0495611_0527773 | Ga0495611_0527773_235_465 | 76 |
| 417 | 3300046660 | Ga0495625_0089623 | Ga0495625_0089623_147_377 | 76 |
| 418 | 3300046660 | Ga0495625_0186644 | Ga0495625_0186644_307_537 | 76 |
| 419 | 3300046660 | Ga0495625_0384117 | Ga0495625_0384117_339_569 | 76 |
| 420 | 3300046660 | Ga0495625_0817288 | Ga0495625_0817288_26_256 | 76 |
| 421 | 3300046663 | Ga0495635_0010392 | Ga0495635_0010392_5763_5993 | 76 |
| 422 | 3300046663 | Ga0495635_0022586 | Ga0495635_0022586_221_451 | 76 |
| 423 | 3300046663 | Ga0495635_0565216 | Ga0495635_0565216_483_728 | 76 |
| 424 | 3300046674 | Ga0495588_0152274 | Ga0495588_0152274_907_1137 | 76 |
| 425 | 3300046675 | Ga0495657_0032748 | Ga0495657_0032748_2314_2544 | 76 |
| 426 | 3300046675 | Ga0495657_0044954 | Ga0495657_0044954_183_413 | 76 |
| 427 | 3300046678 | Ga0495599_0838272 | Ga0495599_0838272_134_364 | 76 |
| 428 | 3300046679 | Ga0495623_0009655 | Ga0495623_0009655_4370_4600 | 76 |
| 429 | 3300046680 | Ga0495646_0014215 | Ga0495646_0014215_930_1160 | 76 |
| 430 | 3300046680 | Ga0495646_0170562 | Ga0495646_0170562_240_470 | 76 |
| 431 | 3300046680 | Ga0495646_0265369 | Ga0495646_0265369_503_748 | 76 |
| 432 | 3300046684 | Ga0495669_0258742 | Ga0495669_0258742_267_497 | 76 |
| 433 | 3300046689 | Ga0495613_0060249 | Ga0495613_0060249_1046_1276 | 76 |
| 434 | 3300046689 | Ga0495613_0674977 | Ga0495613_0674977_132_362 | 76 |
| 435 | 3300046690 | Ga0495624_0252542 | Ga0495624_0252542_213_443 | 76 |
| 436 | 3300046690 | Ga0495624_0943187 | Ga0495624_0943187_240_485 | 76 |
| 437 | 3300046694 | Ga0495649_0023774 | Ga0495649_0023774_818_1048 | 76 |
| 438 | 3300046694 | Ga0495649_0150434 | Ga0495649_0150434_698_928 | 76 |
| 439 | 3300046694 | Ga0495649_0162324 | Ga0495649_0162324_249_518 | 76 |
| 440 | 3300046694 | Ga0495649_0490582 | Ga0495649_0490582_155_385 | 76 |
| 441 | 3300046809 | Ga0495600_0005782 | Ga0495600_0005782_6932_7162 | 76 |
| 442 | 3300046809 | Ga0495600_0116881 | Ga0495600_0116881_387_617 | 76 |
| 443 | 3300046810 | Ga0495660_0277363 | Ga0495660_0277363_131_361 | 76 |
| 444 | 3300047315 | Ga0495581_0032716 | Ga0495581_0032716_1496_1726 | 76 |
| 445 | 3300047315 | Ga0495581_0174821 | Ga0495581_0174821_470_700 | 76 |
| 446 | 3300047317 | Ga0495604_0005334 | Ga0495604_0005334_2029_2259 | 76 |
| 447 | 3300047317 | Ga0495604_0075794 | Ga0495604_0075794_1782_2012 | 76 |
| 448 | 3300047319 | Ga0495674_0368598 | Ga0495674_0368598_646_876 | 76 |
| 449 | 3300047321 | Ga0495676_0099913 | Ga0495676_0099913_251_481 | 76 |
| 450 | 3300047322 | Ga0495680_0005028 | Ga0495680_0005028_10124_10354 | 76 |
| 451 | 3300047323 | Ga0495683_0144977 | Ga0495683_0144977_92_322 | 76 |
| 452 | 3300047323 | Ga0495683_0272745 | Ga0495683_0272745_373_642 | 76 |
| 453 | 3300047323 | Ga0495683_0312483 | Ga0495683_0312483_36_266 | 76 |
| 454 | 3300047443 | Ga0495687_103364 | Ga0495687_103364_20_289 | 76 |
| 455 | 3300047444 | Ga0495675_0059833 | Ga0495675_0059833_1826_2056 | 76 |
| 456 | 3300047445 | Ga0495677_0152295 | Ga0495677_0152295_496_726 | 76 |
| 457 | 3300047446 | Ga0495679_090769 | Ga0495679_090769_17_247 | 76 |
| 458 | 3300047469 | Ga0495673_0047286 | Ga0495673_0047286_981_1211 | 76 |
| 459 | 3300047469 | Ga0495673_0095356 | Ga0495673_0095356_631_861 | 76 |
| 460 | 3300047472 | Ga0495686_0070363 | Ga0495686_0070363_436_666 | 76 |
| 461 | 3300047472 | Ga0495686_0127153 | Ga0495686_0127153_1031_1261 | 76 |
| 462 | 3300047472 | Ga0495686_0657987 | Ga0495686_0657987_89_319 | 76 |
| 463 | 3300048088 | Ga0495602_0034441 | Ga0495602_0034441_86_316 | 76 |
| 464 | 3300048088 | Ga0495602_0072394 | Ga0495602_0072394_1664_1894 | 76 |
| 465 | 3300048089 | Ga0495614_0202802 | Ga0495614_0202802_603_833 | 76 |
| 466 | 3300048903 | Ga0496100_0353934 | Ga0496100_0353934_859_1089 | 76 |
| 467 | 3300048903 | Ga0496100_0941517 | Ga0496100_0941517_228_458 | 76 |
| 468 | 3300048903 | Ga0496100_1555729 | Ga0496100_1555729_226_456 | 76 |
| 469 | 3300048904 | Ga0496101_0488726 | Ga0496101_0488726_396_626 | 76 |
| 470 | 3300048904 | Ga0496101_0583051 | Ga0496101_0583051_434_664 | 76 |
| 471 | 3300048905 | Ga0496102_0187141 | Ga0496102_0187141_1314_1583 | 76 |
| 472 | 3300048905 | Ga0496102_0605818 | Ga0496102_0605818_180_410 | 76 |
| 473 | 3300048905 | Ga0496102_1133081 | Ga0496102_1133081_245_475 | 76 |
| 474 | 3300048905 | Ga0496102_1407633 | Ga0496102_1407633_236_466 | 76 |
| 475 | 3300048906 | Ga0496103_0107292 | Ga0496103_0107292_532_801 | 76 |
| 476 | 3300048906 | Ga0496103_0205310 | Ga0496103_0205310_328_558 | 76 |
| 477 | 3300048907 | Ga0496104_0003677 | Ga0496104_0003677_1910_2140 | 76 |
| 478 | 3300048907 | Ga0496104_0030189 | Ga0496104_0030189_1764_1994 | 76 |
| 479 | 3300048907 | Ga0496104_0306551 | Ga0496104_0306551_933_1202 | 76 |
| 480 | 3300048907 | Ga0496104_0395247 | Ga0496104_0395247_760_990 | 76 |
| 481 | 3300048908 | Ga0496105_0002470 | Ga0496105_0002470_6163_6393 | 76 |
| 482 | 3300048908 | Ga0496105_0019150 | Ga0496105_0019150_1881_2111 | 76 |
| 483 | 3300048908 | Ga0496105_0187699 | Ga0496105_0187699_952_1182 | 76 |
| 484 | 3300048909 | Ga0496106_0022614 | Ga0496106_0022614_2087_2317 | 76 |
| 485 | 3300048910 | Ga0496107_0166917 | Ga0496107_0166917_203_433 | 76 |
| 486 | 3300048910 | Ga0496107_0228698 | Ga0496107_0228698_805_1035 | 76 |
| 487 | 3300048911 | Ga0496108_0187449 | Ga0496108_0187449_620_889 | 76 |
| 488 | 3300048911 | Ga0496108_1056783 | Ga0496108_1056783_153_383 | 76 |
| 489 | 3300048912 | Ga0496109_0762904 | Ga0496109_0762904_618_887 | 76 |
| 490 | 3300048913 | Ga0496110_0130025 | Ga0496110_0130025_973_1242 | 76 |
| 491 | 3300048913 | Ga0496110_0250526 | Ga0496110_0250526_666_896 | 76 |
| 492 | 3300048913 | Ga0496110_0906588 | Ga0496110_0906588_404_634 | 76 |
| 493 | 3300048914 | Ga0496111_0057391 | Ga0496111_0057391_1031_1261 | 76 |
| 494 | 3300048914 | Ga0496111_0345875 | Ga0496111_0345875_28_258 | 76 |
| 495 | 3300048915 | Ga0496112_0213724 | Ga0496112_0213724_921_1190 | 76 |
| 496 | 3300048915 | Ga0496112_0831973 | Ga0496112_0831973_244_474 | 76 |
| 497 | 3300048915 | Ga0496112_1323830 | Ga0496112_1323830_176_406 | 76 |
| 498 | 3300048916 | Ga0496113_0011865 | Ga0496113_0011865_1295_1525 | 76 |
| 499 | 3300048916 | Ga0496113_0243138 | Ga0496113_0243138_856_1086 | 76 |
| 500 | 3300048916 | Ga0496113_0559148 | Ga0496113_0559148_56_286 | 76 |
| 501 | 3300048917 | Ga0496114_0083788 | Ga0496114_0083788_1420_1650 | 76 |
| 502 | 3300048918 | Ga0496115_0166200 | Ga0496115_0166200_1191_1421 | 76 |
| 503 | 3300048918 | Ga0496115_0243406 | Ga0496115_0243406_196_426 | 76 |
| 504 | 3300048918 | Ga0496115_0514257 | Ga0496115_0514257_588_818 | 76 |
| 505 | 3300048919 | Ga0496116_0022320 | Ga0496116_0022320_1065_1295 | 76 |
| 506 | 3300048920 | Ga0496117_0231363 | Ga0496117_0231363_517_747 | 76 |
| 507 | 3300048920 | Ga0496117_0252770 | Ga0496117_0252770_340_570 | 76 |
| 508 | 3300048920 | Ga0496117_0321731 | Ga0496117_0321731_127_357 | 76 |
| 509 | 3300048921 | Ga0496118_0043083 | Ga0496118_0043083_2012_2242 | 76 |
| 510 | 3300048921 | Ga0496118_0099141 | Ga0496118_0099141_285_515 | 76 |
| 511 | 3300048921 | Ga0496118_0110487 | Ga0496118_0110487_802_1071 | 76 |
| 512 | 3300048921 | Ga0496118_0132729 | Ga0496118_0132729_1084_1314 | 76 |
| 513 | 3300048922 | Ga0496119_0068166 | Ga0496119_0068166_1782_2012 | 76 |
| 514 | 3300048922 | Ga0496119_0225577 | Ga0496119_0225577_446_676 | 76 |
| 515 | 3300048922 | Ga0496119_0250808 | Ga0496119_0250808_492_761 | 76 |
| 516 | 3300048923 | Ga0496120_0044017 | Ga0496120_0044017_1814_2044 | 76 |
| 517 | 3300048923 | Ga0496120_0061207 | Ga0496120_0061207_1520_1750 | 76 |
| 518 | 3300048924 | Ga0496121_0016155 | Ga0496121_0016155_1424_1654 | 76 |
| 519 | 3300048924 | Ga0496121_0119729 | Ga0496121_0119729_1693_1923 | 76 |
| 520 | 3300048924 | Ga0496121_0184663 | Ga0496121_0184663_687_917 | 76 |
| 521 | 3300048925 | Ga0496122_0157772 | Ga0496122_0157772_202_435 | 76 |
| 522 | 3300048925 | Ga0496122_0323860 | Ga0496122_0323860_532_801 | 76 |
| 523 | 3300048926 | Ga0496123_0130413 | Ga0496123_0130413_592_861 | 76 |
| 524 | 3300048927 | Ga0496124_0126828 | Ga0496124_0126828_925_1155 | 76 |
| 525 | 3300048927 | Ga0496124_0335407 | Ga0496124_0335407_479_748 | 76 |
| 526 | 3300048927 | Ga0496124_0944911 | Ga0496124_0944911_114_344 | 76 |
| 527 | 3300048928 | Ga0496125_0039775 | Ga0496125_0039775_1550_1783 | 76 |
| 528 | 3300048928 | Ga0496125_0072747 | Ga0496125_0072747_412_642 | 76 |
| 529 | 3300048928 | Ga0496125_0363644 | Ga0496125_0363644_189_425 | 76 |
| 530 | 3300048929 | Ga0496126_0014768 | Ga0496126_0014768_2546_2776 | 76 |
| 531 | 3300048929 | Ga0496126_0097252 | Ga0496126_0097252_872_1102 | 76 |
| 532 | 3300048929 | Ga0496126_0389602 | Ga0496126_0389602_25_255 | 76 |
| 533 | 3300048929 | Ga0496126_0616610 | Ga0496126_0616610_538_768 | 76 |
| 534 | 3300048929 | Ga0496126_0696238 | Ga0496126_0696238_342_572 | 76 |
| 535 | 3300049460 | Ga0495682_0309956 | Ga0495682_0309956_200_430 | 76 |
| 536 | 3300050490 | nmdc:mga03n38_291688_c1 | nmdc:mga03n38_291688_c1_479_748 | 76 |
| 537 | 3300050491 | nmdc:mga00v17_124473_c1 | nmdc:mga00v17_124473_c1_788_1057 | 76 |
| 538 | 3300050493 | nmdc:mga0k408_104431_c1 | nmdc:mga0k408_104431_c1_232_501 | 76 |
| 539 | 3300050494 | nmdc:mga06z11_140137_c1 | nmdc:mga06z11_140137_c1_589_819 | 76 |
| 540 | 3300050495 | nmdc:mga04h51_392865_c1 | nmdc:mga04h51_392865_c1_292_561 | 76 |
| 541 | 3300050496 | nmdc:mga07m45_33230_c1 | nmdc:mga07m45_33230_c1_129_398 | 76 |
| 542 | 3300050516 | nmdc:mga0sz30_36479_c1 | nmdc:mga0sz30_36479_c1_692_925 | 76 |
| 543 | 3300050516 | nmdc:mga0sz30_41348_c1 | nmdc:mga0sz30_41348_c1_193_426 | 76 |
| 544 | 3300050516 | nmdc:mga0sz30_501879_c1 | nmdc:mga0sz30_501879_c1_306_536 | 76 |
| 545 | 3300050516 | nmdc:mga0sz30_61091_c1 | nmdc:mga0sz30_61091_c1_869_1138 | 76 |
| 546 | 3300053079 | Ga0500610_0267602 | Ga0500610_0267602_163_393 | 76 |
| 547 | 3300053080 | Ga0500635_0056317 | Ga0500635_0056317_879_1109 | 76 |
| 548 | 3300053085 | Ga0495619_0089308 | Ga0495619_0089308_119_349 | 76 |
| 549 | 3300053086 | Ga0500578_0439047 | Ga0500578_0439047_182_412 | 76 |
| 550 | 3300053088 | Ga0500644_0076519 | Ga0500644_0076519_246_476 | 76 |
| 551 | 3300053088 | Ga0500644_0255536 | Ga0500644_0255536_414_644 | 76 |
| 552 | 3300053089 | Ga0500581_303976 | Ga0500581_303976_56_286 | 76 |
| 553 | 3300053092 | Ga0500583_0152953 | Ga0500583_0152953_294_524 | 76 |
| 554 | 3300053093 | Ga0500651_0100618 | Ga0500651_0100618_421_651 | 76 |
| 555 | 3300053093 | Ga0500651_0176557 | Ga0500651_0176557_868_1098 | 76 |
| 556 | 3300053093 | Ga0500651_0776676 | Ga0500651_0776676_221_451 | 76 |
| 557 | 3300053094 | Ga0500566_0001157 | Ga0500566_0001157_2692_2922 | 76 |
| 558 | 3300053094 | Ga0500566_0475490 | Ga0500566_0475490_226_456 | 76 |
| 559 | 3300053095 | Ga0500640_046441 | Ga0500640_046441_1303_1533 | 76 |
| 560 | 3300053096 | Ga0500641_0044627 | Ga0500641_0044627_717_947 | 76 |
| 561 | 3300053098 | Ga0500650_0077286 | Ga0500650_0077286_781_1011 | 76 |
| 562 | 3300053102 | Ga0500554_137853 | Ga0500554_137853_84_314 | 76 |
| 563 | 3300053103 | Ga0500555_006517 | Ga0500555_006517_1879_2109 | 76 |
| 564 | 3300053104 | Ga0500556_0170963 | Ga0500556_0170963_173_403 | 76 |
| 565 | 3300053108 | Ga0500562_008443 | Ga0500562_008443_1601_1831 | 76 |
| 566 | 3300053109 | Ga0500569_004124 | Ga0500569_004124_1426_1656 | 76 |
| 567 | 3300053109 | Ga0500569_068209 | Ga0500569_068209_436_666 | 76 |
| 568 | 3300053111 | Ga0500572_014786 | Ga0500572_014786_1619_1849 | 76 |
| 569 | 3300053116 | Ga0500592_002785 | Ga0500592_002785_1432_1662 | 76 |
| 570 | 3300053118 | Ga0500594_0020657 | Ga0500594_0020657_80_310 | 76 |
| 571 | 3300053119 | Ga0500595_015814 | Ga0500595_015814_1729_1959 | 76 |
| 572 | 3300053121 | Ga0500607_004790 | Ga0500607_004790_8161_8391 | 76 |
| 573 | 3300053122 | Ga0500608_030363 | Ga0500608_030363_1364_1594 | 76 |
| 574 | 3300053123 | Ga0500614_076344 | Ga0500614_076344_449_679 | 76 |
| 575 | 3300053125 | Ga0500618_069291 | Ga0500618_069291_474_704 | 76 |
| 576 | 3300053126 | Ga0500621_126379 | Ga0500621_126379_614_844 | 76 |
| 577 | 3300053126 | Ga0500621_281479 | Ga0500621_281479_136_366 | 76 |
| 578 | 3300053130 | Ga0500642_0135231 | Ga0500642_0135231_406_636 | 76 |
| 579 | 3300053130 | Ga0500642_0242264 | Ga0500642_0242264_312_542 | 76 |
| 580 | 3300053133 | Ga0500655_052853 | Ga0500655_052853_364_594 | 76 |
| 581 | 3300053136 | Ga0500559_0565957 | Ga0500559_0565957_227_457 | 76 |
| 582 | 3300053138 | Ga0500564_066019 | Ga0500564_066019_1031_1261 | 76 |
| 583 | 3300053139 | Ga0500568_0044530 | Ga0500568_0044530_58_288 | 76 |
| 584 | 3300053142 | Ga0500577_0019365 | Ga0500577_0019365_610_840 | 76 |
| 585 | 3300053142 | Ga0500577_0521209 | Ga0500577_0521209_176_406 | 76 |
| 586 | 3300053148 | Ga0500590_086798 | Ga0500590_086798_989_1219 | 76 |
| 587 | 3300053148 | Ga0500590_156074 | Ga0500590_156074_221_451 | 76 |
| 588 | 3300053151 | Ga0500604_0069147 | Ga0500604_0069147_825_1055 | 76 |
| 589 | 3300053153 | Ga0500616_0063545 | Ga0500616_0063545_850_1080 | 76 |
| 590 | 3300053154 | Ga0500619_029933 | Ga0500619_029933_47_277 | 76 |
| 591 | 3300053155 | Ga0500620_010398 | Ga0500620_010398_1869_2099 | 76 |
| 592 | 3300053156 | Ga0500622_0118755 | Ga0500622_0118755_691_921 | 76 |
| 593 | 3300053157 | Ga0500624_039880 | Ga0500624_039880_235_468 | 76 |
| 594 | 3300053162 | Ga0500638_100272 | Ga0500638_100272_879_1109 | 76 |
| 595 | 3300053163 | Ga0500639_213906 | Ga0500639_213906_145_375 | 76 |
| 596 | 3300053163 | Ga0500639_241396 | Ga0500639_241396_341_571 | 76 |
| 597 | 3300053177 | Ga0500636_0001310 | Ga0500636_0001310_3832_4062 | 76 |
| 598 | 3300053177 | Ga0500636_0237708 | Ga0500636_0237708_146_391 | 76 |
| 599 | 3300053177 | Ga0500636_0346578 | Ga0500636_0346578_36_266 | 76 |
| 600 | 3300053177 | Ga0500636_0453516 | Ga0500636_0453516_313_543 | 76 |
| 601 | 3300053723 | Ga0500567_219284 | Ga0500567_219284_85_315 | 76 |
| 602 | 3300053727 | Ga0500611_150551 | Ga0500611_150551_270_500 | 76 |
| 603 | 3300053730 | Ga0500645_047532 | Ga0500645_047532_361_627 | 76 |
| 604 | 3300053733 | Ga0500552_075557 | Ga0500552_075557_191_421 | 76 |
| 605 | 3300053735 | Ga0500596_016223 | Ga0500596_016223_85_315 | 76 |
| 606 | 3300053736 | Ga0500599_001988 | Ga0500599_001988_738_968 | 76 |
| 607 | 3300053737 | Ga0500601_000314 | Ga0500601_000314_1638_1871 | 76 |
| 608 | 3300055283 | Ga0500661_014216 | Ga0500661_014216_414_644 | 76 |
| 609 | 3300059478 | Ga0587093_052242 | Ga0587093_052242_296_535 | 76 |
| 610 | 3300059490 | Ga0587066_097843 | Ga0587066_097843_137_376 | 76 |
| 611 | 3300059491 | Ga0587070_115134 | Ga0587070_115134_111_350 | 76 |
| 612 | 3300059492 | Ga0587073_0145057 | Ga0587073_0145057_288_527 | 76 |
| 613 | 3300059503 | Ga0587080_045827 | Ga0587080_045827_296_535 | 76 |
| 614 | 3300059504 | Ga0587082_064362 | Ga0587082_064362_296_535 | 76 |
| 615 | 3300059504 | Ga0587082_168595 | Ga0587082_168595_15_245 | 76 |
| 616 | 3300059505 | Ga0587083_0225278 | Ga0587083_0225278_111_350 | 76 |
| 617 | 3300059507 | Ga0587086_044381 | Ga0587086_044381_174_413 | 76 |
| 618 | 3300059510 | Ga0587090_054994 | Ga0587090_054994_208_447 | 76 |
| 619 | 3300059511 | Ga0587091_108242 | Ga0587091_108242_291_530 | 76 |
| 620 | 3300059623 | Ga0587101_043075 | Ga0587101_043075_432_662 | 76 |
| 621 | 3300059626 | Ga0587115_051878 | Ga0587115_051878_116_355 | 76 |
| 622 | 3300059627 | Ga0587117_050154 | Ga0587117_050154_137_376 | 76 |
| 623 | 3300059641 | Ga0587068_088866 | Ga0587068_088866_109_348 | 76 |
| 624 | 3300059644 | Ga0587075_104449 | Ga0587075_104449_251_490 | 76 |
| 625 | 3300059645 | Ga0587076_070915 | Ga0587076_070915_297_536 | 76 |
| 626 | 3300059646 | Ga0587078_038655 | Ga0587078_038655_290_529 | 76 |
| 627 | 3300060344 | Ga0587071_162926 | Ga0587071_162926_110_340 | 76 |
| 628 | 3300060346 | Ga0587111_0258873 | Ga0587111_0258873_245_484 | 76 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5hte-assembly1.cif.gz_A-2 | recombinant bovine beta-lactoglobulin variant l1a/i2s (sblgb#2) | 0.913 | 30 | 59 |
| 7s00-assembly1.cif.gz_C | x-ray structure of the phage ar9 non-virion rna polymerase core | 0.895 | 30 | 60 |
| 6ryt-assembly1.cif.gz_A | engineered beta-lactoglobulin: variant m107l | 0.8924 | 30 | 64 |
| 7q18-assembly1.cif.gz_BBB | beta-lactoglobulin mutant faf (i56f/l39a/m107f), unliganded form | 0.8815 | 30 | 64 |
| 6ryt-assembly1.cif.gz_B | engineered beta-lactoglobulin: variant m107l | 0.87 | 30 | 64 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54H02_2_246_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9433 | 30 | 60 | 3.50.50.60 |
| af_Q9SVJ9_86_341_2.120.10.80 | Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller | 0.8936 | 34 | 59 | 2.120.10.80 |
| af_Q19910_105_449_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.8829 | 30 | 59 | 3.50.50.60 |
| af_Q8III5_2_235_3.30.830.10 | Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like | 0.8764 | 30 | 59 | 3.30.830.10 |
| 1tkwB02 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8716 | 32 | 63 | 2.40.50.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y6PX91-F1-model_v4 | Uncharacterized protein | 0.9468 | 22 | 59 |
|
| AF-A0A1H6BUU7-F1-model_v4 | Transcriptional repressor NrdR-like N-terminal domain-containing protein | 0.9439 | 22 | 59 |
|
| AF-A0A1F8T3N3-F1-model_v4 | Transcriptional regulator NrdR | 0.9263 | 22 | 62 |
GO:0003677
GO:0005524 GO:0008270 GO:0045892 |
| AF-A0A496QP86-F1-model_v4 | Pyridine nucleotide-disulfide oxidoreductase | 0.9208 | 30 | 60 |
|
| AF-A0A849WZ07-F1-model_v4 | Transcriptional repressor NrdR | 0.9147 | 22 | 59 |
GO:0003677
GO:0005524 GO:0008270 GO:0045892 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar