metagRoot

F470509

General Info

Members	Datasets	Scaffolds	Average Seq Length
626	376	528	173

Family's Representative Sequence

Representative Sequence	3300049586\|Ga0501070_0644806\|Ga0501070_0644806_85_690
Length	201
Sequence	MRAERLTPPSNRSSTGSRLKRVSVPACKETKMLKTILLVAAGTLFASTAFAHVTLEQQQAKIGAGYKAVFRVPHGCAGSATVKLRVQVPEGYIGVKPMPKAGWKIDIVKGKYAKSYDLYGHSISEGVTEIDWSGNLPDAYYDEFVMSGFLADSLPAGEMLYFPVVQECEKGVTRWIEKPAEGADPDSVEHPAPGVKLLPKN

Samples

	Sample ID	Description	Type	Environment
1	2511231052	Sinorhizobium meliloti AK58	Isolate	Nodule
2	2513237086	Sinorhizobium meliloti MVII-I	Isolate	Nodule
3	2513237096	Bradyrhizobium pachyrhizi USDA 3259	Isolate	Nodule
4	2513237137	Bradyrhizobium elkanii USDA 94	Isolate	Nodule
5	2513237145	Bradyrhizobium elkanii USDA 3254	Isolate	Nodule
6	2517572143	Bradyrhizobium elkanii USDA 76	Isolate	Nodule
7	2524023210	Bradyrhizobium sp. Ai1a-2	Isolate	Nodule
8	2524023228	Bradyrhizobium sp. Th.b2	Isolate	Nodule
9	2551306084	Sinorhizobium meliloti 5A14	Isolate	Nodule
10	2551306085	Sinorhizobium meliloti AE608H	Isolate	Nodule
11	2551306086	Sinorhizobium meliloti AK11	Isolate	Nodule
12	2551306087	Sinorhizobium meliloti A0643DD	Isolate	Nodule
13	2551306090	Sinorhizobium meliloti A0641M	Isolate	Nodule
14	2551306092	Sinorhizobium meliloti AK75	Isolate	Nodule
15	2551306093	Sinorhizobium meliloti C0438LL	Isolate	Nodule
16	2667528175	Rhizobium tropici NFR14	Isolate	Rhizoplane
17	2690316117	Sinorhizobium fredii CCBAU 45436	Isolate	Unclassified
18	2693429784	Mesorhizobium sp. LCM 4576	Isolate	Rhizosphere
19	2728368998	Bradyrhizobium macuxiense BR 10303	Isolate	Nodule
20	2791355197	Bradyrhizobium sp. C9	Isolate	Nodule
21	2838074704	Sinorhizobium terangae SEMIA 6460	Isolate	Unclassified
22	2847417321	Sinorhizobium fredii CCBAU 45436	Isolate	Unclassified
23	2848992105	Sinorhizobium fredii CCBAU 25509	Isolate	Unclassified
24	2855839649	Sinorhizobium meliloti AK555	Isolate	Unclassified
25	2855872281	Sinorhizobium fredii PCH1	Isolate	Nodule
26	2876808645	Bradyrhizobium algeriense RST89	Isolate	Unclassified
27	2879110137	Bradyrhizobium algeriense RST91	Isolate	Nodule
28	2885374607	Bradyrhizobium sp. NAS96.2	Isolate	Unclassified
29	2889033259	Bradyrhizobium sp. CCBAU 051011	Isolate	Unclassified
30	2896384573	Ensifer sp. MPMI2T	Isolate	Unclassified
31	2903748898	Bradyrhizobium uaiense UFLA 03-164	Isolate	Nodule
32	2904690495	Bradyrhizobium ivorense CI-1B	Isolate	Nodule
33	2906635258	Bradyrhizobium sp. USDA 3458	Isolate	Unclassified
34	2906660503	Bradyrhizobium brasilense UFLA 03-321	Isolate	Unclassified
35	2908739725	Bradyrhizobium sp. UFLA03-84	Isolate	Nodule
36	2908756301	Bradyrhizobium ivorense CI-41S	Isolate	Nodule
37	2915986958	Sinorhizobium meliloti USDA1659	Isolate	Nodule
38	2915993759	Sinorhizobium meliloti USDA1336	Isolate	Nodule
39	2916035215	Sinorhizobium meliloti 3011	Isolate	Nodule
40	2916068649	Sinorhizobium meliloti USDA1220	Isolate	Nodule
41	2921201388	Sinorhizobium meliloti USDA1692	Isolate	Nodule
42	2921208531	Sinorhizobium meliloti USDA1660	Isolate	Nodule
43	2921289301	Sinorhizobium meliloti USDA1730	Isolate	Nodule
44	2921296804	Sinorhizobium meliloti USDA1200	Isolate	Nodule
45	2924165586	Sinorhizobium meliloti USDA1264	Isolate	Nodule
46	2924186466	Sinorhizobium meliloti USDA1389	Isolate	Nodule
47	2924193448	Sinorhizobium meliloti USDA1158	Isolate	Nodule
48	2924214083	Sinorhizobium meliloti USDA1702	Isolate	Nodule
49	2924228884	Sinorhizobium meliloti USDA1581	Isolate	Nodule
50	2935630451	Bradyrhizobium sp. I1.14.4	Isolate	Nodule
51	2936996657	Sinorhizobium meliloti USDA1025	Isolate	Nodule
52	2937049772	Sinorhizobium meliloti USDA1691	Isolate	Nodule
53	2937063883	Sinorhizobium meliloti USDA1808	Isolate	Nodule
54	2937091812	Sinorhizobium meliloti USDA1221	Isolate	Nodule
55	2937106411	Sinorhizobium meliloti USDA1214	Isolate	Nodule
56	2937113482	Sinorhizobium meliloti USDA1180	Isolate	Nodule
57	2941507105	Bradyrhizobium sp. i1.12.3	Isolate	Nodule
58	2941515067	Bradyrhizobium sp. i1.14.1	Isolate	Nodule
59	2941523033	Bradyrhizobium sp. i1.8.4	Isolate	Nodule
60	2957388812	Sinorhizobium meliloti USDA1195	Isolate	Nodule
61	2957422303	Sinorhizobium meliloti USDA1497	Isolate	Nodule
62	2957430029	Sinorhizobium meliloti USDA1590	Isolate	Nodule
63	2957457609	Sinorhizobium meliloti USDA1751	Isolate	Nodule
64	2957484790	Sinorhizobium meliloti USDA1464	Isolate	Nodule
65	2957505466	Sinorhizobium meliloti USDA1696	Isolate	Nodule
66	2960645483	Sinorhizobium meliloti USDA1703	Isolate	Nodule
67	2964628898	Sinorhizobium meliloti USDA1191	Isolate	Nodule
68	2964636051	Sinorhizobium meliloti USDA1594	Isolate	Nodule
69	2964643177	Sinorhizobium meliloti USDA1760	Isolate	Nodule
70	2964649959	Sinorhizobium meliloti USDA1591	Isolate	Nodule
71	2964656573	Sinorhizobium meliloti USDA1308	Isolate	Nodule
72	2964670856	Sinorhizobium meliloti USDA1211	Isolate	Nodule
73	2964698721	Sinorhizobium meliloti USDA1656	Isolate	Nodule
74	2967664464	Sinorhizobium meliloti USDA1208	Isolate	Nodule
75	2967671571	Sinorhizobium meliloti USDA1496	Isolate	Nodule
76	2967714385	Sinorhizobium meliloti USDA1023	Isolate	Nodule
77	2967721400	Sinorhizobium meliloti USDA1742	Isolate	Nodule
78	2967735183	Sinorhizobium meliloti USDA1710	Isolate	Nodule
79	2970033650	Sinorhizobium meliloti USDA1565	Isolate	Nodule
80	2970040964	Sinorhizobium meliloti USDA1501	Isolate	Nodule
81	2970054988	Sinorhizobium meliloti USDA1031	Isolate	Nodule
82	2970068827	Sinorhizobium meliloti USDA1227	Isolate	Nodule
83	2970116247	Sinorhizobium meliloti USDA1566	Isolate	Nodule
84	2970149975	Sinorhizobium meliloti USDA1215	Isolate	Nodule
85	2970184632	Sinorhizobium meliloti USDA1593	Isolate	Nodule
86	2970191845	Sinorhizobium meliloti USDA1187	Isolate	Nodule
87	2977537788	Sinorhizobium meliloti USDA1184	Isolate	Nodule
88	2977572785	Sinorhizobium meliloti USDA1767	Isolate	Nodule
89	2977579622	Sinorhizobium meliloti USDA1161	Isolate	Nodule
90	3005474847	Bradyrhizobium sp. CCBAU 53421	Isolate	Nodule
91	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
92	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
93	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
94	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
95	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
96	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
97	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
98	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
99	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
100	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
101	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
102	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
103	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
104	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
105	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
106	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
107	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
108	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
109	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
110	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
111	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
112	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
113	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
114	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
115	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
116	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
117	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
118	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
119	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
120	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
121	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
122	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
123	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
124	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
125	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
126	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
127	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
128	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
129	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
130	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
131	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
132	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
133	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
134	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
135	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
136	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
137	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
138	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
139	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
140	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
141	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
142	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
143	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
144	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
145	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
146	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
147	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
148	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
149	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
150	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
151	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
152	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
153	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
154	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
155	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
156	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
157	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
158	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
159	3300006942	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW	Metagenome	Nodule
160	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
161	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
162	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
163	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
164	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
165	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
166	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
167	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
168	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
169	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
170	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
171	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
172	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
173	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
174	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
175	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
176	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
177	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
178	3300012506	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610	Metagenome	Rhizosphere
179	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
180	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
181	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
182	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
183	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
184	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
185	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
186	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
187	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
188	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
189	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
190	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
191	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
192	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
193	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
194	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
195	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
196	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
197	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
198	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
199	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
200	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
201	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
202	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
203	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
204	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
205	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
206	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
207	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
208	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
209	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
210	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
211	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
212	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
213	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
214	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
215	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
216	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
217	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
218	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
219	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
220	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
221	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
222	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
223	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
224	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
225	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
226	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
227	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
228	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
229	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
230	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
231	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
232	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
233	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
234	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
235	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
236	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
237	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
238	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
239	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
240	3300027357	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2)	Metagenome	Nodule
241	3300027361	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2)	Metagenome	Nodule
242	3300027363	Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2)	Metagenome	Nodule
243	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
244	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
245	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
246	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
247	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
248	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
249	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
250	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
251	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
252	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
253	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
254	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
255	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
256	3300033442	Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1	Metagenome	Nodule
257	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
258	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
259	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
260	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
261	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
262	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
263	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
264	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
265	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
266	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
267	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
268	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
269	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
270	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
271	3300041459	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG	Metagenome	Rhizoplane
272	3300041496	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG	Metagenome	Unclassified
273	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
274	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
275	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
276	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
277	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
278	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
279	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
280	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
281	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
282	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
283	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
284	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
285	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
286	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
287	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
288	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
289	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
290	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
291	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
292	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
293	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
294	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
295	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
296	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
297	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
298	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
299	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
300	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
301	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
302	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
303	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
304	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
305	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
306	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
307	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
308	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
309	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
310	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
311	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
312	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
313	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
314	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
315	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
316	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
317	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
318	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
319	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
320	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
321	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
322	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
323	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
324	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
325	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
326	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
327	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
328	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
329	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
330	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
331	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
332	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
333	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
334	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
335	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
336	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
337	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
338	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
339	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
340	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
341	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
342	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
343	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
344	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
345	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
346	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
347	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
348	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
349	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
350	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
351	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
352	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
353	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
354	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
355	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
356	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
357	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
358	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
359	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
360	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
361	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
362	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
363	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
364	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
365	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
366	3300053146	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere	Metagenome	Endosphere
367	3300053147	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere	Metagenome	Endosphere
368	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
369	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
370	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
371	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
372	8006933436	Bradyrhizobium septentrionale 7(2017)	Isolate	Unclassified
373	8006973647	Bradyrhizobium septentrionale 162S2	Isolate	Nodule
374	8006984368	Bradyrhizobium sp. SRL28	Isolate	Unclassified
375	8019555841	Bradyrhizobium sp. JR6.1	Isolate	Nodule
376	8019565922	Bradyrhizobium sp. JR3.5	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	84.59
Metatranscriptomes	0.16
Isolates	15.25

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	4.47
Nodule	13.9
Rhizoplane	7.03
Rhizosphere	68.05
Stem	0
Stem Tuber	0
Unclassified	6.55

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24739J22299_10019912	3300001989	Bacteria	2399
2	JGI25157J39369_1002223	3300002741	Bacteria	5287
3	JGI25153J46596_10001608	3300003215	Bacteria	13391
4	Ga0070683_100076534	3300005329	Bacteria	3128
5	Ga0070690_101014890	3300005330	Bacteria	654
6	Ga0070670_100388143	3300005331	Bacteria	1231
7	Ga0070670_100401096	3300005331	Bacteria	1211
8	Ga0070670_101014414	3300005331	Bacteria	755
9	Ga0068869_100025415	3300005334	Bacteria	4112
10	Ga0068869_100043742	3300005334	Bacteria	3218
11	Ga0070680_100571036	3300005336	Bacteria	970
12	Ga0068868_100048761	3300005338	Bacteria	3323
13	Ga0070689_100328141	3300005340	Bacteria	1279
14	Ga0070691_10447064	3300005341	Bacteria	737
15	Ga0070687_100415440	3300005343	Bacteria	886
16	Ga0070661_100141882	3300005344	Bacteria	1811
17	Ga0070668_100063024	3300005347	Bacteria	2873
18	Ga0070668_100152909	3300005347	Bacteria	1867
19	Ga0070668_100173761	3300005347	Bacteria	1755
20	Ga0070669_100632734	3300005353	Bacteria	899
21	Ga0070671_100198218	3300005355	Bacteria	1702
22	Ga0070673_100465608	3300005364	Bacteria	1139
23	Ga0070673_101113529	3300005364	Bacteria	738
24	Ga0070659_100796449	3300005366	Bacteria	822
25	Ga0070659_100855651	3300005366	Bacteria	793
26	Ga0070659_101240588	3300005366	Bacteria	660
27	Ga0070713_100102995	3300005436	Bacteria	2477
28	Ga0070713_100183830	3300005436	Bacteria	1880
29	Ga0070711_100213079	3300005439	Bacteria	1497
30	Ga0070705_100139865	3300005440	Bacteria	1592
31	Ga0070694_100234994	3300005444	Bacteria	1380
32	Ga0070663_100012396	3300005455	Bacteria	5392
33	Ga0070663_100029531	3300005455	Bacteria	3748
34	Ga0070663_100164603	3300005455	Bacteria	1710
35	Ga0070663_100213667	3300005455	Bacteria	1511
36	Ga0070678_100070205	3300005456	Bacteria	2618
37	Ga0070678_100172765	3300005456	Bacteria	1762
38	Ga0070678_100980887	3300005456	Bacteria	776
39	Ga0070678_101049567	3300005456	Bacteria	751
40	Ga0070662_100184309	3300005457	Bacteria	1647
41	Ga0068867_100297701	3300005459	Bacteria	1329
42	Ga0068867_100551170	3300005459	Bacteria	999
43	Ga0068867_100597605	3300005459	Bacteria	962
44	Ga0070698_100905719	3300005471	Bacteria	828
45	Ga0070699_100196375	3300005518	Bacteria	1794
46	Ga0070684_100280395	3300005535	Bacteria	1527
47	Ga0070697_101188183	3300005536	Bacteria	680
48	Ga0068853_100000731	3300005539	Bacteria	22726
49	Ga0068853_100065731	3300005539	Bacteria	3147
50	Ga0068853_100788138	3300005539	Bacteria	910
51	Ga0070686_100354180	3300005544	Bacteria	1104
52	Ga0070695_100684271	3300005545	Bacteria	813
53	Ga0070696_100944064	3300005546	Bacteria	718
54	Ga0070693_100075865	3300005547	Bacteria	1992
55	Ga0070693_100436668	3300005547	Bacteria	916
56	Ga0070665_100054883	3300005548	Bacteria	3995
57	Ga0070665_100055713	3300005548	Bacteria	3965
58	Ga0070665_100071953	3300005548	Bacteria	3465
59	Ga0070665_100074085	3300005548	Bacteria	3410
60	Ga0070665_100114353	3300005548	Bacteria	2701
61	Ga0070665_100553633	3300005548	Bacteria	1162
62	Ga0068855_100851806	3300005563	Bacteria	966
63	Ga0070664_100067230	3300005564	Bacteria	3063
64	Ga0070664_100112569	3300005564	Bacteria	2377
65	Ga0068857_100258763	3300005577	Bacteria	1597
66	Ga0068854_100101271	3300005578	Bacteria	2160
67	Ga0068856_100000206	3300005614	Bacteria	63167
68	Ga0068856_100073356	3300005614	Bacteria	3389
69	Ga0068856_100589416	3300005614	Bacteria	1133
70	Ga0068856_100712590	3300005614	Bacteria	1024
71	Ga0070702_100062203	3300005615	Bacteria	2176
72	Ga0068852_100118008	3300005616	Bacteria	2424
73	Ga0068852_101038861	3300005616	Bacteria	839
74	Ga0068852_101544438	3300005616	Bacteria	686
75	Ga0068859_100127354	3300005617	Bacteria	2616
76	Ga0068864_100483466	3300005618	Bacteria	1189
77	Ga0068861_100041230	3300005719	Bacteria	3457
78	Ga0068861_100197655	3300005719	Bacteria	1686
79	Ga0068861_102116506	3300005719	Bacteria	563
80	Ga0068863_100149086	3300005841	Bacteria	2238
81	Ga0068863_100896586	3300005841	Bacteria	887
82	Ga0068858_101048645	3300005842	Bacteria	800
83	Ga0068860_100131854	3300005843	Bacteria	2398
84	Ga0068860_100341816	3300005843	Bacteria	1472
85	Ga0068862_100115773	3300005844	Bacteria	2358
86	Ga0068862_100173328	3300005844	Bacteria	1932
87	Ga0068862_100179479	3300005844	Bacteria	1899
88	Ga0068862_100525547	3300005844	Bacteria	1126
89	Ga0068862_100830055	3300005844	Bacteria	904
90	Ga0081455_10057658	3300005937	Bacteria	3291
91	Ga0081455_10117426	3300005937	Bacteria	2102
92	Ga0081540_1033602	3300005983	Bacteria	2782
93	Ga0081540_1046034	3300005983	Bacteria	2207
94	Ga0081540_1047126	3300005983	Bacteria	2170
95	Ga0081540_1177995	3300005983	Bacteria	800
96	Ga0075365_10016751	3300006038	Bacteria	4467
97	Ga0075365_10150409	3300006038	Bacteria	1619
98	Ga0075368_10223787	3300006042	Bacteria	800
99	Ga0075368_10238133	3300006042	Bacteria	776
100	Ga0075363_100002156	3300006048	Bacteria	7917
101	Ga0075363_100293972	3300006048	Bacteria	942
102	Ga0075432_10131370	3300006058	Bacteria	949
103	Ga0070716_100183411	3300006173	Bacteria	1376
104	Ga0070716_100677731	3300006173	Bacteria	785
105	Ga0070712_100613082	3300006175	Bacteria	922
106	Ga0075367_10031333	3300006178	Bacteria	3053
107	Ga0075367_10221756	3300006178	Bacteria	1183
108	Ga0075369_10325983	3300006186	Bacteria	719
109	Ga0097621_100606770	3300006237	Bacteria	1001
110	Ga0075370_10006776	3300006353	Bacteria	5789
111	Ga0075370_10025361	3300006353	Bacteria	3279
112	Ga0068871_100103620	3300006358	Bacteria	2386
113	Ga0068871_100154220	3300006358	Bacteria	1960
114	Ga0068871_101166703	3300006358	Bacteria	722
115	Ga0075433_10106165	3300006852	Bacteria	2489
116	Ga0075434_100033109	3300006871	Bacteria	5099
117	Ga0075429_100406816	3300006880	Bacteria	1192
118	Ga0068865_100028368	3300006881	Bacteria	3705
119	Ga0068865_101258139	3300006881	Bacteria	657
120	Ga0097620_100127357	3300006931	Bacteria	2616
121	Ga0099824_1022643	3300006942	Bacteria	4091
122	Ga0079104_1003965	3300006946	Bacteria	6589
123	Ga0075435_100171604	3300007076	Bacteria	1830
124	Ga0105251_10259547	3300009011	Bacteria	784
125	Ga0105244_10331300	3300009036	Bacteria	702
126	Ga0105240_10092619	3300009093	Bacteria	3690
127	Ga0105240_10142645	3300009093	Bacteria	2862
128	Ga0105240_10500533	3300009093	Bacteria	1351
129	Ga0105240_11520335	3300009093	Bacteria	702
130	Ga0111539_10456322	3300009094	Bacteria	1488
131	Ga0105245_10563656	3300009098	Bacteria	1162
132	Ga0105247_10014169	3300009101	Bacteria	4783
133	Ga0105247_10125352	3300009101	Bacteria	1669
134	Ga0105247_10547215	3300009101	Bacteria	850
135	Ga0114129_10619231	3300009147	Bacteria	1400
136	Ga0105243_10331677	3300009148	Bacteria	1390
137	Ga0105243_10369628	3300009148	Bacteria	1323
138	Ga0105243_10533691	3300009148	Bacteria	1118
139	Ga0105243_10968145	3300009148	Bacteria	851
140	Ga0105243_11613226	3300009148	Bacteria	676
141	Ga0105241_10065234	3300009174	Bacteria	2813
142	Ga0105242_10277960	3300009176	Bacteria	1520
143	Ga0105242_10652458	3300009176	Bacteria	1023
144	Ga0105242_10862525	3300009176	Bacteria	902
145	Ga0105242_11413512	3300009176	Bacteria	724
146	Ga0105248_10079923	3300009177	Bacteria	3675
147	Ga0105248_10123885	3300009177	Bacteria	2915
148	Ga0105248_10252967	3300009177	Bacteria	1983
149	Ga0105248_11431007	3300009177	Bacteria	782
150	Ga0105237_10121031	3300009545	Bacteria	2612
151	Ga0105238_10521453	3300009551	Bacteria	1191
152	Ga0105238_10702564	3300009551	Bacteria	1023
153	Ga0105249_10539724	3300009553	Bacteria	1216
154	Ga0105249_10846744	3300009553	Bacteria	980
155	Ga0105249_11608757	3300009553	Bacteria	722
156	Ga0105239_10011854	3300010375	Bacteria	9725
157	Ga0105239_10304685	3300010375	Bacteria	1794
158	Ga0105239_10460735	3300010375	Bacteria	1443
159	Ga0105239_10604796	3300010375	Bacteria	1251
160	Ga0105239_10739902	3300010375	Bacteria	1125
161	Ga0105246_10185218	3300011119	Bacteria	1607
162	Ga0105246_10188991	3300011119	Bacteria	1593
163	Ga0105246_11249418	3300011119	Bacteria	686
164	Ga0157324_1033049	3300012506	Bacteria	596
165	Ga0157369_10004161	3300013105	Bacteria	17142
166	Ga0157374_10060853	3300013296	Bacteria	3535
167	Ga0157374_10154254	3300013296	Bacteria	2234
168	Ga0157378_10095213	3300013297	Bacteria	2712
169	Ga0163162_10074527	3300013306	Bacteria	3453
170	Ga0163162_11129027	3300013306	Bacteria	888
171	Ga0157372_11093136	3300013307	Bacteria	923
172	Ga0157375_10008002	3300013308	Bacteria	9257
173	Ga0157375_10043306	3300013308	Bacteria	4365
174	Ga0157375_10147111	3300013308	Bacteria	2487
175	Ga0157375_11177957	3300013308	Bacteria	898
176	Ga0157375_11451136	3300013308	Bacteria	809
177	Ga0163163_10104090	3300014325	Bacteria	2863
178	Ga0163163_10124597	3300014325	Bacteria	2613
179	Ga0163163_10250617	3300014325	Bacteria	1821
180	Ga0163163_10338651	3300014325	Bacteria	1559
181	Ga0163163_11020101	3300014325	Bacteria	891
182	Ga0163163_11047930	3300014325	Bacteria	879
183	Ga0163163_11177192	3300014325	Bacteria	829
184	Ga0157380_10081721	3300014326	Bacteria	2644
185	Ga0157380_10133480	3300014326	Bacteria	2121
186	Ga0157377_10069423	3300014745	Bacteria	2033
187	Ga0157377_10097203	3300014745	Bacteria	1748
188	Ga0157379_10176892	3300014968	Bacteria	1927
189	Ga0157379_10522925	3300014968	Bacteria	1102
190	Ga0157376_10098338	3300014969	Bacteria	2551
191	Ga0157376_10118353	3300014969	Bacteria	2344
192	Ga0157376_10263058	3300014969	Bacteria	1617
193	Ga0157376_10537106	3300014969	Bacteria	1155
194	Ga0157376_10614774	3300014969	Bacteria	1083
195	Ga0163161_10234933	3300017792	Bacteria	1424
196	Ga0163161_10437801	3300017792	Bacteria	1055
197	Ga0163161_10554850	3300017792	Bacteria	942
198	Ga0224712_10286523	3300022467	Bacteria	768
199	Ga0209026_1000100	3300025250	Bacteria	156131
200	Ga0209455_1012103	3300025272	Bacteria	2083
201	Ga0207697_10024285	3300025315	Bacteria	2482
202	Ga0207653_10056240	3300025885	Bacteria	1319
203	Ga0207688_10047497	3300025901	Bacteria	2397
204	Ga0207688_10470087	3300025901	Bacteria	785
205	Ga0207647_10028953	3300025904	Bacteria	3591
206	Ga0207647_10144454	3300025904	Bacteria	1393
207	Ga0207643_10342679	3300025908	Bacteria	937
208	Ga0207705_11025380	3300025909	Bacteria	637
209	Ga0207654_10080565	3300025911	Bacteria	1958
210	Ga0207695_10025185	3300025913	Bacteria	6670
211	Ga0207695_10440695	3300025913	Bacteria	1186
212	Ga0207663_10070962	3300025916	Bacteria	2246
213	Ga0207657_10186759	3300025919	Bacteria	1673
214	Ga0207657_10579135	3300025919	Bacteria	876
215	Ga0207649_10146642	3300025920	Bacteria	1621
216	Ga0207681_11472550	3300025923	Bacteria	571
217	Ga0207694_10815951	3300025924	Bacteria	788
218	Ga0207694_11127360	3300025924	Bacteria	664
219	Ga0207650_11237440	3300025925	Bacteria	635
220	Ga0207659_10048310	3300025926	Bacteria	3014
221	Ga0207659_10221498	3300025926	Bacteria	1522
222	Ga0207687_10078584	3300025927	Bacteria	2376
223	Ga0207700_10040307	3300025928	Bacteria	3408
224	Ga0207700_10326764	3300025928	Bacteria	1330
225	Ga0207644_10183345	3300025931	Bacteria	1642
226	Ga0207690_10483082	3300025932	Bacteria	1000
227	Ga0207706_10153239	3300025933	Bacteria	2027
228	Ga0207686_10100556	3300025934	Bacteria	1930
229	Ga0207670_10993919	3300025936	Bacteria	706
230	Ga0207669_10046343	3300025937	Bacteria	2569
231	Ga0207669_10083234	3300025937	Bacteria	2057
232	Ga0207665_10669566	3300025939	Bacteria	814
233	Ga0207691_10107245	3300025940	Bacteria	2487
234	Ga0207691_10164078	3300025940	Bacteria	1947
235	Ga0207691_10463824	3300025940	Bacteria	1077
236	Ga0207711_10072526	3300025941	Bacteria	2991
237	Ga0207711_10170746	3300025941	Bacteria	1973
238	Ga0207689_10012457	3300025942	Bacteria	7265
239	Ga0207689_10253729	3300025942	Bacteria	1455
240	Ga0207689_10445646	3300025942	Bacteria	1082
241	Ga0207661_10189388	3300025944	Bacteria	1803
242	Ga0207679_10381472	3300025945	Bacteria	1236
243	Ga0207667_10432498	3300025949	Bacteria	1338
244	Ga0207667_10531690	3300025949	Bacteria	1190
245	Ga0207667_10639082	3300025949	Bacteria	1071
246	Ga0207651_10097340	3300025960	Bacteria	2173
247	Ga0207651_10197599	3300025960	Bacteria	1609
248	Ga0207651_10630187	3300025960	Bacteria	940
249	Ga0207668_10499849	3300025972	Bacteria	1046
250	Ga0207668_10645642	3300025972	Bacteria	926
251	Ga0207640_10078964	3300025981	Bacteria	2242
252	Ga0207640_10970702	3300025981	Bacteria	746
253	Ga0207677_10126473	3300026023	Bacteria	1932
254	Ga0207677_10188874	3300026023	Bacteria	1628
255	Ga0207677_10190041	3300026023	Bacteria	1623
256	Ga0207703_10123298	3300026035	Bacteria	2227
257	Ga0207703_10271411	3300026035	Bacteria	1537
258	Ga0207703_10400480	3300026035	Bacteria	1273
259	Ga0207639_10001880	3300026041	Bacteria	14114
260	Ga0207639_10049830	3300026041	Bacteria	3178
261	Ga0207639_10204532	3300026041	Bacteria	1696
262	Ga0207639_10274138	3300026041	Bacteria	1481
263	Ga0207678_10011040	3300026067	Bacteria	7934
264	Ga0207678_10020512	3300026067	Bacteria	5794
265	Ga0207678_10075067	3300026067	Bacteria	2896
266	Ga0207678_10567372	3300026067	Bacteria	993
267	Ga0207708_10367225	3300026075	Bacteria	1184
268	Ga0207708_10458277	3300026075	Bacteria	1063
269	Ga0207702_10000075	3300026078	Bacteria	112303
270	Ga0207702_10159216	3300026078	Bacteria	2061
271	Ga0207702_10342933	3300026078	Bacteria	1427
272	Ga0207641_10298406	3300026088	Bacteria	1521
273	Ga0207648_10433046	3300026089	Bacteria	1195
274	Ga0207674_10501004	3300026116	Bacteria	1173
275	Ga0207675_100036814	3300026118	Bacteria	4564
276	Ga0207675_100110251	3300026118	Bacteria	2597
277	Ga0207675_100367474	3300026118	Bacteria	1413
278	Ga0207675_101206147	3300026118	Bacteria	777
279	Ga0207675_101336321	3300026118	Bacteria	737
280	Ga0207683_10303215	3300026121	Bacteria	1461
281	Ga0207683_10483620	3300026121	Bacteria	1143
282	Ga0207698_11105985	3300026142	Bacteria	805
283	Ga0209281_1002748	3300027111	Bacteria	6575
284	Ga0209589_1000003	3300027357	Bacteria	629130
285	Ga0209489_100003	3300027361	Bacteria	663105
286	Ga0209700_100003	3300027363	Bacteria	663105
287	Ga0207428_10244452	3300027907	Bacteria	1340
288	Ga0268266_10003029	3300028379	Bacteria	17259
289	Ga0268266_10033835	3300028379	Bacteria	4343
290	Ga0268266_10099223	3300028379	Bacteria	2563
291	Ga0268266_10441798	3300028379	Bacteria	1235
292	Ga0268266_11363805	3300028379	Bacteria	684
293	Ga0268265_10021839	3300028380	Bacteria	4490
294	Ga0268265_10918418	3300028380	Bacteria	860
295	Ga0268265_11350350	3300028380	Bacteria	714
296	Ga0268264_10562045	3300028381	Bacteria	1120
297	Ga0265330_10026510	3300031235	Bacteria	2621
298	Ga0307509_10025057	3300031507	Bacteria	6668
299	Ga0307508_10025944	3300031616	Bacteria	5314
300	Ga0307508_10195689	3300031616	Bacteria	1623
301	Ga0265314_10003071	3300031711	Bacteria	16455
302	Ga0307516_10016663	3300031730	Bacteria	7675
303	Ga0307516_10062333	3300031730	Bacteria	3614
304	Ga0307416_100385730	3300032002	Bacteria	1433
305	Ga0307416_100391053	3300032002	Bacteria	1425
306	Ga0307416_100729828	3300032002	Bacteria	1082
307	Ga0307411_10392529	3300032005	Bacteria	1145
308	Ga0307415_100501499	3300032126	Bacteria	1061
309	Ga0307510_10002931	3300033180	Bacteria	19626
310	Ga0307510_10470091	3300033180	Bacteria	699
311	Ga0307510_10519705	3300033180	Bacteria	634
312	Ga0315911_1000001	3300033442	Bacteria	1088602
313	Ga0373934_0068928	3300035086	Bacteria	1413
314	Ga0373953_0168231	3300035117	Bacteria	943
315	Ga0373954_0266810	3300035118	Bacteria	843
316	Ga0373954_0335301	3300035118	Bacteria	747
317	Ga0373943_0479246	3300035170	Bacteria	725
318	Ga0373955_0358680	3300035172	Bacteria	883
319	Ga0373931_0009173	3300035691	Bacteria	4724
320	Ga0373935_0665308	3300035692	Bacteria	764
321	Ga0373927_0013136	3300035695	Bacteria	5508
322	Ga0373927_0049614	3300035695	Bacteria	2714
323	Ga0373927_0321474	3300035695	Bacteria	1019
324	Ga0373947_0498985	3300035725	Bacteria	827
325	Ga0373937_0018157	3300036401	Bacteria	6275
326	Ga0395905_0359396	3300037471	Bacteria	1349
327	Ga0395901_0070152	3300038443	Bacteria	3651
328	Ga0395901_0335807	3300038443	Bacteria	1562
329	Ga0395901_1758902	3300038443	Unclassified	570
330	Ga0451791_0911118	3300041451	Bacteria	712
331	Ga0451791_1306229	3300041451	Bacteria	606
332	Ga0451791_1379949	3300041451	Bacteria	709
333	Ga0451795_1181371	3300041456	Bacteria	1109
334	Ga0451800_0699070	3300041459	Bacteria	841
335	Ga0451800_1244742	3300041459	Bacteria	643
336	Ga0451839_0877884	3300041496	Bacteria	857
337	Ga0451853_0418684	3300041512	Bacteria	1157
338	Ga0495592_0339524	3300046454	Bacteria	966
339	Ga0495603_0073139	3300046455	Bacteria	2014
340	Ga0495603_0094153	3300046455	Bacteria	1750
341	Ga0495590_0080207	3300046457	Bacteria	1149
342	Ga0495629_0506179	3300046459	Bacteria	814
343	Ga0495638_0121382	3300046460	Bacteria	1544
344	Ga0495641_0059567	3300046461	Bacteria	1726
345	Ga0495651_0480004	3300046462	Bacteria	799
346	Ga0495650_0147314	3300046471	Bacteria	848
347	Ga0495584_0033170	3300046491	Bacteria	2612
348	Ga0495585_0022874	3300046492	Bacteria	3588
349	Ga0495594_0120821	3300046499	Bacteria	1481
350	Ga0495620_0027207	3300046515	Bacteria	2679
351	Ga0495620_0223734	3300046515	Bacteria	720
352	Ga0495643_0208076	3300046522	Bacteria	935
353	Ga0495652_0094473	3300046529	Bacteria	2439
354	Ga0495598_0037463	3300046537	Bacteria	1399
355	Ga0495622_0146177	3300046557	Bacteria	1071
356	Ga0495622_0173037	3300046557	Bacteria	970
357	Ga0495656_0370099	3300046615	Bacteria	745
358	Ga0495668_0274595	3300046616	Bacteria	923
359	Ga0495668_0301498	3300046616	Bacteria	878
360	Ga0495625_0078824	3300046660	Bacteria	2299
361	Ga0495635_0334149	3300046663	Bacteria	1013
362	Ga0495588_0163057	3300046674	Bacteria	1179
363	Ga0495646_0195367	3300046680	Bacteria	1104
364	Ga0495669_0021107	3300046684	Bacteria	2824
365	Ga0495613_0120196	3300046689	Bacteria	1887
366	Ga0495670_0149305	3300046691	Bacteria	1225
367	Ga0495671_0304599	3300046692	Bacteria	766
368	Ga0495581_0375972	3300047315	Bacteria	829
369	Ga0495674_0492560	3300047319	Bacteria	981
370	Ga0495680_0247738	3300047322	Bacteria	1264
371	Ga0495677_0175794	3300047445	Bacteria	829
372	Ga0495681_0111093	3300047470	Bacteria	1187
373	Ga0495686_0313844	3300047472	Bacteria	861
374	Ga0495593_0277096	3300047673	Bacteria	839
375	Ga0495593_0566712	3300047673	Bacteria	570
376	Ga0495602_0333802	3300048088	Bacteria	1099
377	Ga0496100_0021221	3300048903	Bacteria	3909
378	Ga0496100_0134401	3300048903	Bacteria	1746
379	Ga0496101_0121957	3300048904	Bacteria	1971
380	Ga0496102_0010923	3300048905	Bacteria	7821
381	Ga0496102_0034726	3300048905	Bacteria	4537
382	Ga0496102_0155432	3300048905	Bacteria	2150
383	Ga0496102_0195345	3300048905	Bacteria	1907
384	Ga0496102_0220795	3300048905	Bacteria	1787
385	Ga0496103_0358960	3300048906	Bacteria	937
386	Ga0496104_0072347	3300048907	Bacteria	3278
387	Ga0496104_0132697	3300048907	Bacteria	2392
388	Ga0496105_0013417	3300048908	Bacteria	6503
389	Ga0496106_0071470	3300048909	Bacteria	2652
390	Ga0496106_0291737	3300048909	Bacteria	1308
391	Ga0496107_0004668	3300048910	Bacteria	9298
392	Ga0496107_0018119	3300048910	Bacteria	4954
393	Ga0496108_0009826	3300048911	Bacteria	7752
394	Ga0496108_0025680	3300048911	Bacteria	4857
395	Ga0496109_0121063	3300048912	Bacteria	2438
396	Ga0496109_0129823	3300048912	Bacteria	2351
397	Ga0496109_0217615	3300048912	Bacteria	1796
398	Ga0496110_0022169	3300048913	Bacteria	5388
399	Ga0496110_0627697	3300048913	Bacteria	973
400	Ga0496111_0022030	3300048914	Bacteria	4456
401	Ga0496111_0029678	3300048914	Bacteria	3885
402	Ga0496111_0063155	3300048914	Bacteria	2686
403	Ga0496112_0023082	3300048915	Bacteria	5938
404	Ga0496112_0030050	3300048915	Bacteria	5257
405	Ga0496113_0006251	3300048916	Bacteria	7523
406	Ga0496113_0603606	3300048916	Bacteria	879
407	Ga0496114_0016576	3300048917	Bacteria	5939
408	Ga0496114_0103309	3300048917	Bacteria	2436
409	Ga0496114_0448636	3300048917	Bacteria	1142
410	Ga0496115_0011145	3300048918	Bacteria	6737
411	Ga0496115_0062742	3300048918	Bacteria	2998
412	Ga0496115_0074560	3300048918	Bacteria	2755
413	Ga0496115_0107356	3300048918	Bacteria	2292
414	Ga0496117_0161989	3300048920	Bacteria	1309
415	Ga0496117_0387608	3300048920	Bacteria	709
416	Ga0496118_0320232	3300048921	Bacteria	842
417	Ga0496119_0044799	3300048922	Bacteria	2781
418	Ga0496121_0168217	3300048924	Bacteria	1595
419	Ga0496121_0241519	3300048924	Bacteria	1258
420	Ga0496121_0422768	3300048924	Bacteria	866
421	Ga0496122_0033340	3300048925	Bacteria	4238
422	Ga0496126_0013331	3300048929	Bacteria	8369
423	Ga0496126_0093318	3300048929	Bacteria	2643
424	Ga0496126_0124438	3300048929	Bacteria	2233
425	Ga0496126_0164584	3300048929	Bacteria	1893
426	Ga0496126_0226360	3300048929	Bacteria	1568
427	Ga0501031_0023216	3300049568	Bacteria	4044
428	Ga0501031_0309056	3300049568	Bacteria	1024
429	Ga0501032_0026458	3300049569	Bacteria	3990
430	Ga0501033_0000220	3300049570	Bacteria	55046
431	Ga0501033_0005474	3300049570	Bacteria	10052
432	Ga0501033_0137048	3300049570	Bacteria	1771
433	Ga0501033_0181277	3300049570	Unclassified	1510
434	Ga0501033_0200504	3300049570	Bacteria	1425
435	Ga0501033_0412201	3300049570	Bacteria	941
436	Ga0501037_0000047	3300049573	Bacteria	114757
437	Ga0501038_0403968	3300049574	Unclassified	1056
438	Ga0501038_0642807	3300049574	Bacteria	799
439	Ga0501043_0000369	3300049579	Bacteria	40714
440	Ga0501043_0027428	3300049579	Bacteria	4471
441	Ga0501043_0120872	3300049579	Bacteria	2054
442	Ga0501043_0276679	3300049579	Bacteria	1287
443	Ga0501046_0795354	3300049580	Bacteria	663
444	Ga0501047_0043327	3300049581	Bacteria	4347
445	Ga0501047_0260730	3300049581	Bacteria	1581
446	Ga0501047_0286692	3300049581	Unclassified	1491
447	Ga0501047_0306696	3300049581	Unclassified	1429
448	Ga0501047_0819961	3300049581	Unclassified	745
449	Ga0501067_0021274	3300049583	Bacteria	3589
450	Ga0501067_0143737	3300049583	Bacteria	1329
451	Ga0501067_0301843	3300049583	Unclassified	891
452	Ga0501068_0011053	3300049584	Bacteria	5082
453	Ga0501068_0229586	3300049584	Unclassified	1180
454	Ga0501068_0599335	3300049584	Bacteria	718
455	Ga0501069_0000073	3300049585	Bacteria	50646
456	Ga0501069_0007678	3300049585	Bacteria	5660
457	Ga0501069_0046848	3300049585	Bacteria	2399
458	Ga0501069_0380945	3300049585	Bacteria	833
459	Ga0501070_0000160	3300049586	Bacteria	61662
460	Ga0501070_0000385	3300049586	Bacteria	40440
461	Ga0501070_0002485	3300049586	Bacteria	16163
462	Ga0501070_0013229	3300049586	Bacteria	6956
463	Ga0501070_0023435	3300049586	Bacteria	5171
464	Ga0501070_0340351	3300049586	Bacteria	1219
465	Ga0501070_0644806	3300049586	Bacteria	841
466	Ga0501070_1139560	3300049586	Unclassified	600
467	Ga0501072_0762847	3300049588	Unclassified	758
468	Ga0501073_0025192	3300049589	Bacteria	4269
469	Ga0501073_0037664	3300049589	Bacteria	3432
470	Ga0501073_0142580	3300049589	Bacteria	1660
471	Ga0501073_0289714	3300049589	Bacteria	1130
472	Ga0501074_0000390	3300049590	Bacteria	26047
473	Ga0501074_0091298	3300049590	Bacteria	2181
474	Ga0501074_0172106	3300049590	Bacteria	1545
475	Ga0501077_0022562	3300049593	Bacteria	3987
476	Ga0501077_0220984	3300049593	Unclassified	1204
477	Ga0501080_0007130	3300049742	Bacteria	10091
478	Ga0501080_0017080	3300049742	Bacteria	6702
479	Ga0501080_0019404	3300049742	Bacteria	6299
480	Ga0501080_0037521	3300049742	Bacteria	4527
481	Ga0501080_0231277	3300049742	Bacteria	1690
482	Ga0501080_0268099	3300049742	Bacteria	1554
483	Ga0501080_0354361	3300049742	Bacteria	1325
484	Ga0501080_0752844	3300049742	Bacteria	857
485	Ga0501083_0000848	3300049744	Bacteria	20105
486	Ga0501083_0003251	3300049744	Bacteria	11341
487	Ga0501083_0367443	3300049744	Unclassified	935
488	Ga0501035_0000025	3300049822	Bacteria	204195
489	Ga0501035_0002044	3300049822	Bacteria	20109
490	Ga0501035_0003870	3300049822	Bacteria	14283
491	Ga0501035_0004201	3300049822	Bacteria	13687
492	Ga0501035_0151512	3300049822	Bacteria	2012
493	Ga0501035_0371764	3300049822	Bacteria	1193
494	Ga0501035_0508782	3300049822	Bacteria	991
495	Ga0501035_0582680	3300049822	Bacteria	913
496	Ga0501044_0000031	3300049823	Bacteria	173135
497	Ga0501044_0006542	3300049823	Bacteria	12861
498	Ga0501044_0020689	3300049823	Bacteria	7025
499	Ga0501044_0038415	3300049823	Bacteria	4999
500	Ga0501044_0113917	3300049823	Bacteria	2711
501	Ga0501044_1046364	3300049823	Bacteria	687
502	Ga0501045_0933668	3300049824	Bacteria	637
503	nmdc:mga03n38_352_c1	3300050490	Bacteria	11202
504	nmdc:mga00v17_499180_c1	3300050491	Bacteria	789
505	nmdc:mga0yw44_403003_c1	3300050492	Bacteria	925
506	nmdc:mga0yw44_649586_c1	3300050492	Bacteria	717
507	nmdc:mga06z11_69476_c1	3300050494	Bacteria	1860
508	nmdc:mga04h51_151173_c1	3300050495	Bacteria	887
509	nmdc:mga07m45_1291_c1	3300050496	Bacteria	2988
510	nmdc:mga08y16_416151_c1	3300050511	Bacteria	1374
511	nmdc:mga0rr50_266491_c1	3300050513	Bacteria	1426
512	Ga0495655_0066915	3300053083	Bacteria	995
513	Ga0495595_0035246	3300053084	Bacteria	2267
514	Ga0495619_0777859	3300053085	Bacteria	648
515	Ga0500583_0025813	3300053092	Bacteria	2514
516	Ga0500641_0282983	3300053096	Bacteria	686
517	Ga0500658_0238085	3300053134	Bacteria	836
518	Ga0500568_0310631	3300053139	Bacteria	572
519	Ga0500588_0239106	3300053146	Bacteria	680
520	Ga0500589_058039	3300053147	Bacteria	1781
521	Ga0500634_0064749	3300053161	Bacteria	1930
522	Ga0500645_082603	3300053730	Bacteria	916
523	Ga0501084_0046183	3300054114	Bacteria	3648
524	Ga0501084_1199737	3300054114	Bacteria	637
525	Ga0501082_0091533	3300060353	Bacteria	2626
526	Ga0501082_0180009	3300060353	Bacteria	1838
527	Ga0501082_0206959	3300060353	Bacteria	1707
528	Ga0501082_1134474	3300060353	Unclassified	683

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300031730	Ga0307516_10062333	Ga0307516_100623332	153
2	3300031730	Ga0307516_10016663	Ga0307516_100166639	155
3	3300031616	Ga0307508_10025944	Ga0307508_100259443	157
4	3300032002	Ga0307416_100385730	Ga0307416_1003857302	157
5	3300032005	Ga0307411_10392529	Ga0307411_103925291	157
6	3300009177	Ga0105248_11431007	Ga0105248_114310072	158
7	3300032002	Ga0307416_100729828	Ga0307416_1007298282	158
8	3300005455	Ga0070663_100029531	Ga0070663_1000295314	159
9	3300026041	Ga0207639_10204532	Ga0207639_102045322	159
10	3300047673	Ga0495593_0566712	Ga0495593_0566712_64_552	159
11	3300005455	Ga0070663_100164603	Ga0070663_1001646032	160
12	3300005456	Ga0070678_101049567	Ga0070678_1010495671	160
13	3300005459	Ga0068867_100297701	Ga0068867_1002977012	160
14	3300009148	Ga0105243_10369628	Ga0105243_103696282	160
15	3300009148	Ga0105243_10968145	Ga0105243_109681451	160
16	3300014326	Ga0157380_10081721	Ga0157380_100817212	160
17	3300017792	Ga0163161_10554850	Ga0163161_105548502	160
18	3300025901	Ga0207688_10470087	Ga0207688_104700871	160
19	3300026067	Ga0207678_10567372	Ga0207678_105673722	160
20	3300031235	Ga0265330_10026510	Ga0265330_100265103	160
21	3300031711	Ga0265314_10003071	Ga0265314_100030714	160
22	3300025909	Ga0207705_11025380	Ga0207705_110253801	161
23	3300046616	Ga0495668_0301498	Ga0495668_0301498_11_505	161
24	3300035695	Ga0373927_0321474	Ga0373927_0321474_63_563	162
25	3300005329	Ga0070683_100076534	Ga0070683_1000765343	163
26	3300005331	Ga0070670_100388143	Ga0070670_1003881432	163
27	3300005338	Ga0068868_100048761	Ga0068868_1000487612	163
28	3300005364	Ga0070673_101113529	Ga0070673_1011135291	163
29	3300005547	Ga0070693_100436668	Ga0070693_1004366682	163
30	3300005564	Ga0070664_100067230	Ga0070664_1000672303	163
31	3300005614	Ga0068856_100589416	Ga0068856_1005894162	163
32	3300005616	Ga0068852_100118008	Ga0068852_1001180083	163
33	3300005618	Ga0068864_100483466	Ga0068864_1004834662	163
34	3300005841	Ga0068863_100896586	Ga0068863_1008965862	163
35	3300006173	Ga0070716_100183411	Ga0070716_1001834112	163
36	3300006881	Ga0068865_100028368	Ga0068865_1000283682	163
37	3300009101	Ga0105247_10014169	Ga0105247_100141692	163
38	3300010375	Ga0105239_10304685	Ga0105239_103046852	163
39	3300013105	Ga0157369_10004161	Ga0157369_100041617	163
40	3300013296	Ga0157374_10060853	Ga0157374_100608533	163
41	3300013306	Ga0163162_10074527	Ga0163162_100745273	163
42	3300013308	Ga0157375_10008002	Ga0157375_100080025	163
43	3300014325	Ga0163163_10124597	Ga0163163_101245972	163
44	3300014745	Ga0157377_10069423	Ga0157377_100694233	163
45	3300014969	Ga0157376_10098338	Ga0157376_100983382	163
46	3300025901	Ga0207688_10047497	Ga0207688_100474972	163
47	3300025944	Ga0207661_10189388	Ga0207661_101893882	163
48	3300025945	Ga0207679_10381472	Ga0207679_103814722	163
49	3300026023	Ga0207677_10126473	Ga0207677_101264732	163
50	3300026067	Ga0207678_10020512	Ga0207678_100205126	163
51	3300026078	Ga0207702_10159216	Ga0207702_101592162	163
52	3300026121	Ga0207683_10303215	Ga0207683_103032152	163
53	3300041456	Ga0451795_1181371	Ga0451795_1181371_132_653	163
54	3300041496	Ga0451839_0877884	Ga0451839_0877884_25_546	163
55	3300048903	Ga0496100_0021221	Ga0496100_0021221_571_1092	163
56	3300048905	Ga0496102_0010923	Ga0496102_0010923_601_1122	163
57	3300048907	Ga0496104_0072347	Ga0496104_0072347_89_610	163
58	3300048909	Ga0496106_0071470	Ga0496106_0071470_1321_1842	163
59	3300048910	Ga0496107_0004668	Ga0496107_0004668_8103_8624	163
60	3300048911	Ga0496108_0009826	Ga0496108_0009826_3116_3637	163
61	3300048912	Ga0496109_0129823	Ga0496109_0129823_1561_2082	163
62	3300048913	Ga0496110_0627697	Ga0496110_0627697_194_715	163
63	3300048914	Ga0496111_0029678	Ga0496111_0029678_2185_2706	163
64	3300048916	Ga0496113_0006251	Ga0496113_0006251_609_1130	163
65	3300048918	Ga0496115_0011145	Ga0496115_0011145_1172_1693	163
66	3300053134	Ga0500658_0238085	Ga0500658_0238085_182_709	163
67	3300025972	Ga0207668_10499849	Ga0207668_104998492	164
68	3300005343	Ga0070687_100415440	Ga0070687_1004154402	165
69	3300006942	Ga0099824_1022643	Ga0099824_10226432	165
70	3300027357	Ga0209589_1000003	Ga0209589_100000341	165
71	3300027361	Ga0209489_100003	Ga0209489_10000392	165
72	3300027363	Ga0209700_100003	Ga0209700_10000392	165
73	3300028380	Ga0268265_11350350	Ga0268265_113503501	165
74	3300041451	Ga0451791_1306229	Ga0451791_1306229_16_525	165
75	3300033180	Ga0307510_10470091	Ga0307510_104700912	166
76	iso_pu_bacteria	2511231052	2511499719	166
77	iso_pu_bacteria	2513237086	2513587491	166
78	iso_pu_bacteria	2524023210	2524465250	166
79	iso_pu_bacteria	2551306084	2551679655	166
80	iso_pu_bacteria	2551306085	2551689883	166
81	iso_pu_bacteria	2551306086	2551691875	166
82	iso_pu_bacteria	2551306087	2551704772	166
83	iso_pu_bacteria	2551306090	2551724190	166
84	iso_pu_bacteria	2551306092	2551735211	166
85	iso_pu_bacteria	2551306093	2551742725	166
86	iso_pu_bacteria	2690316117	2692316696	166
87	iso_pu_bacteria	2728368998	2728750390	166
88	iso_pu_bacteria	2838074704	2838080791	166
89	iso_pu_bacteria	2847417321	2847418238	166
90	iso_pu_bacteria	2848992105	2848993213	166
91	iso_pu_bacteria	2855839649	2855845411	166
92	iso_pu_bacteria	2855872281	2855878806	166
93	iso_pu_bacteria	2876808645	2876814398	166
94	iso_pu_bacteria	2879110137	2879118482	166
95	iso_pu_bacteria	2889033259	2889040539	166
96	iso_pu_bacteria	2896384573	2896385993	166
97	iso_pu_bacteria	2915986958	2915988154	166
98	iso_pu_bacteria	2915993759	2915999969	166
99	iso_pu_bacteria	2916035215	2916040708	166
100	iso_pu_bacteria	2916068649	2916075372	166
101	iso_pu_bacteria	2921201388	2921201497	166
102	iso_pu_bacteria	2921208531	2921209769	166
103	iso_pu_bacteria	2921289301	2921289898	166
104	iso_pu_bacteria	2921296804	2921299931	166
105	iso_pu_bacteria	2924165586	2924166919	166
106	iso_pu_bacteria	2924186466	2924188600	166
107	iso_pu_bacteria	2924193448	2924194202	166
108	iso_pu_bacteria	2924214083	2924214865	166
109	iso_pu_bacteria	2924228884	2924231574	166
110	iso_pu_bacteria	2936996657	2937000526	166
111	iso_pu_bacteria	2937049772	2937050569	166
112	iso_pu_bacteria	2937063883	2937070266	166
113	iso_pu_bacteria	2937091812	2937093358	166
114	iso_pu_bacteria	2937106411	2937107794	166
115	iso_pu_bacteria	2937113482	2937118643	166
116	iso_pu_bacteria	2957388812	2957391560	166
117	iso_pu_bacteria	2957422303	2957422505	166
118	iso_pu_bacteria	2957430029	2957436623	166
119	iso_pu_bacteria	2957457609	2957461384	166
120	iso_pu_bacteria	2957484790	2957488557	166
121	iso_pu_bacteria	2957505466	2957512551	166
122	iso_pu_bacteria	2960645483	2960650879	166
123	iso_pu_bacteria	2964628898	2964629417	166
124	iso_pu_bacteria	2964636051	2964643119	166
125	iso_pu_bacteria	2964643177	2964649455	166
126	iso_pu_bacteria	2964649959	2964655881	166
127	iso_pu_bacteria	2964656573	2964657597	166
128	iso_pu_bacteria	2964670856	2964673604	166
129	iso_pu_bacteria	2964698721	2964699385	166
130	iso_pu_bacteria	2967664464	2967671549	166
131	iso_pu_bacteria	2967671571	2967676880	166
132	iso_pu_bacteria	2967714385	2967719244	166
133	iso_pu_bacteria	2967721400	2967724014	166
134	iso_pu_bacteria	2967735183	2967741138	166
135	iso_pu_bacteria	2970033650	2970040029	166
136	iso_pu_bacteria	2970040964	2970046343	166
137	iso_pu_bacteria	2970054988	2970057526	166
138	iso_pu_bacteria	2970068827	2970074751	166
139	iso_pu_bacteria	2970116247	2970121848	166
140	iso_pu_bacteria	2970149975	2970155771	166
141	iso_pu_bacteria	2970184632	2970185847	166
142	iso_pu_bacteria	2970191845	2970194535	166
143	iso_pu_bacteria	2977537788	2977542914	166
144	iso_pu_bacteria	2977572785	2977578218	166
145	iso_pu_bacteria	2977579622	2977582064	166
146	iso_pu_bacteria	8006984368	8006988179	166
147	3300005535	Ga0070684_100280395	Ga0070684_1002803952	167
148	3300005614	Ga0068856_100712590	Ga0068856_1007125902	167
149	3300005616	Ga0068852_101544438	Ga0068852_1015444382	167
150	3300005937	Ga0081455_10057658	Ga0081455_100576583	167
151	3300009093	Ga0105240_10092619	Ga0105240_100926192	167
152	3300009553	Ga0105249_11608757	Ga0105249_116087571	167
153	3300011119	Ga0105246_11249418	Ga0105246_112494181	167
154	3300013308	Ga0157375_10043306	Ga0157375_100433063	167
155	3300014969	Ga0157376_10118353	Ga0157376_101183532	167
156	3300017792	Ga0163161_10234933	Ga0163161_102349332	167
157	3300022467	Ga0224712_10286523	Ga0224712_102865232	167
158	3300025913	Ga0207695_10025185	Ga0207695_100251853	167
159	3300025981	Ga0207640_10970702	Ga0207640_109707022	167
160	3300026078	Ga0207702_10342933	Ga0207702_103429332	167
161	3300033180	Ga0307510_10519705	Ga0307510_105197051	167
162	3300038443	Ga0395901_0070152	Ga0395901_0070152_2445_2960	167
163	3300041459	Ga0451800_1244742	Ga0451800_1244742_55_573	167
164	3300046537	Ga0495598_0037463	Ga0495598_0037463_156_671	167
165	3300046615	Ga0495656_0370099	Ga0495656_0370099_191_706	167
166	3300047445	Ga0495677_0175794	Ga0495677_0175794_171_683	167
167	3300047470	Ga0495681_0111093	Ga0495681_0111093_646_1161	167
168	3300048915	Ga0496112_0030050	Ga0496112_0030050_95_610	167
169	3300048929	Ga0496126_0124438	Ga0496126_0124438_66_590	167
170	3300049586	Ga0501070_0340351	Ga0501070_0340351_158_799	167
171	3300049586	Ga0501070_1139560	Ga0501070_1139560_13_522	167
172	3300049822	Ga0501035_0371764	Ga0501035_0371764_115_624	167
173	3300049822	Ga0501035_0508782	Ga0501035_0508782_448_957	167
174	3300053083	Ga0495655_0066915	Ga0495655_0066915_294_809	167
175	iso_pu_bacteria	2513237096	2513656725	167
176	iso_pu_bacteria	2513237137	2513857915	167
177	iso_pu_bacteria	2513237145	2513917910	167
178	iso_pu_bacteria	2517572143	2517893044	167
179	iso_pu_bacteria	2524023228	2524536843	167
180	iso_pu_bacteria	2667528175	2671117665	167
181	iso_pu_bacteria	2791355197	2793070120	167
182	iso_pu_bacteria	2885374607	2885377842	167
183	iso_pu_bacteria	2903748898	2903755842	167
184	iso_pu_bacteria	2904690495	2904696273	167
185	iso_pu_bacteria	2904699407	2904702608	167
186	iso_pu_bacteria	2906610324	2906617954	167
187	iso_pu_bacteria	2906635258	2906642692	167
188	iso_pu_bacteria	2906660503	2906661447	167
189	iso_pu_bacteria	2908739725	2908743435	167
190	iso_pu_bacteria	2908756301	2908760941	167
191	iso_pu_bacteria	2922425934	2922429458	167
192	iso_pu_bacteria	2935630451	2935633672	167
193	iso_pu_bacteria	2941507105	2941510563	167
194	iso_pu_bacteria	2941515067	2941517698	167
195	iso_pu_bacteria	2941523033	2941525715	167
196	iso_pu_bacteria	3005474847	3005479615	167
197	iso_pu_bacteria	8006933436	8006941502	167
198	iso_pu_bacteria	8006973647	8006981214	167
199	iso_pu_bacteria	8019555841	8019557413	167
200	iso_pu_bacteria	8019565922	8019567888	167
201	3300005334	Ga0068869_100043742	Ga0068869_1000437423	168
202	3300005336	Ga0070680_100571036	Ga0070680_1005710361	168
203	3300005340	Ga0070689_100328141	Ga0070689_1003281412	168
204	3300005341	Ga0070691_10447064	Ga0070691_104470641	168
205	3300005347	Ga0070668_100063024	Ga0070668_1000630242	168
206	3300005355	Ga0070671_100198218	Ga0070671_1001982182	168
207	3300005364	Ga0070673_100465608	Ga0070673_1004656082	168
208	3300005366	Ga0070659_100796449	Ga0070659_1007964492	168
209	3300005366	Ga0070659_101240588	Ga0070659_1012405881	168
210	3300005436	Ga0070713_100183830	Ga0070713_1001838302	168
211	3300005459	Ga0068867_100597605	Ga0068867_1005976051	168
212	3300005539	Ga0068853_100000731	Ga0068853_1000007319	168
213	3300005539	Ga0068853_100065731	Ga0068853_1000657313	168
214	3300005539	Ga0068853_100788138	Ga0068853_1007881382	168
215	3300005544	Ga0070686_100354180	Ga0070686_1003541802	168
216	3300005545	Ga0070695_100684271	Ga0070695_1006842711	168
217	3300005548	Ga0070665_100114353	Ga0070665_1001143533	168
218	3300005548	Ga0070665_100553633	Ga0070665_1005536332	168
219	3300005563	Ga0068855_100851806	Ga0068855_1008518062	168
220	3300005564	Ga0070664_100112569	Ga0070664_1001125692	168
221	3300005577	Ga0068857_100258763	Ga0068857_1002587632	168
222	3300005578	Ga0068854_100101271	Ga0068854_1001012712	168
223	3300005614	Ga0068856_100000206	Ga0068856_10000020656	168
224	3300005615	Ga0070702_100062203	Ga0070702_1000622033	168
225	3300005841	Ga0068863_100149086	Ga0068863_1001490863	168
226	3300005843	Ga0068860_100341816	Ga0068860_1003418162	168
227	3300005844	Ga0068862_100115773	Ga0068862_1001157732	168
228	3300005983	Ga0081540_1047126	Ga0081540_10471263	168
229	3300006058	Ga0075432_10131370	Ga0075432_101313702	168
230	3300006173	Ga0070716_100677731	Ga0070716_1006777312	168
231	3300006353	Ga0075370_10025361	Ga0075370_100253613	168
232	3300006358	Ga0068871_100103620	Ga0068871_1001036202	168
233	3300006358	Ga0068871_100154220	Ga0068871_1001542202	168
234	3300006852	Ga0075433_10106165	Ga0075433_101061654	168
235	3300006871	Ga0075434_100033109	Ga0075434_1000331095	168
236	3300006881	Ga0068865_101258139	Ga0068865_1012581392	168
237	3300007076	Ga0075435_100171604	Ga0075435_1001716043	168
238	3300009011	Ga0105251_10259547	Ga0105251_102595471	168
239	3300009098	Ga0105245_10563656	Ga0105245_105636562	168
240	3300009101	Ga0105247_10125352	Ga0105247_101253522	168
241	3300009101	Ga0105247_10547215	Ga0105247_105472151	168
242	3300009148	Ga0105243_10331677	Ga0105243_103316772	168
243	3300009174	Ga0105241_10065234	Ga0105241_100652343	168
244	3300009176	Ga0105242_10277960	Ga0105242_102779602	168
245	3300009176	Ga0105242_10652458	Ga0105242_106524582	168
246	3300009177	Ga0105248_10079923	Ga0105248_100799233	168
247	3300009177	Ga0105248_10123885	Ga0105248_101238854	168
248	3300009545	Ga0105237_10121031	Ga0105237_101210312	168
249	3300009551	Ga0105238_10521453	Ga0105238_105214532	168
250	3300009553	Ga0105249_10539724	Ga0105249_105397242	168
251	3300009553	Ga0105249_10846744	Ga0105249_108467442	168
252	3300010375	Ga0105239_10011854	Ga0105239_100118544	168
253	3300010375	Ga0105239_10739902	Ga0105239_107399022	168
254	3300011119	Ga0105246_10185218	Ga0105246_101852182	168
255	3300013296	Ga0157374_10154254	Ga0157374_101542542	168
256	3300013297	Ga0157378_10095213	Ga0157378_100952132	168
257	3300013308	Ga0157375_11177957	Ga0157375_111779571	168
258	3300014325	Ga0163163_10338651	Ga0163163_103386512	168
259	3300014325	Ga0163163_11020101	Ga0163163_110201011	168
260	3300014745	Ga0157377_10097203	Ga0157377_100972032	168
261	3300014968	Ga0157379_10176892	Ga0157379_101768922	168
262	3300025315	Ga0207697_10024285	Ga0207697_100242854	168
263	3300025904	Ga0207647_10144454	Ga0207647_101444542	168
264	3300025908	Ga0207643_10342679	Ga0207643_103426791	168
265	3300025911	Ga0207654_10080565	Ga0207654_100805651	168
266	3300025919	Ga0207657_10186759	Ga0207657_101867593	168
267	3300025927	Ga0207687_10078584	Ga0207687_100785842	168
268	3300025928	Ga0207700_10326764	Ga0207700_103267641	168
269	3300025931	Ga0207644_10183345	Ga0207644_101833451	168
270	3300025932	Ga0207690_10483082	Ga0207690_104830822	168
271	3300025934	Ga0207686_10100556	Ga0207686_101005562	168
272	3300025939	Ga0207665_10669566	Ga0207665_106695662	168
273	3300025941	Ga0207711_10072526	Ga0207711_100725263	168
274	3300025942	Ga0207689_10012457	Ga0207689_100124572	168
275	3300025949	Ga0207667_10432498	Ga0207667_104324982	168
276	3300025949	Ga0207667_10531690	Ga0207667_105316902	168
277	3300025949	Ga0207667_10639082	Ga0207667_106390821	168
278	3300025960	Ga0207651_10197599	Ga0207651_101975992	168
279	3300025981	Ga0207640_10078964	Ga0207640_100789642	168
280	3300026023	Ga0207677_10190041	Ga0207677_101900413	168
281	3300026035	Ga0207703_10400480	Ga0207703_104004802	168
282	3300026041	Ga0207639_10001880	Ga0207639_100018808	168
283	3300026041	Ga0207639_10049830	Ga0207639_100498303	168
284	3300026067	Ga0207678_10075067	Ga0207678_100750672	168
285	3300026078	Ga0207702_10000075	Ga0207702_1000007517	168
286	3300026088	Ga0207641_10298406	Ga0207641_102984062	168
287	3300026116	Ga0207674_10501004	Ga0207674_105010042	168
288	3300028379	Ga0268266_10099223	Ga0268266_100992232	168
289	3300028379	Ga0268266_10441798	Ga0268266_104417982	168
290	3300028381	Ga0268264_10562045	Ga0268264_105620451	168
291	3300035691	Ga0373931_0009173	Ga0373931_0009173_2379_2897	168
292	3300035695	Ga0373927_0049614	Ga0373927_0049614_1682_2200	168
293	3300038443	Ga0395901_0335807	Ga0395901_0335807_680_1192	168
294	3300038443	Ga0395901_1758902	Ga0395901_1758902_29_550	168
295	3300046462	Ga0495651_0480004	Ga0495651_0480004_123_638	168
296	3300046492	Ga0495585_0022874	Ga0495585_0022874_1048_1563	168
297	3300046515	Ga0495620_0223734	Ga0495620_0223734_32_550	168
298	3300046691	Ga0495670_0149305	Ga0495670_0149305_479_994	168
299	3300048903	Ga0496100_0134401	Ga0496100_0134401_287_808	168
300	3300048904	Ga0496101_0121957	Ga0496101_0121957_1234_1755	168
301	3300048905	Ga0496102_0034726	Ga0496102_0034726_1477_1995	168
302	3300048905	Ga0496102_0155432	Ga0496102_0155432_469_987	168
303	3300048907	Ga0496104_0132697	Ga0496104_0132697_1727_2245	168
304	3300048908	Ga0496105_0013417	Ga0496105_0013417_3785_4303	168
305	3300048910	Ga0496107_0018119	Ga0496107_0018119_249_767	168
306	3300048911	Ga0496108_0025680	Ga0496108_0025680_1844_2362	168
307	3300048912	Ga0496109_0121063	Ga0496109_0121063_1468_1983	168
308	3300048912	Ga0496109_0217615	Ga0496109_0217615_486_1007	168
309	3300048913	Ga0496110_0022169	Ga0496110_0022169_2655_3173	168
310	3300048914	Ga0496111_0022030	Ga0496111_0022030_2910_3428	168
311	3300048914	Ga0496111_0063155	Ga0496111_0063155_2091_2606	168
312	3300048915	Ga0496112_0023082	Ga0496112_0023082_131_646	168
313	3300048917	Ga0496114_0016576	Ga0496114_0016576_3056_3574	168
314	3300048917	Ga0496114_0103309	Ga0496114_0103309_711_1232	168
315	3300048918	Ga0496115_0062742	Ga0496115_0062742_1691_2209	168
316	3300048920	Ga0496117_0161989	Ga0496117_0161989_32_547	168
317	3300048921	Ga0496118_0320232	Ga0496118_0320232_283_798	168
318	3300048924	Ga0496121_0422768	Ga0496121_0422768_232_747	168
319	3300049568	Ga0501031_0023216	Ga0501031_0023216_192_710	168
320	3300049568	Ga0501031_0309056	Ga0501031_0309056_493_1005	168
321	3300049569	Ga0501032_0026458	Ga0501032_0026458_3262_3855	168
322	3300049570	Ga0501033_0000220	Ga0501033_0000220_2030_2548	168
323	3300049570	Ga0501033_0005474	Ga0501033_0005474_6884_7396	168
324	3300049570	Ga0501033_0137048	Ga0501033_0137048_1034_1561	168
325	3300049570	Ga0501033_0181277	Ga0501033_0181277_655_1167	168
326	3300049570	Ga0501033_0412201	Ga0501033_0412201_123_716	168
327	3300049573	Ga0501037_0000047	Ga0501037_0000047_69458_69976	168
328	3300049574	Ga0501038_0403968	Ga0501038_0403968_56_649	168
329	3300049574	Ga0501038_0642807	Ga0501038_0642807_165_677	168
330	3300049579	Ga0501043_0000369	Ga0501043_0000369_21087_21605	168
331	3300049579	Ga0501043_0027428	Ga0501043_0027428_3025_3537	168
332	3300049579	Ga0501043_0120872	Ga0501043_0120872_771_1364	168
333	3300049581	Ga0501047_0043327	Ga0501047_0043327_865_1377	168
334	3300049581	Ga0501047_0260730	Ga0501047_0260730_1044_1556	168
335	3300049581	Ga0501047_0306696	Ga0501047_0306696_632_1159	168
336	3300049583	Ga0501067_0021274	Ga0501067_0021274_2873_3391	168
337	3300049583	Ga0501067_0301843	Ga0501067_0301843_280_801	168
338	3300049584	Ga0501068_0011053	Ga0501068_0011053_938_1456	168
339	3300049584	Ga0501068_0599335	Ga0501068_0599335_50_562	168
340	3300049585	Ga0501069_0000073	Ga0501069_0000073_13996_14514	168
341	3300049585	Ga0501069_0007678	Ga0501069_0007678_2954_3547	168
342	3300049585	Ga0501069_0380945	Ga0501069_0380945_291_803	168
343	3300049586	Ga0501070_0000160	Ga0501070_0000160_59554_60066	168
344	3300049586	Ga0501070_0000385	Ga0501070_0000385_25733_26251	168
345	3300049586	Ga0501070_0002485	Ga0501070_0002485_12999_13592	168
346	3300049586	Ga0501070_0013229	Ga0501070_0013229_3589_4101	168
347	3300049586	Ga0501070_0644806	Ga0501070_0644806_85_690	168
348	3300049589	Ga0501073_0025192	Ga0501073_0025192_1512_2105	168
349	3300049589	Ga0501073_0037664	Ga0501073_0037664_2792_3304	168
350	3300049589	Ga0501073_0142580	Ga0501073_0142580_900_1421	168
351	3300049589	Ga0501073_0289714	Ga0501073_0289714_277_789	168
352	3300049590	Ga0501074_0000390	Ga0501074_0000390_11781_12299	168
353	3300049590	Ga0501074_0091298	Ga0501074_0091298_1461_2054	168
354	3300049590	Ga0501074_0172106	Ga0501074_0172106_233_745	168
355	3300049742	Ga0501080_0007130	Ga0501080_0007130_2981_3493	168
356	3300049742	Ga0501080_0017080	Ga0501080_0017080_228_746	168
357	3300049742	Ga0501080_0019404	Ga0501080_0019404_1919_2440	168
358	3300049742	Ga0501080_0231277	Ga0501080_0231277_1161_1673	168
359	3300049742	Ga0501080_0268099	Ga0501080_0268099_48_560	168
360	3300049742	Ga0501080_0752844	Ga0501080_0752844_312_827	168
361	3300049744	Ga0501083_0000848	Ga0501083_0000848_5651_6169	168
362	3300049744	Ga0501083_0367443	Ga0501083_0367443_178_699	168
363	3300049822	Ga0501035_0000025	Ga0501035_0000025_44803_45321	168
364	3300049822	Ga0501035_0002044	Ga0501035_0002044_13529_14041	168
365	3300049822	Ga0501035_0003870	Ga0501035_0003870_6636_7229	168
366	3300049822	Ga0501035_0004201	Ga0501035_0004201_8559_9071	168
367	3300049822	Ga0501035_0151512	Ga0501035_0151512_1456_1983	168
368	3300049823	Ga0501044_0000031	Ga0501044_0000031_158869_159387	168
369	3300049823	Ga0501044_0006542	Ga0501044_0006542_6934_7446	168
370	3300049823	Ga0501044_0020689	Ga0501044_0020689_4046_4639	168
371	3300049823	Ga0501044_0038415	Ga0501044_0038415_2071_2598	168
372	3300049823	Ga0501044_1046364	Ga0501044_1046364_20_532	168
373	3300049824	Ga0501045_0933668	Ga0501045_0933668_95_607	168
374	3300050494	nmdc:mga06z11_69476_c1	nmdc:mga06z11_69476_c1_325_840	168
375	3300050513	nmdc:mga0rr50_266491_c1	nmdc:mga0rr50_266491_c1_240_755	168
376	3300053730	Ga0500645_082603	Ga0500645_082603_108_626	168
377	3300060353	Ga0501082_0091533	Ga0501082_0091533_215_733	168
378	3300060353	Ga0501082_0180009	Ga0501082_0180009_816_1337	168
379	3300060353	Ga0501082_0206959	Ga0501082_0206959_26_538	168
380	3300060353	Ga0501082_1134474	Ga0501082_1134474_57_650	168
381	iso_pu_bacteria	2693429784	2694635606	168
382	3300005330	Ga0070690_101014890	Ga0070690_1010148901	169
383	3300005331	Ga0070670_101014414	Ga0070670_1010144141	169
384	3300005548	Ga0070665_100054883	Ga0070665_1000548833	169
385	3300005937	Ga0081455_10117426	Ga0081455_101174264	169
386	3300005983	Ga0081540_1177995	Ga0081540_11779951	169
387	3300006038	Ga0075365_10016751	Ga0075365_100167512	169
388	3300006048	Ga0075363_100293972	Ga0075363_1002939722	169
389	3300006178	Ga0075367_10221756	Ga0075367_102217562	169
390	3300006237	Ga0097621_100606770	Ga0097621_1006067702	169
391	3300009177	Ga0105248_10252967	Ga0105248_102529674	169
392	3300009551	Ga0105238_10702564	Ga0105238_107025642	169
393	3300013307	Ga0157372_11093136	Ga0157372_110931361	169
394	3300014325	Ga0163163_11177192	Ga0163163_111771922	169
395	3300014326	Ga0157380_10133480	Ga0157380_101334802	169
396	3300025924	Ga0207694_10815951	Ga0207694_108159512	169
397	3300025925	Ga0207650_11237440	Ga0207650_112374402	169
398	3300025926	Ga0207659_10221498	Ga0207659_102214982	169
399	3300025937	Ga0207669_10083234	Ga0207669_100832343	169
400	3300025940	Ga0207691_10107245	Ga0207691_101072453	169
401	3300025941	Ga0207711_10170746	Ga0207711_101707464	169
402	3300025960	Ga0207651_10630187	Ga0207651_106301872	169
403	3300026075	Ga0207708_10367225	Ga0207708_103672252	169
404	3300026089	Ga0207648_10433046	Ga0207648_104330462	169
405	3300028379	Ga0268266_10033835	Ga0268266_100338353	169
406	3300031507	Ga0307509_10025057	Ga0307509_100250573	169
407	3300032002	Ga0307416_100391053	Ga0307416_1003910532	169
408	3300033180	Ga0307510_10002931	Ga0307510_1000293113	169
409	3300041512	Ga0451853_0418684	Ga0451853_0418684_444_965	169
410	3300046455	Ga0495603_0094153	Ga0495603_0094153_390_908	169
411	3300046460	Ga0495638_0121382	Ga0495638_0121382_82_603	169
412	3300046461	Ga0495641_0059567	Ga0495641_0059567_647_1165	169
413	3300046471	Ga0495650_0147314	Ga0495650_0147314_167_679	169
414	3300046499	Ga0495594_0120821	Ga0495594_0120821_134_652	169
415	3300046529	Ga0495652_0094473	Ga0495652_0094473_384_905	169
416	3300046557	Ga0495622_0146177	Ga0495622_0146177_359_877	169
417	3300046680	Ga0495646_0195367	Ga0495646_0195367_247_768	169
418	3300046692	Ga0495671_0304599	Ga0495671_0304599_141_659	169
419	3300047322	Ga0495680_0247738	Ga0495680_0247738_439_960	169
420	3300048909	Ga0496106_0291737	Ga0496106_0291737_248_769	169
421	3300048916	Ga0496113_0603606	Ga0496113_0603606_253_774	169
422	3300048918	Ga0496115_0107356	Ga0496115_0107356_885_1403	169
423	3300048924	Ga0496121_0241519	Ga0496121_0241519_356_874	169
424	3300048925	Ga0496122_0033340	Ga0496122_0033340_762_1289	169
425	3300048929	Ga0496126_0226360	Ga0496126_0226360_420_947	169
426	3300049570	Ga0501033_0200504	Ga0501033_0200504_744_1367	169
427	3300049579	Ga0501043_0276679	Ga0501043_0276679_508_1023	169
428	3300049580	Ga0501046_0795354	Ga0501046_0795354_38_553	169
429	3300049581	Ga0501047_0286692	Ga0501047_0286692_915_1430	169
430	3300049581	Ga0501047_0819961	Ga0501047_0819961_61_588	169
431	3300049583	Ga0501067_0143737	Ga0501067_0143737_276_791	169
432	3300049584	Ga0501068_0229586	Ga0501068_0229586_403_930	169
433	3300049585	Ga0501069_0046848	Ga0501069_0046848_1649_2164	169
434	3300049586	Ga0501070_0023435	Ga0501070_0023435_2664_3179	169
435	3300049588	Ga0501072_0762847	Ga0501072_0762847_63_590	169
436	3300049593	Ga0501077_0022562	Ga0501077_0022562_167_697	169
437	3300049593	Ga0501077_0220984	Ga0501077_0220984_429_956	169
438	3300049742	Ga0501080_0037521	Ga0501080_0037521_1857_2372	169
439	3300049742	Ga0501080_0354361	Ga0501080_0354361_731_1246	169
440	3300049744	Ga0501083_0003251	Ga0501083_0003251_6840_7367	169
441	3300049822	Ga0501035_0582680	Ga0501035_0582680_104_619	169
442	3300049823	Ga0501044_0113917	Ga0501044_0113917_1185_1712	169
443	3300053084	Ga0495595_0035246	Ga0495595_0035246_99_620	169
444	3300053092	Ga0500583_0025813	Ga0500583_0025813_1149_1670	169
445	3300053146	Ga0500588_0239106	Ga0500588_0239106_114_635	169
446	3300053147	Ga0500589_058039	Ga0500589_058039_828_1349	169
447	3300053161	Ga0500634_0064749	Ga0500634_0064749_243_764	169
448	3300054114	Ga0501084_0046183	Ga0501084_0046183_2296_2826	169
449	3300054114	Ga0501084_1199737	Ga0501084_1199737_91_606	169
450	3300003215	JGI25153J46596_10001608	JGI25153J46596_1000160811	170
451	3300005331	Ga0070670_100401096	Ga0070670_1004010961	170
452	3300005334	Ga0068869_100025415	Ga0068869_1000254155	170
453	3300005344	Ga0070661_100141882	Ga0070661_1001418822	170
454	3300005347	Ga0070668_100152909	Ga0070668_1001529092	170
455	3300005347	Ga0070668_100173761	Ga0070668_1001737612	170
456	3300005353	Ga0070669_100632734	Ga0070669_1006327342	170
457	3300005366	Ga0070659_100855651	Ga0070659_1008556511	170
458	3300005439	Ga0070711_100213079	Ga0070711_1002130792	170
459	3300005440	Ga0070705_100139865	Ga0070705_1001398652	170
460	3300005444	Ga0070694_100234994	Ga0070694_1002349943	170
461	3300005455	Ga0070663_100012396	Ga0070663_1000123964	170
462	3300005455	Ga0070663_100213667	Ga0070663_1002136672	170
463	3300005456	Ga0070678_100070205	Ga0070678_1000702053	170
464	3300005456	Ga0070678_100172765	Ga0070678_1001727652	170
465	3300005456	Ga0070678_100980887	Ga0070678_1009808872	170
466	3300005457	Ga0070662_100184309	Ga0070662_1001843092	170
467	3300005459	Ga0068867_100551170	Ga0068867_1005511702	170
468	3300005471	Ga0070698_100905719	Ga0070698_1009057191	170
469	3300005518	Ga0070699_100196375	Ga0070699_1001963752	170
470	3300005536	Ga0070697_101188183	Ga0070697_1011881831	170
471	3300005546	Ga0070696_100944064	Ga0070696_1009440641	170
472	3300005547	Ga0070693_100075865	Ga0070693_1000758652	170
473	3300005548	Ga0070665_100055713	Ga0070665_1000557134	170
474	3300005548	Ga0070665_100071953	Ga0070665_1000719533	170
475	3300005614	Ga0068856_100073356	Ga0068856_1000733565	170
476	3300005616	Ga0068852_101038861	Ga0068852_1010388612	170
477	3300005617	Ga0068859_100127354	Ga0068859_1001273542	170
478	3300005719	Ga0068861_100041230	Ga0068861_1000412302	170
479	3300005719	Ga0068861_100197655	Ga0068861_1001976551	170
480	3300005719	Ga0068861_102116506	Ga0068861_1021165061	170
481	3300005842	Ga0068858_101048645	Ga0068858_1010486452	170
482	3300005843	Ga0068860_100131854	Ga0068860_1001318543	170
483	3300005844	Ga0068862_100173328	Ga0068862_1001733282	170
484	3300005844	Ga0068862_100179479	Ga0068862_1001794792	170
485	3300005844	Ga0068862_100525547	Ga0068862_1005255472	170
486	3300005983	Ga0081540_1033602	Ga0081540_10336024	170
487	3300005983	Ga0081540_1046034	Ga0081540_10460342	170
488	3300006038	Ga0075365_10150409	Ga0075365_101504091	170
489	3300006042	Ga0075368_10223787	Ga0075368_102237872	170
490	3300006042	Ga0075368_10238133	Ga0075368_102381332	170
491	3300006048	Ga0075363_100002156	Ga0075363_1000021565	170
492	3300006175	Ga0070712_100613082	Ga0070712_1006130822	170
493	3300006178	Ga0075367_10031333	Ga0075367_100313332	170
494	3300006186	Ga0075369_10325983	Ga0075369_103259831	170
495	3300006353	Ga0075370_10006776	Ga0075370_100067764	170
496	3300006358	Ga0068871_101166703	Ga0068871_1011667031	170
497	3300006880	Ga0075429_100406816	Ga0075429_1004068162	170
498	3300006931	Ga0097620_100127357	Ga0097620_1001273574	170
499	3300006946	Ga0079104_1003965	Ga0079104_10039652	170
500	3300009036	Ga0105244_10331300	Ga0105244_103313002	170
501	3300009093	Ga0105240_10500533	Ga0105240_105005332	170
502	3300009093	Ga0105240_11520335	Ga0105240_115203351	170
503	3300009094	Ga0111539_10456322	Ga0111539_104563222	170
504	3300009147	Ga0114129_10619231	Ga0114129_106192312	170
505	3300009148	Ga0105243_10533691	Ga0105243_105336912	170
506	3300009148	Ga0105243_11613226	Ga0105243_116132262	170
507	3300009176	Ga0105242_10862525	Ga0105242_108625252	170
508	3300009176	Ga0105242_11413512	Ga0105242_114135122	170
509	3300010375	Ga0105239_10460735	Ga0105239_104607352	170
510	3300011119	Ga0105246_10188991	Ga0105246_101889912	170
511	3300012506	Ga0157324_1033049	Ga0157324_10330491	170
512	3300013306	Ga0163162_11129027	Ga0163162_111290271	170
513	3300013308	Ga0157375_10147111	Ga0157375_101471112	170
514	3300013308	Ga0157375_11451136	Ga0157375_114511362	170
515	3300014325	Ga0163163_10104090	Ga0163163_101040902	170
516	3300014325	Ga0163163_10250617	Ga0163163_102506172	170
517	3300014325	Ga0163163_11047930	Ga0163163_110479302	170
518	3300014968	Ga0157379_10522925	Ga0157379_105229252	170
519	3300014969	Ga0157376_10537106	Ga0157376_105371061	170
520	3300014969	Ga0157376_10614774	Ga0157376_106147742	170
521	3300017792	Ga0163161_10437801	Ga0163161_104378012	170
522	3300025272	Ga0209455_1012103	Ga0209455_10121032	170
523	3300025885	Ga0207653_10056240	Ga0207653_100562402	170
524	3300025916	Ga0207663_10070962	Ga0207663_100709622	170
525	3300025919	Ga0207657_10579135	Ga0207657_105791351	170
526	3300025920	Ga0207649_10146642	Ga0207649_101466421	170
527	3300025923	Ga0207681_11472550	Ga0207681_114725501	170
528	3300025924	Ga0207694_11127360	Ga0207694_111273601	170
529	3300025926	Ga0207659_10048310	Ga0207659_100483102	170
530	3300025933	Ga0207706_10153239	Ga0207706_101532392	170
531	3300025936	Ga0207670_10993919	Ga0207670_109939192	170
532	3300025937	Ga0207669_10046343	Ga0207669_100463432	170
533	3300025940	Ga0207691_10164078	Ga0207691_101640782	170
534	3300025940	Ga0207691_10463824	Ga0207691_104638242	170
535	3300025942	Ga0207689_10253729	Ga0207689_102537292	170
536	3300025942	Ga0207689_10445646	Ga0207689_104456462	170
537	3300025960	Ga0207651_10097340	Ga0207651_100973403	170
538	3300025972	Ga0207668_10645642	Ga0207668_106456422	170
539	3300026023	Ga0207677_10188874	Ga0207677_101888743	170
540	3300026035	Ga0207703_10123298	Ga0207703_101232982	170
541	3300026035	Ga0207703_10271411	Ga0207703_102714113	170
542	3300026041	Ga0207639_10274138	Ga0207639_102741383	170
543	3300026067	Ga0207678_10011040	Ga0207678_100110406	170
544	3300026075	Ga0207708_10458277	Ga0207708_104582772	170
545	3300026118	Ga0207675_100036814	Ga0207675_1000368143	170
546	3300026118	Ga0207675_100110251	Ga0207675_1001102512	170
547	3300026118	Ga0207675_100367474	Ga0207675_1003674742	170
548	3300026118	Ga0207675_101206147	Ga0207675_1012061472	170
549	3300026118	Ga0207675_101336321	Ga0207675_1013363211	170
550	3300026121	Ga0207683_10483620	Ga0207683_104836202	170
551	3300026142	Ga0207698_11105985	Ga0207698_111059852	170
552	3300027111	Ga0209281_1002748	Ga0209281_10027487	170
553	3300027907	Ga0207428_10244452	Ga0207428_102444522	170
554	3300028379	Ga0268266_10003029	Ga0268266_100030299	170
555	3300028379	Ga0268266_11363805	Ga0268266_113638051	170
556	3300028380	Ga0268265_10021839	Ga0268265_100218392	170
557	3300028380	Ga0268265_10918418	Ga0268265_109184182	170
558	3300031616	Ga0307508_10195689	Ga0307508_101956892	170
559	3300032126	Ga0307415_100501499	Ga0307415_1005014992	170
560	3300035170	Ga0373943_0479246	Ga0373943_0479246_29_580	170
561	3300035695	Ga0373927_0013136	Ga0373927_0013136_636_1235	170
562	3300037471	Ga0395905_0359396	Ga0395905_0359396_661_1182	170
563	3300041451	Ga0451791_0911118	Ga0451791_0911118_149_673	170
564	3300041459	Ga0451800_0699070	Ga0451800_0699070_12_536	170
565	3300046455	Ga0495603_0073139	Ga0495603_0073139_271_795	170
566	3300046457	Ga0495590_0080207	Ga0495590_0080207_325_849	170
567	3300046459	Ga0495629_0506179	Ga0495629_0506179_251_775	170
568	3300046491	Ga0495584_0033170	Ga0495584_0033170_1284_1808	170
569	3300046515	Ga0495620_0027207	Ga0495620_0027207_307_831	170
570	3300046522	Ga0495643_0208076	Ga0495643_0208076_282_806	170
571	3300046557	Ga0495622_0173037	Ga0495622_0173037_362_886	170
572	3300046616	Ga0495668_0274595	Ga0495668_0274595_364_888	170
573	3300046660	Ga0495625_0078824	Ga0495625_0078824_686_1210	170
574	3300046663	Ga0495635_0334149	Ga0495635_0334149_400_924	170
575	3300046674	Ga0495588_0163057	Ga0495588_0163057_553_1104	170
576	3300046684	Ga0495669_0021107	Ga0495669_0021107_865_1389	170
577	3300047315	Ga0495581_0375972	Ga0495581_0375972_178_702	170
578	3300047472	Ga0495686_0313844	Ga0495686_0313844_220_744	170
579	3300047673	Ga0495593_0277096	Ga0495593_0277096_143_667	170
580	3300048088	Ga0495602_0333802	Ga0495602_0333802_363_887	170
581	3300048905	Ga0496102_0195345	Ga0496102_0195345_200_724	170
582	3300048905	Ga0496102_0220795	Ga0496102_0220795_166_690	170
583	3300048906	Ga0496103_0358960	Ga0496103_0358960_25_549	170
584	3300048918	Ga0496115_0074560	Ga0496115_0074560_1700_2224	170
585	3300048920	Ga0496117_0387608	Ga0496117_0387608_26_550	170
586	3300048929	Ga0496126_0093318	Ga0496126_0093318_1033_1557	170
587	3300050490	nmdc:mga03n38_352_c1	nmdc:mga03n38_352_c1_4345_4869	170
588	3300050491	nmdc:mga00v17_499180_c1	nmdc:mga00v17_499180_c1_119_643	170
589	3300050492	nmdc:mga0yw44_403003_c1	nmdc:mga0yw44_403003_c1_245_769	170
590	3300050492	nmdc:mga0yw44_649586_c1	nmdc:mga0yw44_649586_c1_114_638	170
591	3300050495	nmdc:mga04h51_151173_c1	nmdc:mga04h51_151173_c1_299_823	170
592	3300050496	nmdc:mga07m45_1291_c1	nmdc:mga07m45_1291_c1_403_927	170
593	3300050511	nmdc:mga08y16_416151_c1	nmdc:mga08y16_416151_c1_572_1096	170
594	3300053096	Ga0500641_0282983	Ga0500641_0282983_78_602	170
595	3300053139	Ga0500568_0310631	Ga0500568_0310631_35_559	170
596	3300005436	Ga0070713_100102995	Ga0070713_1001029952	171
597	3300005844	Ga0068862_100830055	Ga0068862_1008300552	171
598	3300010375	Ga0105239_10604796	Ga0105239_106047962	171
599	3300025904	Ga0207647_10028953	Ga0207647_100289534	171
600	3300025913	Ga0207695_10440695	Ga0207695_104406952	171
601	3300025928	Ga0207700_10040307	Ga0207700_100403074	171
602	3300033442	Ga0315911_1000001	Ga0315911_10000011019	171
603	3300035118	Ga0373954_0335301	Ga0373954_0335301_45_566	171
604	3300041451	Ga0451791_1379949	Ga0451791_1379949_17_562	171
605	3300048917	Ga0496114_0448636	Ga0496114_0448636_280_807	171
606	3300048924	Ga0496121_0168217	Ga0496121_0168217_363_890	171
607	3300048929	Ga0496126_0013331	Ga0496126_0013331_3120_3647	171
608	3300048929	Ga0496126_0164584	Ga0496126_0164584_427_957	171
609	3300001989	JGI24739J22299_10019912	JGI24739J22299_100199122	172
610	3300002741	JGI25157J39369_1002223	JGI25157J39369_10022231	172
611	3300005548	Ga0070665_100074085	Ga0070665_1000740854	172
612	3300009093	Ga0105240_10142645	Ga0105240_101426452	172
613	3300014969	Ga0157376_10263058	Ga0157376_102630582	172
614	3300025250	Ga0209026_1000100	Ga0209026_100010063	172
615	3300035086	Ga0373934_0068928	Ga0373934_0068928_266_793	172
616	3300035117	Ga0373953_0168231	Ga0373953_0168231_316_843	172
617	3300035118	Ga0373954_0266810	Ga0373954_0266810_109_636	172
618	3300035172	Ga0373955_0358680	Ga0373955_0358680_120_647	172
619	3300035692	Ga0373935_0665308	Ga0373935_0665308_70_597	172
620	3300035725	Ga0373947_0498985	Ga0373947_0498985_219_746	172
621	3300036401	Ga0373937_0018157	Ga0373937_0018157_2254_2781	172
622	3300046454	Ga0495592_0339524	Ga0495592_0339524_36_563	172
623	3300046689	Ga0495613_0120196	Ga0495613_0120196_463_990	172
624	3300047319	Ga0495674_0492560	Ga0495674_0492560_250_777	172
625	3300048922	Ga0496119_0044799	Ga0496119_0044799_400_939	172
626	3300053085	Ga0495619_0777859	Ga0495619_0777859_80_607	172

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07987

DUF1775

Domain of unkown function (DUF1775)

52

197

0.97 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
7me6-assembly1.cif.gz_A	structure of the apo form of ycni	0.8091	21	167
7me6-assembly1.cif.gz_A	structure of the apo form of ycni	0.7863	21	167
3esm-assembly1.cif.gz_A-2	crystal structure of an uncharacterized protein from nocardia farcinica reveals an immunoglobulin-like fold	0.7563	22	168
3esm-assembly1.cif.gz_A-2	crystal structure of an uncharacterized protein from nocardia farcinica reveals an immunoglobulin-like fold	0.7314	22	168
7tw1-assembly1.cif.gz_E	cryo-em structure of human band 3-protein 4.2 complex (b2p2vertical)	0.7184	20	171

ID	Description	Score	Start	End	Superfamily
3esmA00	Mainly Beta;Sandwich;Immunoglobulin-like;Uncharacterised protein YcnI-like PF07987, DUF1775	0.7563	22	168	2.60.40.2230
3esmA00	Mainly Beta;Sandwich;Immunoglobulin-like;Uncharacterised protein YcnI-like PF07987, DUF1775	0.7314	22	168	2.60.40.2230
af_Q58205_267_360_2.60.40.10	Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins	0.7183	19	168	2.60.40.10
af_P49222_590_685_2.60.40.10	Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins	0.7145	22	145	2.60.40.10
af_Q4DE92_1238_2672_2.60.40.420	Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins -	0.7006	26	171	2.60.40.420

ID	Description	Score	Start	End
AF-A0A530GDL3-F1-model_v4	DUF1775 domain-containing protein	0.9965	35	121
AF-A0A530GDL3-F1-model_v4	DUF1775 domain-containing protein	0.9852	35	121
AF-A0A436FF66-F1-model_v4	DUF1775 domain-containing protein	0.9696	35	171
AF-A0A7R6YHG6-F1-model_v4	deleted	0.962	54	171
AF-A0A436FF66-F1-model_v4	DUF1775 domain-containing protein	0.9559	35	171

Feature Viewer

pLDDT	pTM	Quality
86.62	0.79	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F470509

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF07987

DUF1775

Domain of unkown function (DUF1775)

52

197

0.97

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map