F470355

General Info

Members Datasets Scaffolds Average Seq Length
625 251 1242 326

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10685675|Ga0114129_106856751
Length 379
Sequence MLHQRKKALVNQAPSTHDPKRALAGLKSRSAAVSCVSRRAILLVASTWEDCAVKRREFITLLGGATAWPLAARAQQGERVRRIGVLMYLPADDPEGQARIAAFLQALQQLGWSDGRNLQIDTRWATASDIRKHASELVALAPDVLVAGTGTASVAPLLDETRTVPIVFVTVTDPVGAGFVTSLAQPGGNATGFTIFEYGMSGKWLELLREIAPRVTRAAVLRDPAVASGIGQFGAIQAVAPSLGVELGPVDVRHAGEIERAITAFARGPNGGLIVTATALAFVHQDLIISLASRHRLPAVFWNRRFIPHGGLISYGPDTIDPFRLAAGYVDRILKGEKPANLPVQHPTKFELLINLKTAKTLGLDVPATLLARADEVIE

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
145 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
146 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
147 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
148 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
149 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
150 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
151 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
152 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
153 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
154 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
156 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
157 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
158 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
159 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
160 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
161 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
162 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
163 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
175 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
178 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
179 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
180 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
181 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
182 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
183 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
184 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
185 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
186 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
187 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
188 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
189 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
190 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
191 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
192 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
193 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
194 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
195 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
196 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
197 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
198 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
199 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
200 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
201 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
202 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
203 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
204 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
205 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
206 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
207 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
208 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
209 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
210 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
211 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
214 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
215 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
216 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
217 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
218 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
228 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
231 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
232 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
233 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
234 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
235 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
236 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
237 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
238 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
239 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
240 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
241 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
242 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
243 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
244 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
245 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
246 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
247 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
248 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
249 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
250 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
251 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.84
Metatranscriptomes 0
Isolates 0.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.76
Nodule 0
Rhizoplane 14.72
Rhizosphere 83.36
Stem 0
Stem Tuber 0
Unclassified 18.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10685675 3300009147 Bacteria 1318
2 2214736892 2209111006 Bacteria 4025
3 ARSoilYngRDRAFT_c00585 3300000042 Bacteria 3911
4 ARcpr5yngRDRAFT_c000599 3300000043 Bacteria 4527
5 ARSoilOldRDRAFT_c000515 3300000044 Bacteria 4336
6 ARSoilOldRDRAFT_c001342 3300000044 Unclassified 2299
7 ARCol0yngRDRAFT_1000486 3300000652 Bacteria 4724
8 JGI25404J52841_10000174 3300003659 Bacteria 7374
9 JGI25405J52794_10007189 3300003911 Bacteria 2049
10 Ga0065715_10000317 3300005293 Bacteria 15993
11 Ga0070683_100431342 3300005329 Unclassified 1257
12 Ga0070690_100004460 3300005330 Bacteria 7777
13 Ga0070690_100021058 3300005330 Bacteria 3978
14 Ga0070690_100104225 3300005330 Bacteria 1884
15 Ga0070670_100017162 3300005331 Bacteria 6210
16 Ga0070670_100148752 3300005331 Bacteria 2026
17 Ga0070666_10026208 3300005335 Bacteria 3806
18 Ga0070666_10189245 3300005335 Bacteria 1446
19 Ga0068868_100028588 3300005338 Bacteria 4264
20 Ga0070660_100232208 3300005339 Unclassified 1501
21 Ga0070660_100292690 3300005339 Unclassified 1334
22 Ga0070689_100002134 3300005340 Bacteria 12846
23 Ga0070689_100036583 3300005340 Bacteria 3755
24 Ga0070689_100052338 3300005340 Unclassified 3158
25 Ga0070692_10217365 3300005345 Unclassified 1128
26 Ga0070669_100084139 3300005353 Bacteria 2373
27 Ga0070671_100010441 3300005355 Bacteria 7450
28 Ga0070671_100267093 3300005355 Bacteria 1454
29 Ga0070674_100037336 3300005356 Bacteria 3267
30 Ga0070674_100083782 3300005356 Bacteria 2285
31 Ga0070673_100190347 3300005364 Bacteria 1762
32 Ga0070688_100042922 3300005365 Bacteria 2784
33 Ga0070688_100275625 3300005365 Bacteria 1206
34 Ga0070667_100047003 3300005367 Unclassified 3631
35 Ga0070667_100110501 3300005367 Unclassified 2383
36 Ga0070709_10005532 3300005434 Bacteria 6840
37 Ga0070709_10047694 3300005434 Bacteria 2669
38 Ga0070709_10145423 3300005434 Bacteria 1633
39 Ga0070709_10266473 3300005434 Unclassified 1240
40 Ga0070714_100165416 3300005435 Bacteria 2004
41 Ga0070714_100179018 3300005435 Bacteria 1928
42 Ga0070713_100005026 3300005436 Bacteria 8988
43 Ga0070713_100022621 3300005436 Bacteria 4860
44 Ga0070713_100054599 3300005436 Unclassified 3315
45 Ga0070713_100070626 3300005436 Unclassified 2948
46 Ga0070713_100140960 3300005436 Bacteria 2135
47 Ga0070710_10001919 3300005437 Bacteria 9846
48 Ga0070710_10004346 3300005437 Bacteria 6712
49 Ga0070711_100031866 3300005439 Bacteria 3502
50 Ga0070711_100090099 3300005439 Bacteria 2208
51 Ga0070711_100176960 3300005439 Bacteria 1630
52 Ga0070711_100254315 3300005439 Bacteria 1379
53 Ga0070711_100313705 3300005439 Bacteria 1250
54 Ga0070708_100010931 3300005445 Bacteria 7375
55 Ga0070708_100039455 3300005445 Bacteria 4131
56 Ga0070663_100020275 3300005455 Bacteria 4399
57 Ga0070663_100049417 3300005455 Unclassified 2986
58 Ga0070663_100319313 3300005455 Bacteria 1248
59 Ga0070663_100358187 3300005455 Unclassified 1183
60 Ga0070678_100004147 3300005456 Bacteria 8166
61 Ga0070678_100011241 3300005456 Bacteria 5513
62 Ga0070678_100350414 3300005456 Bacteria 1269
63 Ga0070662_100068208 3300005457 Bacteria 2614
64 Ga0070685_10006301 3300005466 Viruses 6046
65 Ga0070685_10102669 3300005466 Bacteria 1748
66 Ga0070706_100092852 3300005467 Bacteria 2800
67 Ga0070706_100120917 3300005467 Bacteria 2441
68 Ga0070706_100142498 3300005467 Bacteria 2237
69 Ga0070706_100191488 3300005467 Unclassified 1911
70 Ga0070707_100030908 3300005468 Bacteria 5100
71 Ga0070707_100180906 3300005468 Bacteria 2055
72 Ga0070698_100034201 3300005471 Bacteria 5264
73 Ga0070698_100050289 3300005471 Bacteria 4250
74 Ga0070698_100073704 3300005471 Bacteria 3420
75 Ga0070698_100152555 3300005471 Bacteria 2257
76 Ga0070698_100259373 3300005471 Bacteria 1670
77 Ga0070698_100291002 3300005471 Bacteria 1564
78 Ga0070698_100336713 3300005471 Bacteria 1440
79 Ga0070699_100021594 3300005518 Bacteria 5551
80 Ga0070699_100128895 3300005518 Unclassified 2229
81 Ga0070699_100248307 3300005518 Bacteria 1589
82 Ga0070684_100134837 3300005535 Bacteria 2229
83 Ga0070697_100022017 3300005536 Bacteria 5057
84 Ga0070697_100039481 3300005536 Bacteria 3816
85 Ga0070697_100087885 3300005536 Bacteria 2566
86 Ga0070697_100165906 3300005536 Bacteria 1867
87 Ga0070697_100278557 3300005536 Bacteria 1434
88 Ga0068853_100116500 3300005539 Bacteria 2379
89 Ga0068853_100356872 3300005539 Unclassified 1361
90 Ga0070686_100007929 3300005544 Bacteria 5936
91 Ga0070686_100140533 3300005544 Bacteria 1680
92 Ga0070695_100025782 3300005545 Bacteria 3632
93 Ga0070695_100170314 3300005545 Unclassified 1536
94 Ga0070665_100130113 3300005548 Bacteria 2519
95 Ga0070665_100131273 3300005548 Unclassified 2507
96 Ga0070665_100482988 3300005548 Bacteria 1250
97 Ga0070664_100041822 3300005564 Unclassified 3868
98 Ga0070664_100256842 3300005564 Bacteria 1571
99 Ga0068856_100147934 3300005614 Unclassified 2357
100 Ga0070702_100071900 3300005615 Bacteria 2046
101 Ga0068859_100482966 3300005617 Bacteria 1334
102 Ga0068864_100007135 3300005618 Bacteria 9179
103 Ga0068864_100040471 3300005618 Unclassified 3987
104 Ga0068863_100080065 3300005841 Unclassified 3094
105 Ga0068863_100169547 3300005841 Unclassified 2093
106 Ga0068863_100316311 3300005841 Bacteria 1516
107 Ga0068858_100011560 3300005842 Bacteria 8328
108 Ga0068858_100228028 3300005842 Bacteria 1765
109 Ga0068860_100075517 3300005843 Bacteria 3205
110 Ga0068860_100282972 3300005843 Bacteria 1621
111 Ga0068862_100042405 3300005844 Bacteria 3876
112 Ga0068862_100419469 3300005844 Bacteria 1255
113 Ga0081455_10010473 3300005937 Bacteria 9404
114 Ga0081455_10011829 3300005937 Bacteria 8737
115 Ga0081455_10013667 3300005937 Bacteria 7997
116 Ga0081455_10017478 3300005937 Bacteria 6872
117 Ga0081455_10019106 3300005937 Bacteria 6495
118 Ga0081455_10019274 3300005937 Bacteria 6459
119 Ga0081455_10025087 3300005937 Bacteria 5509
120 Ga0081455_10028248 3300005937 Bacteria 5127
121 Ga0081455_10034591 3300005937 Bacteria 4526
122 Ga0081455_10040532 3300005937 Bacteria 4105
123 Ga0081455_10056887 3300005937 Bacteria 3318
124 Ga0081455_10279096 3300005937 Bacteria 1208
125 Ga0081540_1002393 3300005983 Bacteria 15301
126 Ga0081540_1016916 3300005983 Bacteria 4540
127 Ga0081540_1034037 3300005983 Bacteria 2756
128 Ga0081540_1038943 3300005983 Unclassified 2498
129 Ga0081540_1045403 3300005983 Bacteria 2232
130 Ga0081540_1102090 3300005983 Bacteria 1233
131 Ga0081539_10015294 3300005985 Bacteria 5587
132 Ga0070717_10005760 3300006028 Bacteria 9073
133 Ga0070717_10016433 3300006028 Bacteria 5737
134 Ga0070717_10020508 3300006028 Bacteria 5200
135 Ga0070717_10031714 3300006028 Bacteria 4254
136 Ga0070717_10057127 3300006028 Bacteria 3225
137 Ga0070717_10065932 3300006028 Bacteria 3010
138 Ga0070717_10336300 3300006028 Unclassified 1347
139 Ga0070717_10504312 3300006028 Bacteria 1094
140 Ga0075365_10052956 3300006038 Bacteria 2686
141 Ga0075365_10108852 3300006038 Bacteria 1903
142 Ga0075365_10173460 3300006038 Bacteria 1506
143 Ga0075365_10276659 3300006038 Bacteria 1181
144 Ga0075364_10327711 3300006051 Bacteria 1043
145 Ga0070715_10003812 3300006163 Unclassified 4865
146 Ga0070716_100001955 3300006173 Bacteria 9364
147 Ga0070716_100002302 3300006173 Bacteria 8796
148 Ga0070712_100060488 3300006175 Bacteria 2671
149 Ga0070712_100086146 3300006175 Bacteria 2289
150 Ga0070712_100093053 3300006175 Bacteria 2212
151 Ga0075367_10062119 3300006178 Bacteria 2230
152 Ga0075427_10000053 3300006194 Bacteria 8702
153 Ga0097621_100084126 3300006237 Bacteria 2652
154 Ga0097621_100389961 3300006237 Bacteria 1245
155 Ga0068871_100003994 3300006358 Bacteria 10204
156 Ga0075428_100007352 3300006844 Bacteria 12206
157 Ga0075428_100011982 3300006844 Bacteria 9645
158 Ga0075428_100102690 3300006844 Bacteria 3118
159 Ga0075428_100168764 3300006844 Bacteria 2373
160 Ga0075428_100338185 3300006844 Bacteria 1617
161 Ga0075428_100359177 3300006844 Bacteria 1563
162 Ga0075428_100453943 3300006844 Bacteria 1373
163 Ga0075430_100005909 3300006846 Bacteria 10336
164 Ga0075430_100012987 3300006846 Bacteria 7098
165 Ga0075430_100244535 3300006846 Bacteria 1487
166 Ga0075431_100009243 3300006847 Bacteria 9894
167 Ga0075431_100015602 3300006847 Bacteria 7700
168 Ga0075431_100015893 3300006847 Bacteria 7633
169 Ga0075431_100184910 3300006847 Bacteria 2137
170 Ga0075431_100268475 3300006847 Bacteria 1730
171 Ga0075431_100599183 3300006847 Bacteria 1086
172 Ga0075433_10000879 3300006852 Bacteria 21113
173 Ga0075433_10004805 3300006852 Bacteria 10546
174 Ga0075434_100001712 3300006871 Bacteria 18787
175 Ga0075434_100004256 3300006871 Bacteria 12832
176 Ga0075434_100018135 3300006871 Bacteria 6793
177 Ga0075434_100036112 3300006871 Bacteria 4887
178 Ga0075434_100202456 3300006871 Unclassified 2005
179 Ga0075434_100221821 3300006871 Bacteria 1910
180 Ga0075434_100264425 3300006871 Bacteria 1739
181 Ga0075434_100398974 3300006871 Bacteria 1396
182 Ga0075434_100537515 3300006871 Unclassified 1189
183 Ga0075429_100004087 3300006880 Bacteria 12510
184 Ga0075429_100005992 3300006880 Bacteria 10508
185 Ga0075429_100252791 3300006880 Bacteria 1543
186 Ga0068865_100038087 3300006881 Unclassified 3252
187 Ga0068865_100069889 3300006881 Bacteria 2486
188 Ga0068865_100241070 3300006881 Bacteria 1423
189 Ga0068865_100291455 3300006881 Bacteria 1303
190 Ga0075436_100236166 3300006914 Bacteria 1299
191 Ga0075436_100284092 3300006914 Bacteria 1183
192 Ga0097620_100482983 3300006931 Bacteria 1334
193 Ga0075435_100016835 3300007076 Bacteria 5519
194 Ga0075435_100020675 3300007076 Bacteria 5050
195 Ga0075435_100041758 3300007076 Bacteria 3667
196 Ga0075435_100061588 3300007076 Unclassified 3044
197 Ga0075435_100281585 3300007076 Bacteria 1419
198 Ga0105251_10017633 3300009011 Bacteria 3820
199 Ga0111539_10002079 3300009094 Bacteria 26752
200 Ga0111539_10013519 3300009094 Bacteria 10201
201 Ga0111539_10251706 3300009094 Bacteria 2057
202 Ga0111539_10356004 3300009094 Bacteria 1703
203 Ga0111539_10388185 3300009094 Unclassified 1626
204 Ga0111539_10591681 3300009094 Unclassified 1292
205 Ga0105245_10038674 3300009098 Bacteria 4245
206 Ga0105245_10294837 3300009098 Unclassified 1589
207 Ga0105245_10446763 3300009098 Bacteria 1300
208 Ga0105247_10086091 3300009101 Bacteria 1988
209 Ga0114129_10011079 3300009147 Bacteria 12846
210 Ga0114129_10011621 3300009147 Bacteria 12534
211 Ga0114129_10070580 3300009147 Bacteria 4871
212 Ga0114129_10076437 3300009147 Unclassified 4662
213 Ga0114129_10150379 3300009147 Bacteria 3186
214 Ga0114129_10206547 3300009147 Bacteria 2657
215 Ga0114129_10226998 3300009147 Bacteria 2516
216 Ga0114129_10457409 3300009147 Unclassified 1673
217 Ga0114129_10580204 3300009147 Unclassified 1455
218 Ga0114129_10648010 3300009147 Bacteria 1364
219 Ga0114129_10892791 3300009147 Bacteria 1127
220 Ga0105243_10179285 3300009148 Bacteria 1841
221 Ga0105243_10278178 3300009148 Bacteria 1506
222 Ga0105241_10057605 3300009174 Bacteria 2981
223 Ga0105242_10022663 3300009176 Unclassified 4943
224 Ga0105242_10118919 3300009176 Bacteria 2264
225 Ga0105248_10122329 3300009177 Bacteria 2935
226 Ga0105248_10275092 3300009177 Bacteria 1896
227 Ga0105248_10878710 3300009177 Unclassified 1012
228 Ga0105237_10158564 3300009545 Bacteria 2260
229 Ga0105238_10260570 3300009551 Bacteria 1713
230 Ga0105249_10132766 3300009553 Bacteria 2379
231 Ga0105239_10031779 3300010375 Bacteria 5801
232 Ga0105239_10314611 3300010375 Bacteria 1765
233 Ga0105246_10046733 3300011119 Bacteria 2954
234 Ga0105246_10069678 3300011119 Bacteria 2471
235 Ga0105246_10099523 3300011119 Unclassified 2114
236 Ga0157374_10177969 3300013296 Bacteria 2076
237 Ga0157378_10022385 3300013297 Viruses 5564
238 Ga0157378_10029323 3300013297 Bacteria 4857
239 Ga0163162_10045915 3300013306 Bacteria 4378
240 Ga0163162_10114517 3300013306 Bacteria 2796
241 Ga0157375_10100567 3300013308 Bacteria 2972
242 Ga0157375_10209975 3300013308 Bacteria 2104
243 Ga0157375_10303960 3300013308 Bacteria 1759
244 Ga0157375_10379893 3300013308 Bacteria 1579
245 Ga0157375_10573139 3300013308 Bacteria 1289
246 Ga0163163_10214873 3300014325 Bacteria 1972
247 Ga0163163_10637049 3300014325 Bacteria 1129
248 Ga0157380_10128867 3300014326 Bacteria 2155
249 Ga0157379_10059576 3300014968 Unclassified 3413
250 Ga0157379_10316296 3300014968 Bacteria 1425
251 Ga0157376_10026942 3300014969 Unclassified 4549
252 Ga0157376_10285858 3300014969 Bacteria 1555
253 Ga0163161_10397056 3300017792 Bacteria 1105
254 Ga0207692_10037078 3300025898 Bacteria 2382
255 Ga0207692_10040897 3300025898 Unclassified 2291
256 Ga0207692_10047688 3300025898 Unclassified 2152
257 Ga0207692_10061667 3300025898 Bacteria 1944
258 Ga0207710_10001666 3300025900 Bacteria 10815
259 Ga0207710_10009742 3300025900 Unclassified 4037
260 Ga0207688_10206748 3300025901 Bacteria 1178
261 Ga0207680_10194626 3300025903 Bacteria 1378
262 Ga0207685_10000852 3300025905 Bacteria 5726
263 Ga0207685_10002496 3300025905 Unclassified 4234
264 Ga0207699_10002726 3300025906 Bacteria 8354
265 Ga0207699_10177242 3300025906 Unclassified 1430
266 Ga0207645_10186056 3300025907 Bacteria 1364
267 Ga0207684_10027535 3300025910 Bacteria 4841
268 Ga0207684_10153432 3300025910 Bacteria 1982
269 Ga0207684_10218853 3300025910 Bacteria 1643
270 Ga0207671_10213828 3300025914 Unclassified 1509
271 Ga0207671_10317151 3300025914 Bacteria 1233
272 Ga0207693_10002257 3300025915 Bacteria 16770
273 Ga0207693_10032126 3300025915 Unclassified 4144
274 Ga0207693_10185574 3300025915 Bacteria 1637
275 Ga0207693_10264121 3300025915 Bacteria 1349
276 Ga0207693_10374464 3300025915 Unclassified 1114
277 Ga0207663_10004484 3300025916 Bacteria 6951
278 Ga0207663_10014341 3300025916 Bacteria 4334
279 Ga0207663_10055274 3300025916 Bacteria 2490
280 Ga0207663_10117746 3300025916 Unclassified 1813
281 Ga0207663_10179725 3300025916 Bacteria 1510
282 Ga0207662_10006431 3300025918 Bacteria 6340
283 Ga0207657_10046753 3300025919 Bacteria 3789
284 Ga0207657_10056643 3300025919 Unclassified 3381
285 Ga0207646_10016790 3300025922 Bacteria 6866
286 Ga0207646_10184523 3300025922 Bacteria 1884
287 Ga0207694_10068834 3300025924 Unclassified 2765
288 Ga0207650_10016493 3300025925 Bacteria 5165
289 Ga0207687_10012674 3300025927 Bacteria 5509
290 Ga0207700_10008320 3300025928 Bacteria 6415
291 Ga0207700_10011281 3300025928 Bacteria 5692
292 Ga0207700_10013270 3300025928 Bacteria 5353
293 Ga0207700_10161130 3300025928 Unclassified 1863
294 Ga0207664_10018639 3300025929 Bacteria 5114
295 Ga0207664_10058800 3300025929 Bacteria 3060
296 Ga0207664_10158582 3300025929 Bacteria 1928
297 Ga0207664_10460446 3300025929 Bacteria 1136
298 Ga0207664_10473624 3300025929 Bacteria 1120
299 Ga0207644_10015564 3300025931 Bacteria 5108
300 Ga0207644_10290867 3300025931 Bacteria 1314
301 Ga0207706_10015802 3300025933 Bacteria 6824
302 Ga0207706_10186789 3300025933 Bacteria 1820
303 Ga0207706_10257028 3300025933 Bacteria 1525
304 Ga0207686_10021084 3300025934 Bacteria 3733
305 Ga0207709_10172809 3300025935 Bacteria 1518
306 Ga0207670_10035697 3300025936 Unclassified 3226
307 Ga0207669_10194793 3300025937 Bacteria 1465
308 Ga0207704_10077981 3300025938 Unclassified 2129
309 Ga0207665_10004581 3300025939 Bacteria 9177
310 Ga0207665_10004818 3300025939 Bacteria 8981
311 Ga0207691_10025273 3300025940 Bacteria 5577
312 Ga0207691_10169455 3300025940 Bacteria 1913
313 Ga0207691_10477277 3300025940 Unclassified 1060
314 Ga0207711_10019178 3300025941 Bacteria 5694
315 Ga0207711_10247275 3300025941 Unclassified 1637
316 Ga0207711_10403155 3300025941 Bacteria 1271
317 Ga0207689_10118051 3300025942 Bacteria 2181
318 Ga0207689_10416523 3300025942 Bacteria 1121
319 Ga0207679_10051394 3300025945 Bacteria 3017
320 Ga0207679_10395078 3300025945 Bacteria 1215
321 Ga0207712_10262170 3300025961 Bacteria 1402
322 Ga0207677_10029000 3300026023 Unclassified 3510
323 Ga0207677_10454620 3300026023 Bacteria 1098
324 Ga0207703_10018327 3300026035 Bacteria 5467
325 Ga0207678_10029079 3300026067 Unclassified 4823
326 Ga0207678_10163473 3300026067 Bacteria 1901
327 Ga0207678_10371685 3300026067 Unclassified 1235
328 Ga0207708_10052449 3300026075 Unclassified 3107
329 Ga0207708_10361068 3300026075 Bacteria 1194
330 Ga0207641_10171509 3300026088 Bacteria 1981
331 Ga0207641_10455896 3300026088 Bacteria 1236
332 Ga0207641_10484973 3300026088 Unclassified 1198
333 Ga0207648_10091884 3300026089 Bacteria 2653
334 Ga0207676_10039914 3300026095 Unclassified 3594
335 Ga0207676_10294872 3300026095 Bacteria 1478
336 Ga0207675_100058268 3300026118 Bacteria 3605
337 Ga0207675_100308945 3300026118 Unclassified 1542
338 Ga0207675_100398689 3300026118 Bacteria 1356
339 Ga0207683_10006413 3300026121 Bacteria 10074
340 Ga0207683_10009778 3300026121 Bacteria 8174
341 Ga0207683_10422244 3300026121 Bacteria 1228
342 Ga0207683_10522030 3300026121 Unclassified 1097
343 Ga0209588_1039745 3300027671 Bacteria 1517
344 Ga0207428_10000188 3300027907 Bacteria 85820
345 Ga0207428_10000272 3300027907 Bacteria 69872
346 Ga0207428_10007370 3300027907 Bacteria 10036
347 Ga0268266_10005275 3300028379 Bacteria 12134
348 Ga0268265_10020129 3300028380 Bacteria 4653
349 Ga0268265_10261556 3300028380 Bacteria 1539
350 Ga0268264_10123366 3300028381 Bacteria 2286
351 Ga0268264_10160086 3300028381 Unclassified 2027
352 Ga0268264_10394612 3300028381 Unclassified 1328
353 Ga0373938_0004964 3300034957 Bacteria 2243
354 Ga0373926_0028368 3300035083 Unclassified 1964
355 Ga0373926_0072714 3300035083 Bacteria 1265
356 Ga0373928_0000134 3300035084 Bacteria 14013
357 Ga0373929_0011840 3300035085 Unclassified 1649
358 Ga0373940_0010416 3300035088 Bacteria 2184
359 Ga0373944_0062840 3300035089 Bacteria 1194
360 Ga0373944_0067247 3300035089 Bacteria 1161
361 Ga0373949_0006133 3300035090 Bacteria 2657
362 Ga0373951_0005808 3300035091 Bacteria 2851
363 Ga0373952_0000475 3300035092 Bacteria 6981
364 Ga0373932_0007269 3300035112 Bacteria 2634
365 Ga0373936_0032079 3300035113 Bacteria 2077
366 Ga0373939_0014082 3300035114 Unclassified 2069
367 Ga0373939_0035452 3300035114 Unclassified 1470
368 Ga0373941_0075418 3300035115 Unclassified 1128
369 Ga0373945_0004241 3300035116 Bacteria 4544
370 Ga0373956_0019208 3300035119 Bacteria 2898
371 Ga0373960_0055822 3300035121 Bacteria 1185
372 Ga0373943_0010356 3300035170 Unclassified 4182
373 Ga0373943_0087770 3300035170 Unclassified 1606
374 Ga0373943_0105042 3300035170 Bacteria 1482
375 Ga0373942_0001883 3300035207 Bacteria 5269
376 Ga0373961_0006229 3300035241 Bacteria 2868
377 Ga0373962_0001989 3300035242 Bacteria 4876
378 Ga0373931_0001007 3300035691 Bacteria 11924
379 Ga0373931_0032529 3300035691 Unclassified 2699
380 Ga0373931_0077942 3300035691 Bacteria 1822
381 Ga0373935_0279702 3300035692 Bacteria 1175
382 Ga0373927_0016199 3300035695 Bacteria 4919
383 Ga0373927_0080382 3300035695 Bacteria 2112
384 Ga0373927_0239819 3300035695 Bacteria 1191
385 Ga0373947_0001106 3300035725 Bacteria 16547
386 Ga0373947_0032003 3300035725 Bacteria 3098
387 Ga0373947_0081459 3300035725 Bacteria 2004
388 Ga0373947_0105397 3300035725 Bacteria 1776
389 Ga0373947_0145522 3300035725 Bacteria 1523
390 Ga0373937_0110611 3300036401 Unclassified 2555
391 Ga0373925_0015785 3300037068 Bacteria 5465
392 Ga0373925_0083380 3300037068 Bacteria 2434
393 Ga0373925_0268084 3300037068 Bacteria 1373
394 Ga0373925_0290848 3300037068 Bacteria 1317
395 Ga0395898_0354027 3300037466 Bacteria 1400
396 Ga0395901_0210187 3300038443 Bacteria 2037
397 Ga0451577_0338306 3300042876 Unclassified 1365
398 Ga0451576_0011582 3300045051 Bacteria 10001
399 Ga0451576_0130723 3300045051 Bacteria 2617
400 Ga0495592_0106620 3300046454 Unclassified 1988
401 Ga0495603_0013986 3300046455 Bacteria 4853
402 Ga0495603_0016481 3300046455 Bacteria 4471
403 Ga0495603_0112633 3300046455 Bacteria 1586
404 Ga0495603_0132097 3300046455 Bacteria 1453
405 Ga0495629_0002073 3300046459 Bacteria 15547
406 Ga0495629_0016703 3300046459 Bacteria 5267
407 Ga0495629_0088235 3300046459 Unclassified 2163
408 Ga0495629_0090419 3300046459 Bacteria 2136
409 Ga0495629_0166739 3300046459 Bacteria 1529
410 Ga0495629_0320810 3300046459 Unclassified 1059
411 Ga0495641_0042544 3300046461 Bacteria 2104
412 Ga0495641_0114709 3300046461 Bacteria 1202
413 Ga0495651_0033326 3300046462 Bacteria 4018
414 Ga0495653_0011366 3300046463 Bacteria 7273
415 Ga0495580_0026902 3300046472 Unclassified 4189
416 Ga0495580_0274053 3300046472 Bacteria 1152
417 Ga0495582_0015979 3300046473 Bacteria 4115
418 Ga0495582_0072769 3300046473 Bacteria 1902
419 Ga0495582_0178594 3300046473 Bacteria 1209
420 Ga0495639_0013332 3300046475 Bacteria 3548
421 Ga0495662_0011530 3300046476 Bacteria 4319
422 Ga0495662_0101766 3300046476 Bacteria 1405
423 Ga0495664_0040685 3300046477 Unclassified 2749
424 Ga0495585_0048211 3300046492 Bacteria 2369
425 Ga0495594_0057076 3300046499 Bacteria 2156
426 Ga0495594_0072902 3300046499 Unclassified 1910
427 Ga0495607_0047370 3300046501 Bacteria 2519
428 Ga0495607_0107517 3300046501 Bacteria 1483
429 Ga0495608_0030135 3300046511 Unclassified 3676
430 Ga0495618_0007442 3300046514 Bacteria 6622
431 Ga0495630_0036783 3300046517 Unclassified 3659
432 Ga0495630_0116927 3300046517 Bacteria 2021
433 Ga0495644_0001276 3300046523 Bacteria 10320
434 Ga0495644_0108673 3300046523 Bacteria 1052
435 Ga0495666_0046908 3300046526 Unclassified 2081
436 Ga0495652_0024127 3300046529 Bacteria 5386
437 Ga0495652_0255686 3300046529 Bacteria 1296
438 Ga0495665_0032070 3300046531 Unclassified 2810
439 Ga0495640_0004107 3300046533 Bacteria 11646
440 Ga0495598_0077418 3300046537 Bacteria 1060
441 Ga0495645_0247465 3300046543 Unclassified 1186
442 Ga0495667_0008711 3300046559 Bacteria 6889
443 Ga0495634_0005431 3300046642 Bacteria 9818
444 Ga0495635_0014387 3300046663 Bacteria 5535
445 Ga0495588_0018422 3300046674 Unclassified 3404
446 Ga0495599_0200430 3300046678 Bacteria 1226
447 Ga0495647_0001797 3300046681 Bacteria 6630
448 Ga0495647_0023045 3300046681 Bacteria 2255
449 Ga0495647_0050859 3300046681 Bacteria 1609
450 Ga0495658_0007392 3300046683 Bacteria 5434
451 Ga0495658_0174932 3300046683 Bacteria 1330
452 Ga0495669_0063201 3300046684 Bacteria 1679
453 Ga0495613_0017532 3300046689 Bacteria 5331
454 Ga0495624_0031217 3300046690 Unclassified 3466
455 Ga0495624_0060936 3300046690 Bacteria 2365
456 Ga0495670_0004732 3300046691 Bacteria 6684
457 Ga0495600_0015759 3300046809 Bacteria 4786
458 Ga0495581_0049835 3300047315 Unclassified 2418
459 Ga0495604_0027407 3300047317 Bacteria 4532
460 Ga0495674_0002307 3300047319 Bacteria 18712
461 Ga0495676_0032801 3300047321 Bacteria 4381
462 Ga0495676_0079738 3300047321 Bacteria 2488
463 Ga0495676_0225013 3300047321 Bacteria 1291
464 Ga0495676_0299791 3300047321 Bacteria 1084
465 Ga0495680_0013401 3300047322 Bacteria 7155
466 Ga0495680_0338720 3300047322 Bacteria 1049
467 Ga0495684_0001148 3300047471 Bacteria 21341
468 Ga0495614_0038606 3300048089 Bacteria 2049
469 Ga0496100_0004970 3300048903 Bacteria 7108
470 Ga0496100_0031771 3300048903 Unclassified 3285
471 Ga0496100_0281869 3300048903 Bacteria 1239
472 Ga0496100_0312816 3300048903 Bacteria 1178
473 Ga0496101_0045993 3300048904 Bacteria 3128
474 Ga0496101_0080884 3300048904 Bacteria 2401
475 Ga0496101_0118916 3300048904 Bacteria 1996
476 Ga0496101_0128463 3300048904 Unclassified 1922
477 Ga0496101_0184124 3300048904 Bacteria 1609
478 Ga0496101_0266424 3300048904 Bacteria 1337
479 Ga0496101_0417685 3300048904 Bacteria 1057
480 Ga0496102_0502658 3300048905 Bacteria 1134
481 Ga0496103_0266713 3300048906 Bacteria 1101
482 Ga0496104_0000368 3300048907 Bacteria 39833
483 Ga0496104_0014709 3300048907 Bacteria 7071
484 Ga0496104_0023873 3300048907 Bacteria 5624
485 Ga0496104_0031351 3300048907 Bacteria 4943
486 Ga0496104_0038920 3300048907 Bacteria 4450
487 Ga0496104_0044886 3300048907 Bacteria 4154
488 Ga0496104_0049577 3300048907 Bacteria 3959
489 Ga0496104_0058755 3300048907 Bacteria 3640
490 Ga0496104_0059564 3300048907 Bacteria 3615
491 Ga0496104_0067390 3300048907 Bacteria 3400
492 Ga0496104_0169653 3300048907 Bacteria 2092
493 Ga0496104_0177128 3300048907 Bacteria 2042
494 Ga0496104_0429883 3300048907 Bacteria 1232
495 Ga0496104_0569269 3300048907 Bacteria 1043
496 Ga0496105_0020983 3300048908 Bacteria 5283
497 Ga0496105_0029142 3300048908 Bacteria 4517
498 Ga0496105_0033173 3300048908 Bacteria 4239
499 Ga0496105_0085903 3300048908 Bacteria 2600
500 Ga0496105_0104308 3300048908 Bacteria 2341
501 Ga0496105_0124165 3300048908 Bacteria 2128
502 Ga0496105_0137072 3300048908 Bacteria 2015
503 Ga0496105_0149997 3300048908 Bacteria 1916
504 Ga0496105_0201104 3300048908 Bacteria 1626
505 Ga0496105_0353977 3300048908 Bacteria 1172
506 Ga0496106_0006214 3300048909 Bacteria 8836
507 Ga0496106_0026830 3300048909 Unclassified 4289
508 Ga0496106_0198248 3300048909 Bacteria 1597
509 Ga0496106_0208346 3300048909 Bacteria 1557
510 Ga0496107_0021868 3300048910 Bacteria 4519
511 Ga0496107_0024401 3300048910 Bacteria 4277
512 Ga0496108_0031908 3300048911 Bacteria 4372
513 Ga0496108_0232852 3300048911 Bacteria 1602
514 Ga0496108_0237295 3300048911 Bacteria 1586
515 Ga0496108_0364494 3300048911 Unclassified 1261
516 Ga0496108_0444918 3300048911 Unclassified 1132
517 Ga0496109_0064470 3300048912 Bacteria 3353
518 Ga0496109_0089504 3300048912 Bacteria 2846
519 Ga0496109_0266962 3300048912 Bacteria 1612
520 Ga0496109_0600799 3300048912 Bacteria 1036
521 Ga0496109_0671919 3300048912 Bacteria 973
522 Ga0496110_0010917 3300048913 Bacteria 7407
523 Ga0496110_0021618 3300048913 Bacteria 5451
524 Ga0496110_0059847 3300048913 Bacteria 3358
525 Ga0496110_0084981 3300048913 Bacteria 2825
526 Ga0496110_0149447 3300048913 Bacteria 2114
527 Ga0496110_0155382 3300048913 Bacteria 2072
528 Ga0496110_0383747 3300048913 Bacteria 1280
529 Ga0496110_0538308 3300048913 Bacteria 1062
530 Ga0496111_0011587 3300048914 Bacteria 5944
531 Ga0496111_0036536 3300048914 Bacteria 3513
532 Ga0496111_0060616 3300048914 Unclassified 2742
533 Ga0496111_0179492 3300048914 Bacteria 1574
534 Ga0496112_0044695 3300048915 Bacteria 4341
535 Ga0496112_0048980 3300048915 Bacteria 4140
536 Ga0496112_0117946 3300048915 Bacteria 2624
537 Ga0496112_0391763 3300048915 Bacteria 1329
538 Ga0496112_0452620 3300048915 Bacteria 1221
539 Ga0496113_0019535 3300048916 Bacteria 4743
540 Ga0496113_0025579 3300048916 Unclassified 4209
541 Ga0496113_0126211 3300048916 Bacteria 2004
542 Ga0496113_0345976 3300048916 Bacteria 1192
543 Ga0496113_0392445 3300048916 Bacteria 1114
544 Ga0496114_0019243 3300048917 Bacteria 5531
545 Ga0496114_0117425 3300048917 Bacteria 2285
546 Ga0496114_0162899 3300048917 Bacteria 1940
547 Ga0496114_0171099 3300048917 Bacteria 1893
548 Ga0496114_0207735 3300048917 Unclassified 1716
549 Ga0496114_0416896 3300048917 Unclassified 1189
550 Ga0496115_0019304 3300048918 Bacteria 5245
551 Ga0496115_0022053 3300048918 Bacteria 4926
552 Ga0496115_0048961 3300048918 Bacteria 3381
553 Ga0496115_0114646 3300048918 Bacteria 2215
554 Ga0496115_0314026 3300048918 Bacteria 1283
555 Ga0496115_0343230 3300048918 Unclassified 1218
556 Ga0496115_0382176 3300048918 Bacteria 1145
557 Ga0501076_0218029 3300049592 Bacteria 1560
558 nmdc:mga00v17_205695_c1 3300050491 Bacteria 1273
559 nmdc:mga0yw44_145086_c1 3300050492 Bacteria 1545
560 nmdc:mga0yw44_33399_c1 3300050492 Bacteria 3006
561 nmdc:mga0yw44_80533_c1 3300050492 Bacteria 2040
562 nmdc:mga06z11_16016_c1 3300050494 Bacteria 3019
563 nmdc:mga05p37_139501_c1 3300050507 Unclassified 2971
564 nmdc:mga05p37_143838_c1 3300050507 Unclassified 2921
565 nmdc:mga05p37_2361_c1 3300050507 Bacteria 21958
566 nmdc:mga05p37_282587_c1 3300050507 Bacteria 1979
567 nmdc:mga05p37_285201_c1 3300050507 Unclassified 1968
568 nmdc:mga05p37_398576_c1 3300050507 Unclassified 1607
569 nmdc:mga05p37_519728_c1 3300050507 Bacteria 1362
570 nmdc:mga05p37_7467_c1 3300050507 Bacteria 12892
571 nmdc:mga09592_17665_c1 3300050508 Bacteria 5847
572 nmdc:mga09592_34670_c1 3300050508 Unclassified 4220
573 nmdc:mga09592_37604_c1 3300050508 Bacteria 4061
574 nmdc:mga09592_9032_c1 3300050508 Bacteria 8101
575 nmdc:mga0qj67_1746_c1 3300050509 Bacteria 15360
576 nmdc:mga0qj67_19766_c1 3300050509 Bacteria 5151
577 nmdc:mga0qj67_30625_c1 3300050509 Bacteria 4189
578 nmdc:mga06r32_174385_c1 3300050510 Bacteria 2134
579 nmdc:mga06r32_19799_c1 3300050510 Bacteria 6185
580 nmdc:mga06r32_19891_c1 3300050510 Bacteria 6171
581 nmdc:mga06r32_546_c1 3300050510 Bacteria 32690
582 nmdc:mga06r32_91084_c1 3300050510 Unclassified 2980
583 nmdc:mga08y16_124764_c1 3300050511 Unclassified 2679
584 nmdc:mga08y16_1498_c1 3300050511 Bacteria 23520
585 nmdc:mga08y16_2619_c1 3300050511 Bacteria 18484
586 nmdc:mga08y16_32282_c1 3300050511 Bacteria 5506
587 nmdc:mga08y16_3375_c1 3300050511 Bacteria 16554
588 nmdc:mga08y16_501246_c1 3300050511 Bacteria 1233
589 nmdc:mga0n895_152906_c1 3300050512 Bacteria 2338
590 nmdc:mga0n895_160068_c1 3300050512 Unclassified 2283
591 nmdc:mga0n895_193529_c1 3300050512 Bacteria 2065
592 nmdc:mga0n895_303305_c1 3300050512 Unclassified 1619
593 nmdc:mga0n895_35211_c1 3300050512 Unclassified 4825
594 nmdc:mga0n895_365038_c1 3300050512 Unclassified 1462
595 nmdc:mga0n895_38950_c1 3300050512 Bacteria 4609
596 nmdc:mga0n895_449082_c1 3300050512 Bacteria 1302
597 nmdc:mga0n895_495701_c1 3300050512 Bacteria 1231
598 nmdc:mga0n895_56003_c1 3300050512 Bacteria 3883
599 nmdc:mga0n895_8191_c1 3300050512 Bacteria 9035
600 nmdc:mga0rr50_11345_c1 3300050513 Bacteria 5700
601 nmdc:mga0rr50_212656_c1 3300050513 Bacteria 1594
602 nmdc:mga0rr50_641969_c1 3300050513 Unclassified 906
603 nmdc:mga08x19_128684_c1 3300050514 Bacteria 1702
604 nmdc:mga0a205_100_c1 3300050515 Bacteria 49122
605 nmdc:mga0a205_184567_c1 3300050515 Bacteria 1979
606 nmdc:mga0a205_32636_c1 3300050515 Bacteria 4992
607 nmdc:mga0a205_389497_c1 3300050515 Bacteria 1258
608 nmdc:mga0a205_444_c1 3300050515 Bacteria 31211
609 nmdc:mga0a205_48095_c1 3300050515 Bacteria 4116
610 Ga0495601_0000704 3300053077 Bacteria 17930
611 Ga0495601_0032014 3300053077 Bacteria 3271
612 Ga0495601_0214371 3300053077 Bacteria 1258
613 Ga0495612_0004379 3300053078 Bacteria 5859
614 Ga0495595_0000241 3300053084 Bacteria 21521
615 Ga0495595_0067226 3300053084 Bacteria 1689
616 Ga0495619_0001954 3300053085 Bacteria 13749
617 Ga0495619_0012903 3300053085 Bacteria 5263
618 Ga0495619_0094886 3300053085 Unclassified 2024
619 Ga0495619_0187973 3300053085 Bacteria 1430
620 Ga0501082_0226760 3300060353 Bacteria 1626
621 2885411751 2885409591 Bacteria 9235467
622 Ga0114129_10685675
623 2214736892
624 ARSoilYngRDRAFT_c00585
625 ARcpr5yngRDRAFT_c000599
626 ARSoilOldRDRAFT_c000515
627 ARSoilOldRDRAFT_c001342
628 ARCol0yngRDRAFT_1000486
629 JGI25404J52841_10000174
630 JGI25405J52794_10007189
631 Ga0065715_10000317
632 Ga0070683_100431342
633 Ga0070690_100004460
634 Ga0070690_100021058
635 Ga0070690_100104225
636 Ga0070670_100017162
637 Ga0070670_100148752
638 Ga0070666_10026208
639 Ga0070666_10189245
640 Ga0068868_100028588
641 Ga0070660_100232208
642 Ga0070660_100292690
643 Ga0070689_100002134
644 Ga0070689_100036583
645 Ga0070689_100052338
646 Ga0070692_10217365
647 Ga0070669_100084139
648 Ga0070671_100010441
649 Ga0070671_100267093
650 Ga0070674_100037336
651 Ga0070674_100083782
652 Ga0070673_100190347
653 Ga0070688_100042922
654 Ga0070688_100275625
655 Ga0070667_100047003
656 Ga0070667_100110501
657 Ga0070709_10005532
658 Ga0070709_10047694
659 Ga0070709_10145423
660 Ga0070709_10266473
661 Ga0070714_100165416
662 Ga0070714_100179018
663 Ga0070713_100005026
664 Ga0070713_100022621
665 Ga0070713_100054599
666 Ga0070713_100070626
667 Ga0070713_100140960
668 Ga0070710_10001919
669 Ga0070710_10004346
670 Ga0070711_100031866
671 Ga0070711_100090099
672 Ga0070711_100176960
673 Ga0070711_100254315
674 Ga0070711_100313705
675 Ga0070708_100010931
676 Ga0070708_100039455
677 Ga0070663_100020275
678 Ga0070663_100049417
679 Ga0070663_100319313
680 Ga0070663_100358187
681 Ga0070678_100004147
682 Ga0070678_100011241
683 Ga0070678_100350414
684 Ga0070662_100068208
685 Ga0070685_10006301
686 Ga0070685_10102669
687 Ga0070706_100092852
688 Ga0070706_100120917
689 Ga0070706_100142498
690 Ga0070706_100191488
691 Ga0070707_100030908
692 Ga0070707_100180906
693 Ga0070698_100034201
694 Ga0070698_100050289
695 Ga0070698_100073704
696 Ga0070698_100152555
697 Ga0070698_100259373
698 Ga0070698_100291002
699 Ga0070698_100336713
700 Ga0070699_100021594
701 Ga0070699_100128895
702 Ga0070699_100248307
703 Ga0070684_100134837
704 Ga0070697_100022017
705 Ga0070697_100039481
706 Ga0070697_100087885
707 Ga0070697_100165906
708 Ga0070697_100278557
709 Ga0068853_100116500
710 Ga0068853_100356872
711 Ga0070686_100007929
712 Ga0070686_100140533
713 Ga0070695_100025782
714 Ga0070695_100170314
715 Ga0070665_100130113
716 Ga0070665_100131273
717 Ga0070665_100482988
718 Ga0070664_100041822
719 Ga0070664_100256842
720 Ga0068856_100147934
721 Ga0070702_100071900
722 Ga0068859_100482966
723 Ga0068864_100007135
724 Ga0068864_100040471
725 Ga0068863_100080065
726 Ga0068863_100169547
727 Ga0068863_100316311
728 Ga0068858_100011560
729 Ga0068858_100228028
730 Ga0068860_100075517
731 Ga0068860_100282972
732 Ga0068862_100042405
733 Ga0068862_100419469
734 Ga0081455_10010473
735 Ga0081455_10011829
736 Ga0081455_10013667
737 Ga0081455_10017478
738 Ga0081455_10019106
739 Ga0081455_10019274
740 Ga0081455_10025087
741 Ga0081455_10028248
742 Ga0081455_10034591
743 Ga0081455_10040532
744 Ga0081455_10056887
745 Ga0081455_10279096
746 Ga0081540_1002393
747 Ga0081540_1016916
748 Ga0081540_1034037
749 Ga0081540_1038943
750 Ga0081540_1045403
751 Ga0081540_1102090
752 Ga0081539_10015294
753 Ga0070717_10005760
754 Ga0070717_10016433
755 Ga0070717_10020508
756 Ga0070717_10031714
757 Ga0070717_10057127
758 Ga0070717_10065932
759 Ga0070717_10336300
760 Ga0070717_10504312
761 Ga0075365_10052956
762 Ga0075365_10108852
763 Ga0075365_10173460
764 Ga0075365_10276659
765 Ga0075364_10327711
766 Ga0070715_10003812
767 Ga0070716_100001955
768 Ga0070716_100002302
769 Ga0070712_100060488
770 Ga0070712_100086146
771 Ga0070712_100093053
772 Ga0075367_10062119
773 Ga0075427_10000053
774 Ga0097621_100084126
775 Ga0097621_100389961
776 Ga0068871_100003994
777 Ga0075428_100007352
778 Ga0075428_100011982
779 Ga0075428_100102690
780 Ga0075428_100168764
781 Ga0075428_100338185
782 Ga0075428_100359177
783 Ga0075428_100453943
784 Ga0075430_100005909
785 Ga0075430_100012987
786 Ga0075430_100244535
787 Ga0075431_100009243
788 Ga0075431_100015602
789 Ga0075431_100015893
790 Ga0075431_100184910
791 Ga0075431_100268475
792 Ga0075431_100599183
793 Ga0075433_10000879
794 Ga0075433_10004805
795 Ga0075434_100001712
796 Ga0075434_100004256
797 Ga0075434_100018135
798 Ga0075434_100036112
799 Ga0075434_100202456
800 Ga0075434_100221821
801 Ga0075434_100264425
802 Ga0075434_100398974
803 Ga0075434_100537515
804 Ga0075429_100004087
805 Ga0075429_100005992
806 Ga0075429_100252791
807 Ga0068865_100038087
808 Ga0068865_100069889
809 Ga0068865_100241070
810 Ga0068865_100291455
811 Ga0075436_100236166
812 Ga0075436_100284092
813 Ga0097620_100482983
814 Ga0075435_100016835
815 Ga0075435_100020675
816 Ga0075435_100041758
817 Ga0075435_100061588
818 Ga0075435_100281585
819 Ga0105251_10017633
820 Ga0111539_10002079
821 Ga0111539_10013519
822 Ga0111539_10251706
823 Ga0111539_10356004
824 Ga0111539_10388185
825 Ga0111539_10591681
826 Ga0105245_10038674
827 Ga0105245_10294837
828 Ga0105245_10446763
829 Ga0105247_10086091
830 Ga0114129_10011079
831 Ga0114129_10011621
832 Ga0114129_10070580
833 Ga0114129_10076437
834 Ga0114129_10150379
835 Ga0114129_10206547
836 Ga0114129_10226998
837 Ga0114129_10457409
838 Ga0114129_10580204
839 Ga0114129_10648010
840 Ga0114129_10892791
841 Ga0105243_10179285
842 Ga0105243_10278178
843 Ga0105241_10057605
844 Ga0105242_10022663
845 Ga0105242_10118919
846 Ga0105248_10122329
847 Ga0105248_10275092
848 Ga0105248_10878710
849 Ga0105237_10158564
850 Ga0105238_10260570
851 Ga0105249_10132766
852 Ga0105239_10031779
853 Ga0105239_10314611
854 Ga0105246_10046733
855 Ga0105246_10069678
856 Ga0105246_10099523
857 Ga0157374_10177969
858 Ga0157378_10022385
859 Ga0157378_10029323
860 Ga0163162_10045915
861 Ga0163162_10114517
862 Ga0157375_10100567
863 Ga0157375_10209975
864 Ga0157375_10303960
865 Ga0157375_10379893
866 Ga0157375_10573139
867 Ga0163163_10214873
868 Ga0163163_10637049
869 Ga0157380_10128867
870 Ga0157379_10059576
871 Ga0157379_10316296
872 Ga0157376_10026942
873 Ga0157376_10285858
874 Ga0163161_10397056
875 Ga0207692_10037078
876 Ga0207692_10040897
877 Ga0207692_10047688
878 Ga0207692_10061667
879 Ga0207710_10001666
880 Ga0207710_10009742
881 Ga0207688_10206748
882 Ga0207680_10194626
883 Ga0207685_10000852
884 Ga0207685_10002496
885 Ga0207699_10002726
886 Ga0207699_10177242
887 Ga0207645_10186056
888 Ga0207684_10027535
889 Ga0207684_10153432
890 Ga0207684_10218853
891 Ga0207671_10213828
892 Ga0207671_10317151
893 Ga0207693_10002257
894 Ga0207693_10032126
895 Ga0207693_10185574
896 Ga0207693_10264121
897 Ga0207693_10374464
898 Ga0207663_10004484
899 Ga0207663_10014341
900 Ga0207663_10055274
901 Ga0207663_10117746
902 Ga0207663_10179725
903 Ga0207662_10006431
904 Ga0207657_10046753
905 Ga0207657_10056643
906 Ga0207646_10016790
907 Ga0207646_10184523
908 Ga0207694_10068834
909 Ga0207650_10016493
910 Ga0207687_10012674
911 Ga0207700_10008320
912 Ga0207700_10011281
913 Ga0207700_10013270
914 Ga0207700_10161130
915 Ga0207664_10018639
916 Ga0207664_10058800
917 Ga0207664_10158582
918 Ga0207664_10460446
919 Ga0207664_10473624
920 Ga0207644_10015564
921 Ga0207644_10290867
922 Ga0207706_10015802
923 Ga0207706_10186789
924 Ga0207706_10257028
925 Ga0207686_10021084
926 Ga0207709_10172809
927 Ga0207670_10035697
928 Ga0207669_10194793
929 Ga0207704_10077981
930 Ga0207665_10004581
931 Ga0207665_10004818
932 Ga0207691_10025273
933 Ga0207691_10169455
934 Ga0207691_10477277
935 Ga0207711_10019178
936 Ga0207711_10247275
937 Ga0207711_10403155
938 Ga0207689_10118051
939 Ga0207689_10416523
940 Ga0207679_10051394
941 Ga0207679_10395078
942 Ga0207712_10262170
943 Ga0207677_10029000
944 Ga0207677_10454620
945 Ga0207703_10018327
946 Ga0207678_10029079
947 Ga0207678_10163473
948 Ga0207678_10371685
949 Ga0207708_10052449
950 Ga0207708_10361068
951 Ga0207641_10171509
952 Ga0207641_10455896
953 Ga0207641_10484973
954 Ga0207648_10091884
955 Ga0207676_10039914
956 Ga0207676_10294872
957 Ga0207675_100058268
958 Ga0207675_100308945
959 Ga0207675_100398689
960 Ga0207683_10006413
961 Ga0207683_10009778
962 Ga0207683_10422244
963 Ga0207683_10522030
964 Ga0209588_1039745
965 Ga0207428_10000188
966 Ga0207428_10000272
967 Ga0207428_10007370
968 Ga0268266_10005275
969 Ga0268265_10020129
970 Ga0268265_10261556
971 Ga0268264_10123366
972 Ga0268264_10160086
973 Ga0268264_10394612
974 Ga0373938_0004964
975 Ga0373926_0028368
976 Ga0373926_0072714
977 Ga0373928_0000134
978 Ga0373929_0011840
979 Ga0373940_0010416
980 Ga0373944_0062840
981 Ga0373944_0067247
982 Ga0373949_0006133
983 Ga0373951_0005808
984 Ga0373952_0000475
985 Ga0373932_0007269
986 Ga0373936_0032079
987 Ga0373939_0014082
988 Ga0373939_0035452
989 Ga0373941_0075418
990 Ga0373945_0004241
991 Ga0373956_0019208
992 Ga0373960_0055822
993 Ga0373943_0010356
994 Ga0373943_0087770
995 Ga0373943_0105042
996 Ga0373942_0001883
997 Ga0373961_0006229
998 Ga0373962_0001989
999 Ga0373931_0001007
1000 Ga0373931_0032529
1001 Ga0373931_0077942
1002 Ga0373935_0279702
1003 Ga0373927_0016199
1004 Ga0373927_0080382
1005 Ga0373927_0239819
1006 Ga0373947_0001106
1007 Ga0373947_0032003
1008 Ga0373947_0081459
1009 Ga0373947_0105397
1010 Ga0373947_0145522
1011 Ga0373937_0110611
1012 Ga0373925_0015785
1013 Ga0373925_0083380
1014 Ga0373925_0268084
1015 Ga0373925_0290848
1016 Ga0395898_0354027
1017 Ga0395901_0210187
1018 Ga0451577_0338306
1019 Ga0451576_0011582
1020 Ga0451576_0130723
1021 Ga0495592_0106620
1022 Ga0495603_0013986
1023 Ga0495603_0016481
1024 Ga0495603_0112633
1025 Ga0495603_0132097
1026 Ga0495629_0002073
1027 Ga0495629_0016703
1028 Ga0495629_0088235
1029 Ga0495629_0090419
1030 Ga0495629_0166739
1031 Ga0495629_0320810
1032 Ga0495641_0042544
1033 Ga0495641_0114709
1034 Ga0495651_0033326
1035 Ga0495653_0011366
1036 Ga0495580_0026902
1037 Ga0495580_0274053
1038 Ga0495582_0015979
1039 Ga0495582_0072769
1040 Ga0495582_0178594
1041 Ga0495639_0013332
1042 Ga0495662_0011530
1043 Ga0495662_0101766
1044 Ga0495664_0040685
1045 Ga0495585_0048211
1046 Ga0495594_0057076
1047 Ga0495594_0072902
1048 Ga0495607_0047370
1049 Ga0495607_0107517
1050 Ga0495608_0030135
1051 Ga0495618_0007442
1052 Ga0495630_0036783
1053 Ga0495630_0116927
1054 Ga0495644_0001276
1055 Ga0495644_0108673
1056 Ga0495666_0046908
1057 Ga0495652_0024127
1058 Ga0495652_0255686
1059 Ga0495665_0032070
1060 Ga0495640_0004107
1061 Ga0495598_0077418
1062 Ga0495645_0247465
1063 Ga0495667_0008711
1064 Ga0495634_0005431
1065 Ga0495635_0014387
1066 Ga0495588_0018422
1067 Ga0495599_0200430
1068 Ga0495647_0001797
1069 Ga0495647_0023045
1070 Ga0495647_0050859
1071 Ga0495658_0007392
1072 Ga0495658_0174932
1073 Ga0495669_0063201
1074 Ga0495613_0017532
1075 Ga0495624_0031217
1076 Ga0495624_0060936
1077 Ga0495670_0004732
1078 Ga0495600_0015759
1079 Ga0495581_0049835
1080 Ga0495604_0027407
1081 Ga0495674_0002307
1082 Ga0495676_0032801
1083 Ga0495676_0079738
1084 Ga0495676_0225013
1085 Ga0495676_0299791
1086 Ga0495680_0013401
1087 Ga0495680_0338720
1088 Ga0495684_0001148
1089 Ga0495614_0038606
1090 Ga0496100_0004970
1091 Ga0496100_0031771
1092 Ga0496100_0281869
1093 Ga0496100_0312816
1094 Ga0496101_0045993
1095 Ga0496101_0080884
1096 Ga0496101_0118916
1097 Ga0496101_0128463
1098 Ga0496101_0184124
1099 Ga0496101_0266424
1100 Ga0496101_0417685
1101 Ga0496102_0502658
1102 Ga0496103_0266713
1103 Ga0496104_0000368
1104 Ga0496104_0014709
1105 Ga0496104_0023873
1106 Ga0496104_0031351
1107 Ga0496104_0038920
1108 Ga0496104_0044886
1109 Ga0496104_0049577
1110 Ga0496104_0058755
1111 Ga0496104_0059564
1112 Ga0496104_0067390
1113 Ga0496104_0169653
1114 Ga0496104_0177128
1115 Ga0496104_0429883
1116 Ga0496104_0569269
1117 Ga0496105_0020983
1118 Ga0496105_0029142
1119 Ga0496105_0033173
1120 Ga0496105_0085903
1121 Ga0496105_0104308
1122 Ga0496105_0124165
1123 Ga0496105_0137072
1124 Ga0496105_0149997
1125 Ga0496105_0201104
1126 Ga0496105_0353977
1127 Ga0496106_0006214
1128 Ga0496106_0026830
1129 Ga0496106_0198248
1130 Ga0496106_0208346
1131 Ga0496107_0021868
1132 Ga0496107_0024401
1133 Ga0496108_0031908
1134 Ga0496108_0232852
1135 Ga0496108_0237295
1136 Ga0496108_0364494
1137 Ga0496108_0444918
1138 Ga0496109_0064470
1139 Ga0496109_0089504
1140 Ga0496109_0266962
1141 Ga0496109_0600799
1142 Ga0496109_0671919
1143 Ga0496110_0010917
1144 Ga0496110_0021618
1145 Ga0496110_0059847
1146 Ga0496110_0084981
1147 Ga0496110_0149447
1148 Ga0496110_0155382
1149 Ga0496110_0383747
1150 Ga0496110_0538308
1151 Ga0496111_0011587
1152 Ga0496111_0036536
1153 Ga0496111_0060616
1154 Ga0496111_0179492
1155 Ga0496112_0044695
1156 Ga0496112_0048980
1157 Ga0496112_0117946
1158 Ga0496112_0391763
1159 Ga0496112_0452620
1160 Ga0496113_0019535
1161 Ga0496113_0025579
1162 Ga0496113_0126211
1163 Ga0496113_0345976
1164 Ga0496113_0392445
1165 Ga0496114_0019243
1166 Ga0496114_0117425
1167 Ga0496114_0162899
1168 Ga0496114_0171099
1169 Ga0496114_0207735
1170 Ga0496114_0416896
1171 Ga0496115_0019304
1172 Ga0496115_0022053
1173 Ga0496115_0048961
1174 Ga0496115_0114646
1175 Ga0496115_0314026
1176 Ga0496115_0343230
1177 Ga0496115_0382176
1178 Ga0501076_0218029
1179 nmdc:mga00v17_205695_c1
1180 nmdc:mga0yw44_145086_c1
1181 nmdc:mga0yw44_33399_c1
1182 nmdc:mga0yw44_80533_c1
1183 nmdc:mga06z11_16016_c1
1184 nmdc:mga05p37_139501_c1
1185 nmdc:mga05p37_143838_c1
1186 nmdc:mga05p37_2361_c1
1187 nmdc:mga05p37_282587_c1
1188 nmdc:mga05p37_285201_c1
1189 nmdc:mga05p37_398576_c1
1190 nmdc:mga05p37_519728_c1
1191 nmdc:mga05p37_7467_c1
1192 nmdc:mga09592_17665_c1
1193 nmdc:mga09592_34670_c1
1194 nmdc:mga09592_37604_c1
1195 nmdc:mga09592_9032_c1
1196 nmdc:mga0qj67_1746_c1
1197 nmdc:mga0qj67_19766_c1
1198 nmdc:mga0qj67_30625_c1
1199 nmdc:mga06r32_174385_c1
1200 nmdc:mga06r32_19799_c1
1201 nmdc:mga06r32_19891_c1
1202 nmdc:mga06r32_546_c1
1203 nmdc:mga06r32_91084_c1
1204 nmdc:mga08y16_124764_c1
1205 nmdc:mga08y16_1498_c1
1206 nmdc:mga08y16_2619_c1
1207 nmdc:mga08y16_32282_c1
1208 nmdc:mga08y16_3375_c1
1209 nmdc:mga08y16_501246_c1
1210 nmdc:mga0n895_152906_c1
1211 nmdc:mga0n895_160068_c1
1212 nmdc:mga0n895_193529_c1
1213 nmdc:mga0n895_303305_c1
1214 nmdc:mga0n895_35211_c1
1215 nmdc:mga0n895_365038_c1
1216 nmdc:mga0n895_38950_c1
1217 nmdc:mga0n895_449082_c1
1218 nmdc:mga0n895_495701_c1
1219 nmdc:mga0n895_56003_c1
1220 nmdc:mga0n895_8191_c1
1221 nmdc:mga0rr50_11345_c1
1222 nmdc:mga0rr50_212656_c1
1223 nmdc:mga0rr50_641969_c1
1224 nmdc:mga08x19_128684_c1
1225 nmdc:mga0a205_100_c1
1226 nmdc:mga0a205_184567_c1
1227 nmdc:mga0a205_32636_c1
1228 nmdc:mga0a205_389497_c1
1229 nmdc:mga0a205_444_c1
1230 nmdc:mga0a205_48095_c1
1231 Ga0495601_0000704
1232 Ga0495601_0032014
1233 Ga0495601_0214371
1234 Ga0495612_0004379
1235 Ga0495595_0000241
1236 Ga0495595_0067226
1237 Ga0495619_0001954
1238 Ga0495619_0012903
1239 Ga0495619_0094886
1240 Ga0495619_0187973
1241 Ga0501082_0226760
1242 2885411751

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04392

ABC_sub_bind

ABC transporter substrate binding protein

83

378

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.8975 29 328
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.8891 29 328
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.8834 27 327
3lft-assembly2.cif.gz_B the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.8808 31 328
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.8779 27 327
ID Description Score Start End Superfamily
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8867 151 328 3.40.50.2300
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8866 151 327 3.40.50.2300
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8697 151 328 3.40.50.2300
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8639 151 327 3.40.50.2300
af_P02925_28_128_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7833 166 251 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A537MMK8-F1-model_v4 ABC transporter substrate-binding protein 0.9645 151 329
AF-A0A7V9HTZ8-F1-model_v4 ABC transporter substrate-binding protein 0.9603 223 329
AF-A0A4V1KUC4-F1-model_v4 ABC transporter substrate-binding protein 0.9589 222 329
AF-A0A536Z3T8-F1-model_v4 ABC transporter substrate-binding protein 0.9562 232 329
AF-A0A537H7S6-F1-model_v4 ABC transporter substrate-binding protein 0.9557 222 329

Map