F470352

General Info

Members Datasets Scaffolds Average Seq Length
625 297 1250 136

Family's Representative Sequence

Representative Sequence 3300006881|Ga0068865_100379152|Ga0068865_1003791522
Length 165
Sequence MALQQTALPTKLTLEVVTPERKILSETVDEVVLPGRDGYLGVLPGHAPLLTSLKIGQVEYRQGSEKSYLSLAWGFAEILPEKVTILADVAERPEEIDVERAKAKKEEIERQIRQPGPDFDFAKAQDQLQKAIVRIDIGTQRVKRLPGEPTRRAPQAGRIRQDPGN

Samples

Sample ID Description Type Environment
1 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
117 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
118 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
180 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
181 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
182 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
183 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
184 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
185 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
186 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
187 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
188 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
189 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
190 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
191 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
192 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
193 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
194 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
195 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
196 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
197 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
198 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
199 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
200 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
201 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
202 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
203 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
204 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
205 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
206 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
207 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
208 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
209 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
210 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
211 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
212 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
213 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
214 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
216 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
217 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
218 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
219 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
220 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
221 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
222 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
223 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
224 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
225 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
226 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
227 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
228 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
229 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
230 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
231 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
232 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
233 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
234 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
235 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
236 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
237 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
238 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
239 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
240 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
241 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
242 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
243 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
244 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
245 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
246 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
247 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
248 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
249 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
250 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
251 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
252 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
253 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
254 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
255 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
256 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
257 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
258 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
259 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
260 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
261 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
262 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
263 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
264 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
265 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
266 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
267 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
270 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
271 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
272 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
273 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
274 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
275 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
276 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
277 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
278 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
279 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
280 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
281 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
282 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
283 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
284 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
285 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
286 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
287 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
288 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
289 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
290 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
291 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
292 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
293 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
294 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
295 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
296 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
297 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.96
Nodule 0
Rhizoplane 6.24
Rhizosphere 88
Stem 0
Stem Tuber 0
Unclassified 5.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068865_100379152 3300006881 Bacteria 1153
2 JGI24744J21845_10021670 3300002077 Bacteria 1263
3 rootL2_10253403 3300003322 Bacteria 1040
4 Ga0065712_10007813 3300005290 Bacteria 2594
5 Ga0065712_10027610 3300005290 Bacteria 1687
6 Ga0065712_10031817 3300005290 Bacteria 949
7 Ga0065712_10081017 3300005290 Bacteria 3048
8 Ga0065712_10111092 3300005290 Bacteria 1824
9 Ga0065712_10433239 3300005290 Bacteria 701
10 Ga0065715_10037412 3300005293 Bacteria 2244
11 Ga0065715_10051615 3300005293 Bacteria 831
12 Ga0065715_10061736 3300005293 Bacteria 732
13 Ga0065715_10380726 3300005293 Bacteria 908
14 Ga0065707_10091455 3300005295 Bacteria 3944
15 Ga0065707_10135769 3300005295 Bacteria 1844
16 Ga0065707_10682636 3300005295 Bacteria 648
17 Ga0070676_10099024 3300005328 Bacteria 1798
18 Ga0070690_100012018 3300005330 Bacteria 5081
19 Ga0070690_100019014 3300005330 Bacteria 4160
20 Ga0070690_100118463 3300005330 Bacteria 1775
21 Ga0070690_100202903 3300005330 Bacteria 1381
22 Ga0070670_100006746 3300005331 Bacteria 9731
23 Ga0070670_100170622 3300005331 Bacteria 1887
24 Ga0070670_100349525 3300005331 Bacteria 1299
25 Ga0070670_100638112 3300005331 Bacteria 955
26 Ga0070677_10659635 3300005333 Bacteria 585
27 Ga0068869_100143953 3300005334 Bacteria 1843
28 Ga0068869_100223043 3300005334 Bacteria 1495
29 Ga0068869_100821722 3300005334 Unclassified 800
30 Ga0070666_10015446 3300005335 Bacteria 4872
31 Ga0070666_10068736 3300005335 Bacteria 2407
32 Ga0070666_10271521 3300005335 Bacteria 1204
33 Ga0070666_10319239 3300005335 Bacteria 1108
34 Ga0070680_100351226 3300005336 Bacteria 1254
35 Ga0070682_100549154 3300005337 Bacteria 904
36 Ga0070682_100886175 3300005337 Bacteria 732
37 Ga0070682_101353521 3300005337 Unclassified 607
38 Ga0068868_100095830 3300005338 Bacteria 2396
39 Ga0068868_100338533 3300005338 Bacteria 1286
40 Ga0070660_100095581 3300005339 Bacteria 2349
41 Ga0070689_100005396 3300005340 Bacteria 8720
42 Ga0070689_100145186 3300005340 Bacteria 1911
43 Ga0070689_100157796 3300005340 Unclassified 1832
44 Ga0070689_100325237 3300005340 Unclassified 1285
45 Ga0070689_100511787 3300005340 Bacteria 1030
46 Ga0070691_10065328 3300005341 Bacteria 1756
47 Ga0070687_100074938 3300005343 Bacteria 1828
48 Ga0070661_100125252 3300005344 Bacteria 1927
49 Ga0070661_100383955 3300005344 Bacteria 1108
50 Ga0070661_101097877 3300005344 Bacteria 663
51 Ga0070668_100230188 3300005347 Bacteria 1532
52 Ga0070668_100433059 3300005347 Bacteria 1128
53 Ga0070669_100033131 3300005353 Bacteria 3735
54 Ga0070669_100275114 3300005353 Bacteria 1347
55 Ga0070669_101070557 3300005353 Bacteria 694
56 Ga0070675_100003018 3300005354 Bacteria 12707
57 Ga0070675_100067679 3300005354 Bacteria 2955
58 Ga0070675_101571457 3300005354 Bacteria 607
59 Ga0070671_100003645 3300005355 Bacteria 12060
60 Ga0070671_100399524 3300005355 Bacteria 1176
61 Ga0070671_101999729 3300005355 Archaea 516
62 Ga0070673_100017054 3300005364 Bacteria 5152
63 Ga0070673_100051338 3300005364 Bacteria 3229
64 Ga0070673_100301934 3300005364 Bacteria 1410
65 Ga0070673_100709882 3300005364 Bacteria 924
66 Ga0070673_100760488 3300005364 Bacteria 893
67 Ga0070673_100849389 3300005364 Bacteria 845
68 Ga0070688_100158941 3300005365 Bacteria 1551
69 Ga0070667_100107988 3300005367 Bacteria 2410
70 Ga0070667_100455987 3300005367 Bacteria 1169
71 Ga0070667_101578611 3300005367 Bacteria 617
72 Ga0070709_10064483 3300005434 Bacteria 2343
73 Ga0070709_10719608 3300005434 Bacteria 778
74 Ga0070709_10921108 3300005434 Bacteria 692
75 Ga0070714_100289952 3300005435 Bacteria 1523
76 Ga0070713_100242007 3300005436 Bacteria 1643
77 Ga0070710_10265580 3300005437 Bacteria 1108
78 Ga0070701_10086357 3300005438 Bacteria 1710
79 Ga0070701_10205297 3300005438 Bacteria 1167
80 Ga0070705_100061000 3300005440 Bacteria 2239
81 Ga0070705_101358128 3300005440 Unclassified 591
82 Ga0070700_100024147 3300005441 Bacteria 3566
83 Ga0070700_100892314 3300005441 Bacteria 723
84 Ga0070700_100936376 3300005441 Unclassified 708
85 Ga0070694_100103193 3300005444 Bacteria 2020
86 Ga0070694_100135760 3300005444 Bacteria 1782
87 Ga0070694_100300415 3300005444 Bacteria 1230
88 Ga0070708_100425228 3300005445 Bacteria 1253
89 Ga0070663_100232547 3300005455 Bacteria 1452
90 Ga0070663_100482037 3300005455 Bacteria 1027
91 Ga0070678_100486266 3300005456 Bacteria 1087
92 Ga0070678_100847022 3300005456 Bacteria 833
93 Ga0070678_101931934 3300005456 Bacteria 558
94 Ga0070662_100057793 3300005457 Bacteria 2820
95 Ga0070662_100514975 3300005457 Bacteria 999
96 Ga0070662_100567423 3300005457 Bacteria 952
97 Ga0070685_10278065 3300005466 Bacteria 1120
98 Ga0070698_100696392 3300005471 Bacteria 958
99 Ga0070699_100101825 3300005518 Bacteria 2518
100 Ga0070699_100180535 3300005518 Bacteria 1873
101 Ga0070699_100476354 3300005518 Bacteria 1133
102 Ga0070699_100645761 3300005518 Bacteria 966
103 Ga0070699_100681326 3300005518 Bacteria 939
104 Ga0070699_100700819 3300005518 Unclassified 925
105 Ga0070679_101600709 3300005530 Bacteria 599
106 Ga0070684_100139357 3300005535 Bacteria 2193
107 Ga0070697_100022793 3300005536 Bacteria 4977
108 Ga0070697_100063667 3300005536 Bacteria 3011
109 Ga0070672_100017932 3300005543 Bacteria 5106
110 Ga0070672_100187549 3300005543 Bacteria 1725
111 Ga0070672_101363724 3300005543 Bacteria 634
112 Ga0070672_101852917 3300005543 Bacteria 543
113 Ga0070686_100000153 3300005544 Bacteria 47434
114 Ga0070686_100168838 3300005544 Bacteria 1546
115 Ga0070686_100179581 3300005544 Bacteria 1503
116 Ga0070686_100288724 3300005544 Bacteria 1212
117 Ga0070686_101746990 3300005544 Unclassified 529
118 Ga0070695_100000634 3300005545 Bacteria 18646
119 Ga0070695_100015003 3300005545 Bacteria 4674
120 Ga0070696_100515883 3300005546 Bacteria 953
121 Ga0070693_100006290 3300005547 Bacteria 5754
122 Ga0070665_100905606 3300005548 Bacteria 895
123 Ga0070704_100146603 3300005549 Bacteria 1850
124 Ga0068855_101143715 3300005563 Bacteria 812
125 Ga0068855_101694071 3300005563 Bacteria 645
126 Ga0070664_100288249 3300005564 Bacteria 1482
127 Ga0070664_100397081 3300005564 Bacteria 1260
128 Ga0070664_100436265 3300005564 Bacteria 1201
129 Ga0070664_101021181 3300005564 Bacteria 777
130 Ga0070664_101426935 3300005564 Bacteria 655
131 Ga0070664_101478058 3300005564 Bacteria 643
132 Ga0070664_101903690 3300005564 Unclassified 564
133 Ga0068854_100094201 3300005578 Bacteria 2233
134 Ga0068856_101272988 3300005614 Bacteria 751
135 Ga0070702_100091315 3300005615 Bacteria 1847
136 Ga0070702_100698336 3300005615 Bacteria 773
137 Ga0068852_100028054 3300005616 Bacteria 4601
138 Ga0068852_100454267 3300005616 Bacteria 1269
139 Ga0068852_101211033 3300005616 Archaea 776
140 Ga0068852_101266488 3300005616 Bacteria 759
141 Ga0068859_100102724 3300005617 Bacteria 2916
142 Ga0068859_100135485 3300005617 Bacteria 2535
143 Ga0068859_100162990 3300005617 Bacteria 2309
144 Ga0068859_100225714 3300005617 Bacteria 1961
145 Ga0068859_100731630 3300005617 Bacteria 1079
146 Ga0068864_100190267 3300005618 Bacteria 1881
147 Ga0068864_100728308 3300005618 Bacteria 971
148 Ga0068866_10439319 3300005718 Bacteria 850
149 Ga0068861_100145272 3300005719 Bacteria 1940
150 Ga0068861_100213219 3300005719 Bacteria 1628
151 Ga0068861_100532988 3300005719 Bacteria 1067
152 Ga0068861_100901052 3300005719 Bacteria 837
153 Ga0068851_10148445 3300005834 Bacteria 1280
154 Ga0068851_10383500 3300005834 Bacteria 824
155 Ga0068870_10184836 3300005840 Bacteria 1254
156 Ga0068863_100058575 3300005841 Bacteria 3645
157 Ga0068863_100474146 3300005841 Bacteria 1230
158 Ga0068863_100494889 3300005841 Bacteria 1203
159 Ga0068858_100174032 3300005842 Bacteria 2031
160 Ga0068858_100257444 3300005842 Bacteria 1658
161 Ga0068858_100851946 3300005842 Bacteria 890
162 Ga0068860_100200063 3300005843 Bacteria 1936
163 Ga0068860_100222263 3300005843 Bacteria 1834
164 Ga0068860_101538300 3300005843 Bacteria 687
165 Ga0068860_102321617 3300005843 Unclassified 557
166 Ga0068862_100185566 3300005844 Bacteria 1869
167 Ga0068862_100462753 3300005844 Bacteria 1197
168 Ga0068862_100874445 3300005844 Archaea 882
169 Ga0068862_101483626 3300005844 Bacteria 683
170 Ga0081455_10373035 3300005937 Bacteria 999
171 Ga0081539_10002012 3300005985 Bacteria 30795
172 Ga0070717_10053862 3300006028 Bacteria 3316
173 Ga0075365_10003186 3300006038 Bacteria 8378
174 Ga0075368_10010466 3300006042 Bacteria 3352
175 Ga0075368_10062890 3300006042 Bacteria 1488
176 Ga0075368_10089084 3300006042 Bacteria 1261
177 Ga0075363_100226050 3300006048 Bacteria 1073
178 Ga0075364_10173777 3300006051 Bacteria 1456
179 Ga0075364_10239513 3300006051 Bacteria 1232
180 Ga0075364_10795807 3300006051 Bacteria 645
181 Ga0070715_10405517 3300006163 Bacteria 759
182 Ga0070716_100728082 3300006173 Unclassified 761
183 Ga0070712_100624841 3300006175 Bacteria 913
184 Ga0075367_10355038 3300006178 Bacteria 925
185 Ga0075367_10427832 3300006178 Bacteria 838
186 Ga0075366_10002821 3300006195 Bacteria 8995
187 Ga0075366_10087861 3300006195 Bacteria 1861
188 Ga0075366_10407069 3300006195 Bacteria 837
189 Ga0097621_100027008 3300006237 Bacteria 4510
190 Ga0097621_100343067 3300006237 Bacteria 1327
191 Ga0097621_100905646 3300006237 Bacteria 822
192 Ga0075370_10011509 3300006353 Bacteria 4652
193 Ga0075370_10023411 3300006353 Bacteria 3402
194 Ga0068871_100623275 3300006358 Bacteria 983
195 Ga0068871_100669252 3300006358 Bacteria 949
196 Ga0068871_100944448 3300006358 Bacteria 801
197 Ga0068871_101511051 3300006358 Archaea 635
198 Ga0068871_101785678 3300006358 Bacteria 584
199 Ga0075430_100092142 3300006846 Bacteria 2534
200 Ga0075430_100729346 3300006846 Bacteria 817
201 Ga0075430_101359021 3300006846 Bacteria 584
202 Ga0075431_101103597 3300006847 Bacteria 758
203 Ga0075434_100001202 3300006871 Bacteria 21518
204 Ga0075434_100022294 3300006871 Bacteria 6168
205 Ga0075434_100499195 3300006871 Bacteria 1238
206 Ga0068865_100218883 3300006881 Bacteria 1488
207 Ga0068865_100830735 3300006881 Archaea 799
208 Ga0075436_100008391 3300006914 Bacteria 7065
209 Ga0075436_100136634 3300006914 Bacteria 1721
210 Ga0075436_100169302 3300006914 Bacteria 1542
211 Ga0075436_100493757 3300006914 Bacteria 895
212 Ga0097620_100102740 3300006931 Bacteria 2916
213 Ga0097620_100135497 3300006931 Bacteria 2535
214 Ga0097620_100162982 3300006931 Bacteria 2309
215 Ga0097620_100225713 3300006931 Bacteria 1961
216 Ga0097620_100731571 3300006931 Bacteria 1079
217 Ga0075435_100000204 3300007076 Bacteria 35933
218 Ga0075435_100001088 3300007076 Bacteria 17281
219 Ga0075435_100002425 3300007076 Bacteria 12369
220 Ga0075435_100095033 3300007076 Bacteria 2465
221 Ga0075435_100324232 3300007076 Bacteria 1318
222 Ga0075435_100606463 3300007076 Bacteria 949
223 Ga0105240_10825277 3300009093 Bacteria 1003
224 Ga0105245_10187447 3300009098 Bacteria 1980
225 Ga0105245_10208289 3300009098 Bacteria 1881
226 Ga0105245_10623303 3300009098 Bacteria 1107
227 Ga0105247_10681816 3300009101 Bacteria 771
228 Ga0105247_10694892 3300009101 Unclassified 765
229 Ga0105247_10789462 3300009101 Bacteria 723
230 Ga0114129_10462560 3300009147 Bacteria 1662
231 Ga0114129_10692310 3300009147 Bacteria 1311
232 Ga0105243_10056975 3300009148 Bacteria 3110
233 Ga0105243_10117657 3300009148 Bacteria 2235
234 Ga0105243_10341902 3300009148 Bacteria 1371
235 Ga0105243_11119427 3300009148 Bacteria 797
236 Ga0105241_10339984 3300009174 Bacteria 1300
237 Ga0105241_10507330 3300009174 Bacteria 1076
238 Ga0105242_10085151 3300009176 Bacteria 2650
239 Ga0105242_10195879 3300009176 Bacteria 1792
240 Ga0105242_10288945 3300009176 Bacteria 1492
241 Ga0105242_11239814 3300009176 Unclassified 767
242 Ga0105242_11267665 3300009176 Bacteria 759
243 Ga0105248_10026431 3300009177 Bacteria 6458
244 Ga0105248_10096201 3300009177 Bacteria 3335
245 Ga0105248_10604924 3300009177 Bacteria 1237
246 Ga0105248_11912137 3300009177 Unclassified 673
247 Ga0105248_12115980 3300009177 Bacteria 640
248 Ga0105237_10758681 3300009545 Bacteria 977
249 Ga0105238_10720712 3300009551 Bacteria 1010
250 Ga0105249_10400921 3300009553 Bacteria 1402
251 Ga0105249_10545469 3300009553 Bacteria 1209
252 Ga0105249_11509895 3300009553 Viruses 744
253 Ga0105239_10057888 3300010375 Bacteria 4251
254 Ga0105239_10428026 3300010375 Bacteria 1500
255 Ga0105239_10794305 3300010375 Bacteria 1084
256 Ga0105246_10813182 3300011119 Bacteria 830
257 Ga0157370_10237700 3300013104 Bacteria 1686
258 Ga0157369_10861304 3300013105 Bacteria 930
259 Ga0157374_10509848 3300013296 Bacteria 1208
260 Ga0157378_10071198 3300013297 Bacteria 3122
261 Ga0157378_10905276 3300013297 Bacteria 913
262 Ga0157378_11461688 3300013297 Bacteria 727
263 Ga0163162_10197770 3300013306 Bacteria 2139
264 Ga0157375_10390121 3300013308 Bacteria 1559
265 Ga0157375_10406531 3300013308 Bacteria 1528
266 Ga0157375_10516442 3300013308 Bacteria 1358
267 Ga0157375_12208176 3300013308 Unclassified 656
268 Ga0163163_10082907 3300014325 Bacteria 3211
269 Ga0163163_10091482 3300014325 Bacteria 3057
270 Ga0163163_10239634 3300014325 Bacteria 1863
271 Ga0163163_11179458 3300014325 Bacteria 828
272 Ga0163163_11216422 3300014325 Bacteria 816
273 Ga0163163_11320589 3300014325 Bacteria 783
274 Ga0163163_12012758 3300014325 Archaea 637
275 Ga0157380_10052201 3300014326 Bacteria 3236
276 Ga0157380_10393867 3300014326 Bacteria 1311
277 Ga0157380_10876656 3300014326 Bacteria 922
278 Ga0157377_10058953 3300014745 Bacteria 2187
279 Ga0157379_10358399 3300014968 Bacteria 1336
280 Ga0157376_10462872 3300014969 Bacteria 1239
281 Ga0157376_10759171 3300014969 Bacteria 980
282 Ga0157376_10814960 3300014969 Bacteria 947
283 Ga0163161_10054649 3300017792 Bacteria 2898
284 Ga0206350_11550062 3300020080 Bacteria 1373
285 Ga0224572_1008181 3300024225 Bacteria 1931
286 Ga0228598_1001679 3300024227 Bacteria 4844
287 Ga0207697_10002984 3300025315 Bacteria 8536
288 Ga0207697_10166110 3300025315 Bacteria 964
289 Ga0207697_10230456 3300025315 Bacteria 818
290 Ga0207656_10078613 3300025321 Bacteria 1479
291 Ga0207653_10040531 3300025885 Bacteria 1527
292 Ga0207682_10175799 3300025893 Bacteria 976
293 Ga0207710_10542210 3300025900 Bacteria 606
294 Ga0207688_10119749 3300025901 Bacteria 1535
295 Ga0207680_10148843 3300025903 Bacteria 1559
296 Ga0207680_10169206 3300025903 Bacteria 1471
297 Ga0207680_10200090 3300025903 Bacteria 1361
298 Ga0207680_10228971 3300025903 Bacteria 1277
299 Ga0207647_10272928 3300025904 Bacteria 966
300 Ga0207685_10178301 3300025905 Bacteria 983
301 Ga0207699_10308130 3300025906 Bacteria 1107
302 Ga0207645_10025717 3300025907 Bacteria 3808
303 Ga0207654_10504454 3300025911 Bacteria 855
304 Ga0207695_10701941 3300025913 Bacteria 892
305 Ga0207695_10906793 3300025913 Bacteria 761
306 Ga0207671_10969093 3300025914 Bacteria 671
307 Ga0207693_10339278 3300025915 Bacteria 1176
308 Ga0207663_10178768 3300025916 Bacteria 1513
309 Ga0207660_10253379 3300025917 Bacteria 1390
310 Ga0207662_10021857 3300025918 Bacteria 3661
311 Ga0207662_10077627 3300025918 Bacteria 2020
312 Ga0207657_10342667 3300025919 Bacteria 1179
313 Ga0207657_11073099 3300025919 Bacteria 616
314 Ga0207649_10100803 3300025920 Bacteria 1911
315 Ga0207649_10187349 3300025920 Bacteria 1453
316 Ga0207646_10752636 3300025922 Unclassified 869
317 Ga0207681_10099803 3300025923 Bacteria 2091
318 Ga0207681_10244577 3300025923 Bacteria 1398
319 Ga0207650_10016612 3300025925 Bacteria 5145
320 Ga0207650_10182945 3300025925 Bacteria 1671
321 Ga0207650_10312735 3300025925 Unclassified 1285
322 Ga0207650_10507796 3300025925 Bacteria 1008
323 Ga0207659_10003331 3300025926 Bacteria 9633
324 Ga0207659_10095980 3300025926 Bacteria 2224
325 Ga0207687_10213933 3300025927 Bacteria 1514
326 Ga0207687_10394171 3300025927 Bacteria 1137
327 Ga0207687_10481368 3300025927 Bacteria 1034
328 Ga0207687_11761514 3300025927 Bacteria 530
329 Ga0207700_10113559 3300025928 Bacteria 2184
330 Ga0207644_10011948 3300025931 Bacteria 5758
331 Ga0207644_10924210 3300025931 Bacteria 731
332 Ga0207644_11138173 3300025931 Unclassified 656
333 Ga0207644_11554040 3300025931 Archaea 555
334 Ga0207706_10185952 3300025933 Bacteria 1824
335 Ga0207706_10432383 3300025933 Bacteria 1140
336 Ga0207706_10723434 3300025933 Bacteria 849
337 Ga0207706_10774261 3300025933 Bacteria 816
338 Ga0207706_11147966 3300025933 Bacteria 647
339 Ga0207686_10062936 3300025934 Bacteria 2358
340 Ga0207686_10707497 3300025934 Bacteria 801
341 Ga0207709_10389413 3300025935 Bacteria 1063
342 Ga0207670_10010102 3300025936 Bacteria 5419
343 Ga0207670_10095483 3300025936 Bacteria 2112
344 Ga0207670_10254654 3300025936 Bacteria 1358
345 Ga0207670_10580212 3300025936 Archaea 919
346 Ga0207670_10777458 3300025936 Bacteria 797
347 Ga0207669_10448882 3300025937 Bacteria 1021
348 Ga0207704_10212260 3300025938 Bacteria 1426
349 Ga0207704_10579159 3300025938 Bacteria 916
350 Ga0207704_10667553 3300025938 Archaea 858
351 Ga0207665_10136872 3300025939 Bacteria 1743
352 Ga0207665_11193259 3300025939 Unclassified 607
353 Ga0207691_10005110 3300025940 Bacteria 12664
354 Ga0207691_10036798 3300025940 Bacteria 4534
355 Ga0207691_10082630 3300025940 Bacteria 2885
356 Ga0207691_11010852 3300025940 Bacteria 694
357 Ga0207711_10029070 3300025941 Bacteria 4659
358 Ga0207711_10234717 3300025941 Bacteria 1680
359 Ga0207711_10786428 3300025941 Bacteria 886
360 Ga0207711_11001191 3300025941 Bacteria 775
361 Ga0207689_10022939 3300025942 Bacteria 5242
362 Ga0207689_10275342 3300025942 Bacteria 1393
363 Ga0207679_10254463 3300025945 Bacteria 1495
364 Ga0207679_10735522 3300025945 Bacteria 897
365 Ga0207679_10839146 3300025945 Bacteria 839
366 Ga0207679_11261358 3300025945 Bacteria 678
367 Ga0207679_11729757 3300025945 Unclassified 572
368 Ga0207679_11938752 3300025945 Unclassified 537
369 Ga0207667_10752554 3300025949 Bacteria 974
370 Ga0207651_10000712 3300025960 Bacteria 14261
371 Ga0207651_10095558 3300025960 Bacteria 2189
372 Ga0207651_10214889 3300025960 Bacteria 1551
373 Ga0207651_10373007 3300025960 Bacteria 1207
374 Ga0207651_10518988 3300025960 Bacteria 1032
375 Ga0207651_10828424 3300025960 Bacteria 821
376 Ga0207712_10160810 3300025961 Bacteria 1745
377 Ga0207712_10311541 3300025961 Bacteria 1295
378 Ga0207668_10064741 3300025972 Bacteria 2585
379 Ga0207668_10217123 3300025972 Bacteria 1533
380 Ga0207640_10062896 3300025981 Bacteria 2464
381 Ga0207658_10121119 3300025986 Bacteria 2086
382 Ga0207658_10303075 3300025986 Bacteria 1377
383 Ga0207677_10192666 3300026023 Bacteria 1613
384 Ga0207677_11218244 3300026023 Bacteria 689
385 Ga0207703_10121094 3300026035 Bacteria 2246
386 Ga0207703_10199166 3300026035 Bacteria 1779
387 Ga0207639_10498238 3300026041 Bacteria 1112
388 Ga0207678_10270490 3300026067 Bacteria 1457
389 Ga0207678_10280812 3300026067 Bacteria 1429
390 Ga0207678_11444197 3300026067 Bacteria 608
391 Ga0207708_10092051 3300026075 Bacteria 2339
392 Ga0207708_10360623 3300026075 Bacteria 1194
393 Ga0207702_11163831 3300026078 Bacteria 765
394 Ga0207641_10118565 3300026088 Bacteria 2358
395 Ga0207641_10519458 3300026088 Bacteria 1158
396 Ga0207641_10568364 3300026088 Bacteria 1107
397 Ga0207648_10088519 3300026089 Bacteria 2703
398 Ga0207648_10613999 3300026089 Bacteria 1003
399 Ga0207648_11758961 3300026089 Bacteria 581
400 Ga0207676_10020645 3300026095 Bacteria 4822
401 Ga0207676_10079395 3300026095 Bacteria 2661
402 Ga0207676_10785542 3300026095 Bacteria 928
403 Ga0207676_10989315 3300026095 Bacteria 828
404 Ga0207675_100069655 3300026118 Bacteria 3288
405 Ga0207675_100562280 3300026118 Bacteria 1141
406 Ga0207675_100797806 3300026118 Bacteria 957
407 Ga0207675_100872354 3300026118 Bacteria 915
408 Ga0207675_101470875 3300026118 Bacteria 702
409 Ga0207675_102220598 3300026118 Bacteria 564
410 Ga0207683_10069152 3300026121 Bacteria 3118
411 Ga0207683_10687428 3300026121 Bacteria 948
412 Ga0207683_10729482 3300026121 Unclassified 919
413 Ga0207683_10915801 3300026121 Bacteria 814
414 Ga0207698_10075568 3300026142 Bacteria 2693
415 Ga0207698_10821437 3300026142 Archaea 933
416 Ga0207698_11016934 3300026142 Bacteria 840
417 Ga0209813_10027607 3300027866 Bacteria 1649
418 Ga0209813_10134725 3300027866 Bacteria 872
419 Ga0209813_10150298 3300027866 Bacteria 834
420 Ga0268266_10015925 3300028379 Bacteria 6434
421 Ga0268266_10159964 3300028379 Bacteria 2037
422 Ga0268265_10289367 3300028380 Bacteria 1470
423 Ga0268265_10337352 3300028380 Bacteria 1371
424 Ga0268265_12077884 3300028380 Bacteria 575
425 Ga0268264_10480993 3300028381 Bacteria 1208
426 Ga0268264_10781208 3300028381 Bacteria 953
427 Ga0268264_11271667 3300028381 Bacteria 746
428 Ga0265760_10012556 3300031090 Bacteria 2423
429 Ga0265332_10033437 3300031238 Bacteria 2238
430 Ga0265328_10431271 3300031239 Unclassified 519
431 Ga0265329_10141171 3300031242 Unclassified 778
432 Ga0265331_10224320 3300031250 Bacteria 844
433 Ga0265316_10663024 3300031344 Bacteria 737
434 Ga0265314_10011701 3300031711 Bacteria 7219
435 Ga0307405_11979672 3300031731 Bacteria 521
436 Ga0307406_10183859 3300031901 Bacteria 1524
437 Ga0307407_10067864 3300031903 Bacteria 2110
438 Ga0307412_10180571 3300031911 Bacteria 1587
439 Ga0307412_10352594 3300031911 Bacteria 1182
440 Ga0307412_10453036 3300031911 Bacteria 1058
441 Ga0307412_11829949 3300031911 Bacteria 559
442 Ga0307416_100500941 3300032002 Bacteria 1279
443 Ga0307416_101643879 3300032002 Bacteria 747
444 Ga0307415_101212035 3300032126 Bacteria 712
445 Ga0373930_0033198 3300034816 Bacteria 1070
446 Ga0373950_0007027 3300034818 Bacteria 1735
447 Ga0373958_0000965 3300034819 Bacteria 3736
448 Ga0373938_0000489 3300034957 Bacteria 6397
449 Ga0373928_0081543 3300035084 Bacteria 816
450 Ga0373929_0000898 3300035085 Bacteria 5806
451 Ga0373929_0130322 3300035085 Bacteria 659
452 Ga0373940_0138353 3300035088 Bacteria 768
453 Ga0373949_0001032 3300035090 Bacteria 8540
454 Ga0373951_0007844 3300035091 Bacteria 2421
455 Ga0373951_0026523 3300035091 Bacteria 1350
456 Ga0373952_0025077 3300035092 Bacteria 1285
457 Ga0373939_0002375 3300035114 Bacteria 4445
458 Ga0373939_0107842 3300035114 Bacteria 965
459 Ga0373939_0120242 3300035114 Bacteria 926
460 Ga0373941_0022379 3300035115 Bacteria 1793
461 Ga0373941_0118457 3300035115 Bacteria 941
462 Ga0373941_0124414 3300035115 Bacteria 922
463 Ga0373953_0486034 3300035117 Bacteria 547
464 Ga0373960_0115123 3300035121 Bacteria 886
465 Ga0373943_0090563 3300035170 Bacteria 1584
466 Ga0373943_0276619 3300035170 Archaea 948
467 Ga0373946_0657234 3300035171 Unclassified 546
468 Ga0373942_0000565 3300035207 Bacteria 10406
469 Ga0373961_0004391 3300035241 Bacteria 3413
470 Ga0373962_0005233 3300035242 Bacteria 3136
471 Ga0373931_0171521 3300035691 Bacteria 1279
472 Ga0373931_0404887 3300035691 Bacteria 864
473 Ga0373927_0713959 3300035695 Bacteria 662
474 Ga0373933_1026232 3300035724 Bacteria 543
475 Ga0373947_0403835 3300035725 Bacteria 922
476 Ga0373937_0121505 3300036401 Bacteria 2434
477 Ga0373937_0307205 3300036401 Bacteria 1500
478 Ga0373925_0272264 3300037068 Bacteria 1362
479 Ga0373925_1316269 3300037068 Unclassified 593
480 Ga0439439_0062975 3300041406 Bacteria 987
481 Ga0451797_0414587 3300041453 Bacteria 845
482 Ga0451802_0132103 3300041460 Bacteria 1287
483 Ga0451807_0382184 3300041486 Bacteria 2057
484 Ga0451843_1492053 3300041509 Bacteria 1103
485 Ga0451855_1884180 3300041511 Bacteria 615
486 Ga0451853_0769925 3300041512 Bacteria 964
487 Ga0451853_3511899 3300041512 Unclassified 508
488 Ga0439433_0029720 3300041999 Bacteria 1248
489 Ga0439443_011537 3300042003 Bacteria 1296
490 Ga0439446_0030533 3300042156 Bacteria 1557
491 Ga0439434_0057259 3300042435 Bacteria 1215
492 Ga0453683_0563504 3300044673 Bacteria 742
493 Ga0453684_0689326 3300044712 Bacteria 1111
494 Ga0451576_0118553 3300045051 Bacteria 2755
495 Ga0495592_0302526 3300046454 Bacteria 1039
496 Ga0495603_0733913 3300046455 Bacteria 564
497 Ga0495603_0854136 3300046455 Unclassified 518
498 Ga0495653_0197886 3300046463 Bacteria 1366
499 Ga0495580_0693262 3300046472 Bacteria 667
500 Ga0495582_0240619 3300046473 Bacteria 1037
501 Ga0495662_0302103 3300046476 Bacteria 787
502 Ga0495608_0104950 3300046511 Bacteria 1820
503 Ga0495618_0144400 3300046514 Bacteria 1522
504 Ga0495618_0235903 3300046514 Bacteria 1151
505 Ga0495628_0230618 3300046516 Bacteria 1388
506 Ga0495630_0237471 3300046517 Bacteria 1393
507 Ga0495630_0554227 3300046517 Bacteria 881
508 Ga0495630_0567153 3300046517 Bacteria 870
509 Ga0495640_0091251 3300046533 Bacteria 2010
510 Ga0495640_0446384 3300046533 Archaea 790
511 Ga0495586_0218829 3300046535 Bacteria 1082
512 Ga0495621_0099283 3300046539 Bacteria 1106
513 Ga0495621_0117525 3300046539 Bacteria 1025
514 Ga0495635_0000335 3300046663 Bacteria 30093
515 Ga0495635_0473741 3300046663 Archaea 826
516 Ga0495599_0141080 3300046678 Bacteria 1495
517 Ga0495658_0054579 3300046683 Bacteria 2274
518 Ga0495658_0176654 3300046683 Bacteria 1323
519 Ga0495613_0088368 3300046689 Bacteria 2246
520 Ga0495613_0103562 3300046689 Bacteria 2055
521 Ga0495613_0624350 3300046689 Bacteria 715
522 Ga0495600_0171447 3300046809 Bacteria 1400
523 Ga0495604_0516164 3300047317 Bacteria 774
524 Ga0495674_0154480 3300047319 Bacteria 1923
525 Ga0495672_0000772 3300047320 Bacteria 34827
526 Ga0495680_0004528 3300047322 Bacteria 13277
527 Ga0495684_0006457 3300047471 Bacteria 9106
528 Ga0495684_0471562 3300047471 Unclassified 868
529 Ga0495684_0629443 3300047471 Bacteria 720
530 Ga0496100_0160017 3300048903 Bacteria 1614
531 Ga0496100_0756715 3300048903 Bacteria 760
532 Ga0496100_0758850 3300048903 Bacteria 759
533 Ga0496100_1367196 3300048903 Archaea 559
534 Ga0496101_0141631 3300048904 Bacteria 1833
535 Ga0496102_0514243 3300048905 Bacteria 1120
536 Ga0496102_0830993 3300048905 Bacteria 846
537 Ga0496102_0876362 3300048905 Bacteria 820
538 Ga0496104_0273376 3300048907 Bacteria 1602
539 Ga0496104_0498572 3300048907 Bacteria 1129
540 Ga0496104_0851877 3300048907 Bacteria 817
541 Ga0496104_1160527 3300048907 Archaea 676
542 Ga0496105_0036060 3300048908 Bacteria 4073
543 Ga0496105_0056725 3300048908 Bacteria 3233
544 Ga0496106_0077954 3300048909 Bacteria 2542
545 Ga0496106_0197496 3300048909 Bacteria 1600
546 Ga0496107_0122063 3300048910 Bacteria 1919
547 Ga0496107_0446707 3300048910 Bacteria 961
548 Ga0496107_0454435 3300048910 Bacteria 951
549 Ga0496107_0689466 3300048910 Bacteria 752
550 Ga0496107_1364682 3300048910 Bacteria 505
551 Ga0496108_0094061 3300048911 Bacteria 2551
552 Ga0496108_0132546 3300048911 Bacteria 2142
553 Ga0496108_0170202 3300048911 Bacteria 1885
554 Ga0496108_0384344 3300048911 Bacteria 1226
555 Ga0496108_0570770 3300048911 Bacteria 986
556 Ga0496109_0052581 3300048912 Bacteria 3713
557 Ga0496109_0067308 3300048912 Bacteria 3281
558 Ga0496109_0280225 3300048912 Bacteria 1571
559 Ga0496109_1147744 3300048912 Bacteria 714
560 Ga0496110_0356135 3300048913 Bacteria 1333
561 Ga0496111_0078547 3300048914 Unclassified 2407
562 Ga0496111_0352668 3300048914 Bacteria 1089
563 Ga0496112_0447594 3300048915 Bacteria 1229
564 Ga0496113_0235408 3300048916 Bacteria 1461
565 Ga0496114_0760382 3300048917 Bacteria 846
566 Ga0501042_0576322 3300049578 Bacteria 818
567 Ga0501042_0907248 3300049578 Bacteria 642
568 Ga0501046_1251270 3300049580 Unclassified 508
569 Ga0501067_0189020 3300049583 Bacteria 1147
570 Ga0501067_0443792 3300049583 Bacteria 725
571 Ga0501071_0626198 3300049587 Bacteria 828
572 Ga0501073_0326584 3300049589 Bacteria 1059
573 Ga0501076_0292166 3300049592 Bacteria 1335
574 Ga0501077_0274900 3300049593 Bacteria 1072
575 Ga0501079_0285082 3300049741 Bacteria 1291
576 Ga0501080_0074665 3300049742 Bacteria 3154
577 Ga0501080_1389859 3300049742 Unclassified 599
578 Ga0501083_0184523 3300049744 Bacteria 1362
579 nmdc:mga00v17_229133_c1 3300050491 Bacteria 1204
580 nmdc:mga00v17_306476_c1 3300050491 Bacteria 1032
581 nmdc:mga0yw44_53522_c1 3300050492 Bacteria 2452
582 nmdc:mga0k408_32240_c1 3300050493 Bacteria 2994
583 nmdc:mga0k408_48560_c1 3300050493 Bacteria 2456
584 nmdc:mga0k408_8436_c1 3300050493 Bacteria 5532
585 nmdc:mga06z11_110941_c1 3300050494 Bacteria 1519
586 nmdc:mga06z11_3006_c1 3300050494 Bacteria 6485
587 nmdc:mga04h51_130138_c1 3300050495 Bacteria 946
588 nmdc:mga04h51_30964_c1 3300050495 Bacteria 1688
589 nmdc:mga04h51_52134_c1 3300050495 Bacteria 1377
590 nmdc:mga07m45_16466_c1 3300050496 Bacteria 3958
591 nmdc:mga07m45_369925_c1 3300050496 Bacteria 833
592 nmdc:mga05p37_138156_c1 3300050507 Bacteria 2987
593 nmdc:mga09592_189085_c1 3300050508 Bacteria 1782
594 nmdc:mga0qj67_18038_c1 3300050509 Bacteria 5376
595 nmdc:mga06r32_966361_c1 3300050510 Bacteria 806
596 nmdc:mga08y16_1381158_c1 3300050511 Bacteria 668
597 nmdc:mga0n895_1011853_c1 3300050512 Bacteria 812
598 nmdc:mga0n895_141_c1 3300050512 Bacteria 43611
599 nmdc:mga0n895_25107_c1 3300050512 Bacteria 5627
600 nmdc:mga0n895_328616_c1 3300050512 Bacteria 1549
601 nmdc:mga0n895_460010_c1 3300050512 Bacteria 1284
602 nmdc:mga0rr50_10070_c1 3300050513 Bacteria 5982
603 nmdc:mga0rr50_1401_c1 3300050513 Bacteria 13214
604 nmdc:mga0rr50_1_c1 3300050513 Bacteria 558123
605 nmdc:mga0rr50_264051_c1 3300050513 Bacteria 1433
606 nmdc:mga0rr50_40858_c1 3300050513 Bacteria 3375
607 nmdc:mga0rr50_455479_c1 3300050513 Bacteria 1085
608 nmdc:mga08x19_257364_c1 3300050514 Bacteria 1206
609 nmdc:mga08x19_291809_c1 3300050514 Bacteria 1131
610 nmdc:mga08x19_40819_c1 3300050514 Bacteria 2955
611 nmdc:mga08x19_62657_c1 3300050514 Bacteria 2412
612 nmdc:mga08x19_708099_c1 3300050514 Bacteria 715
613 nmdc:mga08x19_92_c1 3300050514 Bacteria 80986
614 Ga0495601_0126699 3300053077 Bacteria 1661
615 Ga0495601_0866879 3300053077 Bacteria 571
616 Ga0495612_0170005 3300053078 Bacteria 954
617 Ga0495655_0238254 3300053083 Bacteria 608
618 Ga0495595_0043405 3300053084 Bacteria 2062
619 Ga0495595_0391105 3300053084 Unclassified 704
620 Ga0495619_0067845 3300053085 Bacteria 2382
621 Ga0495619_0120969 3300053085 Bacteria 1795
622 Ga0495619_0369246 3300053085 Bacteria 992
623 Ga0501082_0191525 3300060353 Bacteria 1779
624 Ga0501082_0538447 3300060353 Bacteria 1021
625 Ga0530510_0520557 3300061734 Bacteria 902
626 Ga0068865_100379152
627 JGI24744J21845_10021670
628 rootL2_10253403
629 Ga0065712_10007813
630 Ga0065712_10027610
631 Ga0065712_10031817
632 Ga0065712_10081017
633 Ga0065712_10111092
634 Ga0065712_10433239
635 Ga0065715_10037412
636 Ga0065715_10051615
637 Ga0065715_10061736
638 Ga0065715_10380726
639 Ga0065707_10091455
640 Ga0065707_10135769
641 Ga0065707_10682636
642 Ga0070676_10099024
643 Ga0070690_100012018
644 Ga0070690_100019014
645 Ga0070690_100118463
646 Ga0070690_100202903
647 Ga0070670_100006746
648 Ga0070670_100170622
649 Ga0070670_100349525
650 Ga0070670_100638112
651 Ga0070677_10659635
652 Ga0068869_100143953
653 Ga0068869_100223043
654 Ga0068869_100821722
655 Ga0070666_10015446
656 Ga0070666_10068736
657 Ga0070666_10271521
658 Ga0070666_10319239
659 Ga0070680_100351226
660 Ga0070682_100549154
661 Ga0070682_100886175
662 Ga0070682_101353521
663 Ga0068868_100095830
664 Ga0068868_100338533
665 Ga0070660_100095581
666 Ga0070689_100005396
667 Ga0070689_100145186
668 Ga0070689_100157796
669 Ga0070689_100325237
670 Ga0070689_100511787
671 Ga0070691_10065328
672 Ga0070687_100074938
673 Ga0070661_100125252
674 Ga0070661_100383955
675 Ga0070661_101097877
676 Ga0070668_100230188
677 Ga0070668_100433059
678 Ga0070669_100033131
679 Ga0070669_100275114
680 Ga0070669_101070557
681 Ga0070675_100003018
682 Ga0070675_100067679
683 Ga0070675_101571457
684 Ga0070671_100003645
685 Ga0070671_100399524
686 Ga0070671_101999729
687 Ga0070673_100017054
688 Ga0070673_100051338
689 Ga0070673_100301934
690 Ga0070673_100709882
691 Ga0070673_100760488
692 Ga0070673_100849389
693 Ga0070688_100158941
694 Ga0070667_100107988
695 Ga0070667_100455987
696 Ga0070667_101578611
697 Ga0070709_10064483
698 Ga0070709_10719608
699 Ga0070709_10921108
700 Ga0070714_100289952
701 Ga0070713_100242007
702 Ga0070710_10265580
703 Ga0070701_10086357
704 Ga0070701_10205297
705 Ga0070705_100061000
706 Ga0070705_101358128
707 Ga0070700_100024147
708 Ga0070700_100892314
709 Ga0070700_100936376
710 Ga0070694_100103193
711 Ga0070694_100135760
712 Ga0070694_100300415
713 Ga0070708_100425228
714 Ga0070663_100232547
715 Ga0070663_100482037
716 Ga0070678_100486266
717 Ga0070678_100847022
718 Ga0070678_101931934
719 Ga0070662_100057793
720 Ga0070662_100514975
721 Ga0070662_100567423
722 Ga0070685_10278065
723 Ga0070698_100696392
724 Ga0070699_100101825
725 Ga0070699_100180535
726 Ga0070699_100476354
727 Ga0070699_100645761
728 Ga0070699_100681326
729 Ga0070699_100700819
730 Ga0070679_101600709
731 Ga0070684_100139357
732 Ga0070697_100022793
733 Ga0070697_100063667
734 Ga0070672_100017932
735 Ga0070672_100187549
736 Ga0070672_101363724
737 Ga0070672_101852917
738 Ga0070686_100000153
739 Ga0070686_100168838
740 Ga0070686_100179581
741 Ga0070686_100288724
742 Ga0070686_101746990
743 Ga0070695_100000634
744 Ga0070695_100015003
745 Ga0070696_100515883
746 Ga0070693_100006290
747 Ga0070665_100905606
748 Ga0070704_100146603
749 Ga0068855_101143715
750 Ga0068855_101694071
751 Ga0070664_100288249
752 Ga0070664_100397081
753 Ga0070664_100436265
754 Ga0070664_101021181
755 Ga0070664_101426935
756 Ga0070664_101478058
757 Ga0070664_101903690
758 Ga0068854_100094201
759 Ga0068856_101272988
760 Ga0070702_100091315
761 Ga0070702_100698336
762 Ga0068852_100028054
763 Ga0068852_100454267
764 Ga0068852_101211033
765 Ga0068852_101266488
766 Ga0068859_100102724
767 Ga0068859_100135485
768 Ga0068859_100162990
769 Ga0068859_100225714
770 Ga0068859_100731630
771 Ga0068864_100190267
772 Ga0068864_100728308
773 Ga0068866_10439319
774 Ga0068861_100145272
775 Ga0068861_100213219
776 Ga0068861_100532988
777 Ga0068861_100901052
778 Ga0068851_10148445
779 Ga0068851_10383500
780 Ga0068870_10184836
781 Ga0068863_100058575
782 Ga0068863_100474146
783 Ga0068863_100494889
784 Ga0068858_100174032
785 Ga0068858_100257444
786 Ga0068858_100851946
787 Ga0068860_100200063
788 Ga0068860_100222263
789 Ga0068860_101538300
790 Ga0068860_102321617
791 Ga0068862_100185566
792 Ga0068862_100462753
793 Ga0068862_100874445
794 Ga0068862_101483626
795 Ga0081455_10373035
796 Ga0081539_10002012
797 Ga0070717_10053862
798 Ga0075365_10003186
799 Ga0075368_10010466
800 Ga0075368_10062890
801 Ga0075368_10089084
802 Ga0075363_100226050
803 Ga0075364_10173777
804 Ga0075364_10239513
805 Ga0075364_10795807
806 Ga0070715_10405517
807 Ga0070716_100728082
808 Ga0070712_100624841
809 Ga0075367_10355038
810 Ga0075367_10427832
811 Ga0075366_10002821
812 Ga0075366_10087861
813 Ga0075366_10407069
814 Ga0097621_100027008
815 Ga0097621_100343067
816 Ga0097621_100905646
817 Ga0075370_10011509
818 Ga0075370_10023411
819 Ga0068871_100623275
820 Ga0068871_100669252
821 Ga0068871_100944448
822 Ga0068871_101511051
823 Ga0068871_101785678
824 Ga0075430_100092142
825 Ga0075430_100729346
826 Ga0075430_101359021
827 Ga0075431_101103597
828 Ga0075434_100001202
829 Ga0075434_100022294
830 Ga0075434_100499195
831 Ga0068865_100218883
832 Ga0068865_100830735
833 Ga0075436_100008391
834 Ga0075436_100136634
835 Ga0075436_100169302
836 Ga0075436_100493757
837 Ga0097620_100102740
838 Ga0097620_100135497
839 Ga0097620_100162982
840 Ga0097620_100225713
841 Ga0097620_100731571
842 Ga0075435_100000204
843 Ga0075435_100001088
844 Ga0075435_100002425
845 Ga0075435_100095033
846 Ga0075435_100324232
847 Ga0075435_100606463
848 Ga0105240_10825277
849 Ga0105245_10187447
850 Ga0105245_10208289
851 Ga0105245_10623303
852 Ga0105247_10681816
853 Ga0105247_10694892
854 Ga0105247_10789462
855 Ga0114129_10462560
856 Ga0114129_10692310
857 Ga0105243_10056975
858 Ga0105243_10117657
859 Ga0105243_10341902
860 Ga0105243_11119427
861 Ga0105241_10339984
862 Ga0105241_10507330
863 Ga0105242_10085151
864 Ga0105242_10195879
865 Ga0105242_10288945
866 Ga0105242_11239814
867 Ga0105242_11267665
868 Ga0105248_10026431
869 Ga0105248_10096201
870 Ga0105248_10604924
871 Ga0105248_11912137
872 Ga0105248_12115980
873 Ga0105237_10758681
874 Ga0105238_10720712
875 Ga0105249_10400921
876 Ga0105249_10545469
877 Ga0105249_11509895
878 Ga0105239_10057888
879 Ga0105239_10428026
880 Ga0105239_10794305
881 Ga0105246_10813182
882 Ga0157370_10237700
883 Ga0157369_10861304
884 Ga0157374_10509848
885 Ga0157378_10071198
886 Ga0157378_10905276
887 Ga0157378_11461688
888 Ga0163162_10197770
889 Ga0157375_10390121
890 Ga0157375_10406531
891 Ga0157375_10516442
892 Ga0157375_12208176
893 Ga0163163_10082907
894 Ga0163163_10091482
895 Ga0163163_10239634
896 Ga0163163_11179458
897 Ga0163163_11216422
898 Ga0163163_11320589
899 Ga0163163_12012758
900 Ga0157380_10052201
901 Ga0157380_10393867
902 Ga0157380_10876656
903 Ga0157377_10058953
904 Ga0157379_10358399
905 Ga0157376_10462872
906 Ga0157376_10759171
907 Ga0157376_10814960
908 Ga0163161_10054649
909 Ga0206350_11550062
910 Ga0224572_1008181
911 Ga0228598_1001679
912 Ga0207697_10002984
913 Ga0207697_10166110
914 Ga0207697_10230456
915 Ga0207656_10078613
916 Ga0207653_10040531
917 Ga0207682_10175799
918 Ga0207710_10542210
919 Ga0207688_10119749
920 Ga0207680_10148843
921 Ga0207680_10169206
922 Ga0207680_10200090
923 Ga0207680_10228971
924 Ga0207647_10272928
925 Ga0207685_10178301
926 Ga0207699_10308130
927 Ga0207645_10025717
928 Ga0207654_10504454
929 Ga0207695_10701941
930 Ga0207695_10906793
931 Ga0207671_10969093
932 Ga0207693_10339278
933 Ga0207663_10178768
934 Ga0207660_10253379
935 Ga0207662_10021857
936 Ga0207662_10077627
937 Ga0207657_10342667
938 Ga0207657_11073099
939 Ga0207649_10100803
940 Ga0207649_10187349
941 Ga0207646_10752636
942 Ga0207681_10099803
943 Ga0207681_10244577
944 Ga0207650_10016612
945 Ga0207650_10182945
946 Ga0207650_10312735
947 Ga0207650_10507796
948 Ga0207659_10003331
949 Ga0207659_10095980
950 Ga0207687_10213933
951 Ga0207687_10394171
952 Ga0207687_10481368
953 Ga0207687_11761514
954 Ga0207700_10113559
955 Ga0207644_10011948
956 Ga0207644_10924210
957 Ga0207644_11138173
958 Ga0207644_11554040
959 Ga0207706_10185952
960 Ga0207706_10432383
961 Ga0207706_10723434
962 Ga0207706_10774261
963 Ga0207706_11147966
964 Ga0207686_10062936
965 Ga0207686_10707497
966 Ga0207709_10389413
967 Ga0207670_10010102
968 Ga0207670_10095483
969 Ga0207670_10254654
970 Ga0207670_10580212
971 Ga0207670_10777458
972 Ga0207669_10448882
973 Ga0207704_10212260
974 Ga0207704_10579159
975 Ga0207704_10667553
976 Ga0207665_10136872
977 Ga0207665_11193259
978 Ga0207691_10005110
979 Ga0207691_10036798
980 Ga0207691_10082630
981 Ga0207691_11010852
982 Ga0207711_10029070
983 Ga0207711_10234717
984 Ga0207711_10786428
985 Ga0207711_11001191
986 Ga0207689_10022939
987 Ga0207689_10275342
988 Ga0207679_10254463
989 Ga0207679_10735522
990 Ga0207679_10839146
991 Ga0207679_11261358
992 Ga0207679_11729757
993 Ga0207679_11938752
994 Ga0207667_10752554
995 Ga0207651_10000712
996 Ga0207651_10095558
997 Ga0207651_10214889
998 Ga0207651_10373007
999 Ga0207651_10518988
1000 Ga0207651_10828424
1001 Ga0207712_10160810
1002 Ga0207712_10311541
1003 Ga0207668_10064741
1004 Ga0207668_10217123
1005 Ga0207640_10062896
1006 Ga0207658_10121119
1007 Ga0207658_10303075
1008 Ga0207677_10192666
1009 Ga0207677_11218244
1010 Ga0207703_10121094
1011 Ga0207703_10199166
1012 Ga0207639_10498238
1013 Ga0207678_10270490
1014 Ga0207678_10280812
1015 Ga0207678_11444197
1016 Ga0207708_10092051
1017 Ga0207708_10360623
1018 Ga0207702_11163831
1019 Ga0207641_10118565
1020 Ga0207641_10519458
1021 Ga0207641_10568364
1022 Ga0207648_10088519
1023 Ga0207648_10613999
1024 Ga0207648_11758961
1025 Ga0207676_10020645
1026 Ga0207676_10079395
1027 Ga0207676_10785542
1028 Ga0207676_10989315
1029 Ga0207675_100069655
1030 Ga0207675_100562280
1031 Ga0207675_100797806
1032 Ga0207675_100872354
1033 Ga0207675_101470875
1034 Ga0207675_102220598
1035 Ga0207683_10069152
1036 Ga0207683_10687428
1037 Ga0207683_10729482
1038 Ga0207683_10915801
1039 Ga0207698_10075568
1040 Ga0207698_10821437
1041 Ga0207698_11016934
1042 Ga0209813_10027607
1043 Ga0209813_10134725
1044 Ga0209813_10150298
1045 Ga0268266_10015925
1046 Ga0268266_10159964
1047 Ga0268265_10289367
1048 Ga0268265_10337352
1049 Ga0268265_12077884
1050 Ga0268264_10480993
1051 Ga0268264_10781208
1052 Ga0268264_11271667
1053 Ga0265760_10012556
1054 Ga0265332_10033437
1055 Ga0265328_10431271
1056 Ga0265329_10141171
1057 Ga0265331_10224320
1058 Ga0265316_10663024
1059 Ga0265314_10011701
1060 Ga0307405_11979672
1061 Ga0307406_10183859
1062 Ga0307407_10067864
1063 Ga0307412_10180571
1064 Ga0307412_10352594
1065 Ga0307412_10453036
1066 Ga0307412_11829949
1067 Ga0307416_100500941
1068 Ga0307416_101643879
1069 Ga0307415_101212035
1070 Ga0373930_0033198
1071 Ga0373950_0007027
1072 Ga0373958_0000965
1073 Ga0373938_0000489
1074 Ga0373928_0081543
1075 Ga0373929_0000898
1076 Ga0373929_0130322
1077 Ga0373940_0138353
1078 Ga0373949_0001032
1079 Ga0373951_0007844
1080 Ga0373951_0026523
1081 Ga0373952_0025077
1082 Ga0373939_0002375
1083 Ga0373939_0107842
1084 Ga0373939_0120242
1085 Ga0373941_0022379
1086 Ga0373941_0118457
1087 Ga0373941_0124414
1088 Ga0373953_0486034
1089 Ga0373960_0115123
1090 Ga0373943_0090563
1091 Ga0373943_0276619
1092 Ga0373946_0657234
1093 Ga0373942_0000565
1094 Ga0373961_0004391
1095 Ga0373962_0005233
1096 Ga0373931_0171521
1097 Ga0373931_0404887
1098 Ga0373927_0713959
1099 Ga0373933_1026232
1100 Ga0373947_0403835
1101 Ga0373937_0121505
1102 Ga0373937_0307205
1103 Ga0373925_0272264
1104 Ga0373925_1316269
1105 Ga0439439_0062975
1106 Ga0451797_0414587
1107 Ga0451802_0132103
1108 Ga0451807_0382184
1109 Ga0451843_1492053
1110 Ga0451855_1884180
1111 Ga0451853_0769925
1112 Ga0451853_3511899
1113 Ga0439433_0029720
1114 Ga0439443_011537
1115 Ga0439446_0030533
1116 Ga0439434_0057259
1117 Ga0453683_0563504
1118 Ga0453684_0689326
1119 Ga0451576_0118553
1120 Ga0495592_0302526
1121 Ga0495603_0733913
1122 Ga0495603_0854136
1123 Ga0495653_0197886
1124 Ga0495580_0693262
1125 Ga0495582_0240619
1126 Ga0495662_0302103
1127 Ga0495608_0104950
1128 Ga0495618_0144400
1129 Ga0495618_0235903
1130 Ga0495628_0230618
1131 Ga0495630_0237471
1132 Ga0495630_0554227
1133 Ga0495630_0567153
1134 Ga0495640_0091251
1135 Ga0495640_0446384
1136 Ga0495586_0218829
1137 Ga0495621_0099283
1138 Ga0495621_0117525
1139 Ga0495635_0000335
1140 Ga0495635_0473741
1141 Ga0495599_0141080
1142 Ga0495658_0054579
1143 Ga0495658_0176654
1144 Ga0495613_0088368
1145 Ga0495613_0103562
1146 Ga0495613_0624350
1147 Ga0495600_0171447
1148 Ga0495604_0516164
1149 Ga0495674_0154480
1150 Ga0495672_0000772
1151 Ga0495680_0004528
1152 Ga0495684_0006457
1153 Ga0495684_0471562
1154 Ga0495684_0629443
1155 Ga0496100_0160017
1156 Ga0496100_0756715
1157 Ga0496100_0758850
1158 Ga0496100_1367196
1159 Ga0496101_0141631
1160 Ga0496102_0514243
1161 Ga0496102_0830993
1162 Ga0496102_0876362
1163 Ga0496104_0273376
1164 Ga0496104_0498572
1165 Ga0496104_0851877
1166 Ga0496104_1160527
1167 Ga0496105_0036060
1168 Ga0496105_0056725
1169 Ga0496106_0077954
1170 Ga0496106_0197496
1171 Ga0496107_0122063
1172 Ga0496107_0446707
1173 Ga0496107_0454435
1174 Ga0496107_0689466
1175 Ga0496107_1364682
1176 Ga0496108_0094061
1177 Ga0496108_0132546
1178 Ga0496108_0170202
1179 Ga0496108_0384344
1180 Ga0496108_0570770
1181 Ga0496109_0052581
1182 Ga0496109_0067308
1183 Ga0496109_0280225
1184 Ga0496109_1147744
1185 Ga0496110_0356135
1186 Ga0496111_0078547
1187 Ga0496111_0352668
1188 Ga0496112_0447594
1189 Ga0496113_0235408
1190 Ga0496114_0760382
1191 Ga0501042_0576322
1192 Ga0501042_0907248
1193 Ga0501046_1251270
1194 Ga0501067_0189020
1195 Ga0501067_0443792
1196 Ga0501071_0626198
1197 Ga0501073_0326584
1198 Ga0501076_0292166
1199 Ga0501077_0274900
1200 Ga0501079_0285082
1201 Ga0501080_0074665
1202 Ga0501080_1389859
1203 Ga0501083_0184523
1204 nmdc:mga00v17_229133_c1
1205 nmdc:mga00v17_306476_c1
1206 nmdc:mga0yw44_53522_c1
1207 nmdc:mga0k408_32240_c1
1208 nmdc:mga0k408_48560_c1
1209 nmdc:mga0k408_8436_c1
1210 nmdc:mga06z11_110941_c1
1211 nmdc:mga06z11_3006_c1
1212 nmdc:mga04h51_130138_c1
1213 nmdc:mga04h51_30964_c1
1214 nmdc:mga04h51_52134_c1
1215 nmdc:mga07m45_16466_c1
1216 nmdc:mga07m45_369925_c1
1217 nmdc:mga05p37_138156_c1
1218 nmdc:mga09592_189085_c1
1219 nmdc:mga0qj67_18038_c1
1220 nmdc:mga06r32_966361_c1
1221 nmdc:mga08y16_1381158_c1
1222 nmdc:mga0n895_1011853_c1
1223 nmdc:mga0n895_141_c1
1224 nmdc:mga0n895_25107_c1
1225 nmdc:mga0n895_328616_c1
1226 nmdc:mga0n895_460010_c1
1227 nmdc:mga0rr50_10070_c1
1228 nmdc:mga0rr50_1401_c1
1229 nmdc:mga0rr50_1_c1
1230 nmdc:mga0rr50_264051_c1
1231 nmdc:mga0rr50_40858_c1
1232 nmdc:mga0rr50_455479_c1
1233 nmdc:mga08x19_257364_c1
1234 nmdc:mga08x19_291809_c1
1235 nmdc:mga08x19_40819_c1
1236 nmdc:mga08x19_62657_c1
1237 nmdc:mga08x19_708099_c1
1238 nmdc:mga08x19_92_c1
1239 Ga0495601_0126699
1240 Ga0495601_0866879
1241 Ga0495612_0170005
1242 Ga0495655_0238254
1243 Ga0495595_0043405
1244 Ga0495595_0391105
1245 Ga0495619_0067845
1246 Ga0495619_0120969
1247 Ga0495619_0369246
1248 Ga0501082_0191525
1249 Ga0501082_0538447
1250 Ga0530510_0520557

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02823

ATP-synt_DE_N

ATP synthase, Delta/Epsilon chain, beta-sandwich domain

12

90

0.98

PF00401

ATP-synt_DE

ATP synthase, Delta/Epsilon chain, long alpha-helix domain

94

138

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hkk-assembly2.cif.gz_P caldalaklibacillus thermarum f1-atpase (wild type) 0.9614 6 135
5ik2-assembly1.cif.gz_H caldalaklibacillus thermarum f1-atpase (epsilon mutant) 0.9498 6 135
5hkk-assembly2.cif.gz_P caldalaklibacillus thermarum f1-atpase (wild type) 0.9403 6 135
5ik2-assembly1.cif.gz_H caldalaklibacillus thermarum f1-atpase (epsilon mutant) 0.9291 6 135
5dn6-assembly1.cif.gz_I atp synthase from paracoccus denitrificans 0.9262 12 84
ID Description Score Start End Superfamily
2e5yB01 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9679 4 91 2.60.15.10
af_Q2FWF1_1_89_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9651 4 91 2.60.15.10
2e5yB01 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9573 4 91 2.60.15.10
af_P00835_1_88_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9544 6 91 2.60.15.10
af_P0A6E6_91_134_1.20.5.440 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;ATP synthase delta/epsilon subunit, C-terminal domain 0.9512 92 135 1.20.5.440
ID Description Score Start End GO Terms
AF-A0A1F9HME4-F1-model_v4 ATP synthase F1 subunit epsilon 0.9933 6 86 GO:0012505
GO:0045261
GO:0046933
AF-A0A832DIA0-F1-model_v4 ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit) 0.9905 6 92 GO:0005524
GO:0005886
GO:0012505
GO:0045261
GO:0046933
AF-A0A7W0NUT7-F1-model_v4 ATP synthase F1 subunit epsilon 0.9881 7 83 GO:0012505
GO:0045261
GO:0046933
AF-A0A2D6QYI8-F1-model_v4 ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit) 0.9868 4 139 GO:0005524
GO:0005886
GO:0045261
GO:0046933
AF-T1BVN2-F1-model_v4 ATPase, F1 complex, delta/epsilon subunit (EC 3.6.3.14) 0.9862 6 80 GO:0016787
GO:0045261
GO:0046933

Map