F470297

General Info

Members Datasets Scaffolds Average Seq Length
624 265 1248 243

Family's Representative Sequence

Representative Sequence 3300044693|Ga0466961_0034925|Ga0466961_0034925_92_916
Length 274
Sequence MSTPTNISPSLPRLAGGRPRSGFAATYVKYELLRTVRNKRSFIFSLIFPIVMYFLLAGPNRNKHNFGGSAAHPTHLFAPQYYMLGLLAFGTMIAAMSAGARIAAERAVGWNRQLRITPLTPRMYFRAKVLTSYLMAAMSIVLLYAAGIAMGVRIHPFGNWFKMTGLVLVALVPFAALGIALGHLLTSDSMGPALGGITSLFAFLGGTWFPITGHGFFVQVCKTLPSYWLTEAGHIGYGGTSDPWGSRGWVTIAAWALACVAFARWAYRRDTGRA

Samples

Sample ID Description Type Environment
1 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
174 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
175 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
176 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
177 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
178 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
185 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
186 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
187 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
188 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
189 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
190 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
191 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
192 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
193 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
194 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
195 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
196 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
197 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
198 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
199 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
200 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
201 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
202 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
203 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
204 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
205 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
206 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
207 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
208 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
209 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
210 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
211 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
212 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
213 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
214 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
219 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
220 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
221 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
222 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
223 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
224 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
238 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
239 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
240 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
241 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
242 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
243 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
244 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
245 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
246 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
249 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
252 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
253 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
254 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
255 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
256 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
257 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
258 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
259 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
260 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
261 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
262 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
263 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
264 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
265 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.48
Nodule 0
Rhizoplane 14.26
Rhizosphere 85.1
Stem 0
Stem Tuber 0
Unclassified 4.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466961_0034925 3300044693 Bacteria 3228
2 Ga0070683_100015318 3300005329 Bacteria 6730
3 Ga0070683_100017542 3300005329 Bacteria 6328
4 Ga0070683_100025155 3300005329 Bacteria 5343
5 Ga0070683_100049373 3300005329 Bacteria 3892
6 Ga0070683_100262925 3300005329 Bacteria 1641
7 Ga0070690_100244629 3300005330 Bacteria 1266
8 Ga0070670_100007315 3300005331 Bacteria 9366
9 Ga0068869_100019510 3300005334 Bacteria 4634
10 Ga0068869_100034405 3300005334 Bacteria 3584
11 Ga0068869_100176839 3300005334 Bacteria 1671
12 Ga0068869_100178071 3300005334 Bacteria 1665
13 Ga0070666_10037007 3300005335 Bacteria 3243
14 Ga0070680_100018180 3300005336 Bacteria 5552
15 Ga0070680_100033320 3300005336 Bacteria 4151
16 Ga0070682_100006877 3300005337 Bacteria 6392
17 Ga0070682_100013832 3300005337 Bacteria 4652
18 Ga0070682_100017693 3300005337 Bacteria 4157
19 Ga0070682_100038492 3300005337 Bacteria 2933
20 Ga0070682_100067423 3300005337 Bacteria 2279
21 Ga0070682_100111271 3300005337 Bacteria 1825
22 Ga0070682_100234565 3300005337 Bacteria 1314
23 Ga0068868_100002874 3300005338 Bacteria 11946
24 Ga0068868_100017952 3300005338 Bacteria 5279
25 Ga0068868_100079104 3300005338 Bacteria 2633
26 Ga0068868_100464609 3300005338 Bacteria 1103
27 Ga0070660_100331106 3300005339 Bacteria 1252
28 Ga0070689_100010814 3300005340 Bacteria 6521
29 Ga0070689_100053594 3300005340 Bacteria 3122
30 Ga0070691_10009382 3300005341 Bacteria 4468
31 Ga0070691_10014149 3300005341 Bacteria 3658
32 Ga0070661_100326452 3300005344 Bacteria 1199
33 Ga0070692_10008875 3300005345 Bacteria 4504
34 Ga0070668_100379978 3300005347 Bacteria 1202
35 Ga0070669_100466673 3300005353 Bacteria 1043
36 Ga0070675_100022233 3300005354 Bacteria 5066
37 Ga0070675_100130327 3300005354 Bacteria 2142
38 Ga0070675_100164532 3300005354 Bacteria 1910
39 Ga0070671_100006431 3300005355 Bacteria 9387
40 Ga0070671_100101971 3300005355 Bacteria 2408
41 Ga0070671_100221015 3300005355 Bacteria 1607
42 Ga0070674_100233988 3300005356 Bacteria 1435
43 Ga0070673_100083074 3300005364 Bacteria 2601
44 Ga0070688_100056280 3300005365 Bacteria 2470
45 Ga0070659_100015410 3300005366 Bacteria 5725
46 Ga0070659_100026771 3300005366 Bacteria 4439
47 Ga0070659_100051366 3300005366 Bacteria 3242
48 Ga0070659_100692159 3300005366 Unclassified 881
49 Ga0070709_10029314 3300005434 Bacteria 3291
50 Ga0070709_10162839 3300005434 Bacteria 1552
51 Ga0070714_100069246 3300005435 Bacteria 3046
52 Ga0070713_100219899 3300005436 Bacteria 1723
53 Ga0070713_100470636 3300005436 Bacteria 1183
54 Ga0070710_10055584 3300005437 Bacteria 2237
55 Ga0070701_10025732 3300005438 Bacteria 2861
56 Ga0070711_100067883 3300005439 Bacteria 2503
57 Ga0070711_100132640 3300005439 Bacteria 1857
58 Ga0070711_100300555 3300005439 Unclassified 1276
59 Ga0070711_100311955 3300005439 Bacteria 1254
60 Ga0070700_100001440 3300005441 Bacteria 11842
61 Ga0070700_100012039 3300005441 Bacteria 4808
62 Ga0070700_100076267 3300005441 Bacteria 2153
63 Ga0070708_100014056 3300005445 Bacteria 6577
64 Ga0070663_100006859 3300005455 Bacteria 6891
65 Ga0070663_100037025 3300005455 Bacteria 3394
66 Ga0070663_100058004 3300005455 Bacteria 2779
67 Ga0070678_100006880 3300005456 Bacteria 6707
68 Ga0070678_100791646 3300005456 Bacteria 860
69 Ga0070662_100153827 3300005457 Bacteria 1793
70 Ga0070662_100387231 3300005457 Bacteria 1152
71 Ga0070681_10002072 3300005458 Bacteria 18196
72 Ga0070681_10086307 3300005458 Bacteria 3091
73 Ga0070681_10515274 3300005458 Bacteria 1109
74 Ga0070685_10097141 3300005466 Bacteria 1793
75 Ga0070707_100015000 3300005468 Bacteria 7272
76 Ga0070699_100007034 3300005518 Bacteria 9775
77 Ga0070679_100011572 3300005530 Bacteria 8407
78 Ga0070679_100023415 3300005530 Bacteria 6044
79 Ga0070679_100046910 3300005530 Bacteria 4307
80 Ga0070684_100014693 3300005535 Bacteria 6351
81 Ga0070684_100018166 3300005535 Bacteria 5787
82 Ga0070684_100018832 3300005535 Bacteria 5698
83 Ga0070684_100061640 3300005535 Bacteria 3283
84 Ga0070684_100145323 3300005535 Bacteria 2146
85 Ga0070684_100255517 3300005535 Bacteria 1602
86 Ga0068853_100202193 3300005539 Bacteria 1808
87 Ga0070672_100147236 3300005543 Bacteria 1946
88 Ga0070686_100082145 3300005544 Bacteria 2136
89 Ga0070686_100103477 3300005544 Bacteria 1927
90 Ga0070695_100252719 3300005545 Bacteria 1284
91 Ga0070695_100319113 3300005545 Bacteria 1154
92 Ga0070696_100052213 3300005546 Bacteria 2844
93 Ga0070696_100058558 3300005546 Bacteria 2690
94 Ga0070696_100584024 3300005546 Bacteria 899
95 Ga0070693_100001973 3300005547 Bacteria 9388
96 Ga0070693_100044765 3300005547 Bacteria 2505
97 Ga0070665_100028709 3300005548 Bacteria 5601
98 Ga0070704_100019732 3300005549 Bacteria 4337
99 Ga0068855_100019063 3300005563 Bacteria 8248
100 Ga0068855_100076018 3300005563 Bacteria 3898
101 Ga0068855_100099434 3300005563 Bacteria 3351
102 Ga0068855_100115468 3300005563 Bacteria 3077
103 Ga0068855_100438617 3300005563 Bacteria 1427
104 Ga0070664_100033294 3300005564 Bacteria 4315
105 Ga0068857_100083105 3300005577 Bacteria 2860
106 Ga0068857_100157915 3300005577 Bacteria 2057
107 Ga0068857_100282481 3300005577 Bacteria 1527
108 Ga0068854_100043578 3300005578 Bacteria 3181
109 Ga0068856_100002734 3300005614 Bacteria 18057
110 Ga0068856_100051954 3300005614 Bacteria 4041
111 Ga0068856_100143412 3300005614 Bacteria 2396
112 Ga0068856_100158741 3300005614 Unclassified 2272
113 Ga0068856_100288650 3300005614 Bacteria 1657
114 Ga0068856_100328326 3300005614 Bacteria 1547
115 Ga0068856_100330708 3300005614 Bacteria 1541
116 Ga0068856_100547462 3300005614 Bacteria 1178
117 Ga0070702_100026080 3300005615 Bacteria 3138
118 Ga0070702_100027572 3300005615 Bacteria 3067
119 Ga0070702_100147010 3300005615 Bacteria 1508
120 Ga0068852_100103219 3300005616 Bacteria 2578
121 Ga0068852_100121657 3300005616 Bacteria 2391
122 Ga0068852_100123300 3300005616 Bacteria 2376
123 Ga0068852_100623063 3300005616 Unclassified 1085
124 Ga0068852_100710500 3300005616 Unclassified 1016
125 Ga0068859_100215167 3300005617 Bacteria 2009
126 Ga0068859_100264788 3300005617 Bacteria 1811
127 Ga0068864_100005205 3300005618 Bacteria 10659
128 Ga0068864_100168542 3300005618 Bacteria 1995
129 Ga0068866_10071144 3300005718 Bacteria 1839
130 Ga0068861_100032453 3300005719 Bacteria 3844
131 Ga0068851_10161395 3300005834 Bacteria 1231
132 Ga0068870_10000951 3300005840 Bacteria 11373
133 Ga0068863_100015559 3300005841 Bacteria 7309
134 Ga0068863_100691906 3300005841 Unclassified 1013
135 Ga0068858_100067430 3300005842 Bacteria 3314
136 Ga0068860_100270681 3300005843 Bacteria 1658
137 Ga0081455_10030832 3300005937 Bacteria 4864
138 Ga0081455_10066007 3300005937 Bacteria 3024
139 Ga0070717_10267263 3300006028 Bacteria 1514
140 Ga0075365_10156943 3300006038 Bacteria 1584
141 Ga0075363_100338603 3300006048 Unclassified 877
142 Ga0075432_10013630 3300006058 Bacteria 2762
143 Ga0075432_10036804 3300006058 Bacteria 1702
144 Ga0070716_100064180 3300006173 Bacteria 2134
145 Ga0070712_100006959 3300006175 Bacteria 7050
146 Ga0070712_100435031 3300006175 Unclassified 1090
147 Ga0097621_100038116 3300006237 Bacteria 3856
148 Ga0097621_100075974 3300006237 Bacteria 2786
149 Ga0097621_100212298 3300006237 Bacteria 1684
150 Ga0097621_100254730 3300006237 Bacteria 1538
151 Ga0068871_100025724 3300006358 Bacteria 4583
152 Ga0068871_100191131 3300006358 Bacteria 1763
153 Ga0075428_100004576 3300006844 Bacteria 15296
154 Ga0075428_100138451 3300006844 Bacteria 2646
155 Ga0075428_100233558 3300006844 Bacteria 1984
156 Ga0075431_100082366 3300006847 Bacteria 3321
157 Ga0075433_10021256 3300006852 Bacteria 5441
158 Ga0075433_10141564 3300006852 Bacteria 2138
159 Ga0075433_10344019 3300006852 Bacteria 1318
160 Ga0075433_10379182 3300006852 Unclassified 1248
161 Ga0075434_100017106 3300006871 Bacteria 6978
162 Ga0075434_100100757 3300006871 Bacteria 2894
163 Ga0075434_100520266 3300006871 Unclassified 1210
164 Ga0075434_100740901 3300006871 Unclassified 1000
165 Ga0075434_100905338 3300006871 Unclassified 897
166 Ga0075429_100009096 3300006880 Bacteria 8626
167 Ga0068865_100027298 3300006881 Bacteria 3770
168 Ga0068865_100192939 3300006881 Bacteria 1577
169 Ga0075436_100003011 3300006914 Bacteria 11543
170 Ga0075436_100007628 3300006914 Bacteria 7393
171 Ga0075436_100041973 3300006914 Bacteria 3155
172 Ga0075436_100047473 3300006914 Bacteria 2962
173 Ga0075436_100200535 3300006914 Bacteria 1413
174 Ga0097620_100215160 3300006931 Bacteria 2009
175 Ga0097620_100264779 3300006931 Bacteria 1811
176 Ga0075435_100003515 3300007076 Bacteria 10642
177 Ga0075435_100071248 3300007076 Bacteria 2838
178 Ga0105240_10024463 3300009093 Bacteria 7957
179 Ga0105240_10091933 3300009093 Bacteria 3706
180 Ga0105240_10404831 3300009093 Bacteria 1536
181 Ga0111539_10008396 3300009094 Bacteria 13142
182 Ga0111539_10012375 3300009094 Bacteria 10698
183 Ga0111539_10016063 3300009094 Bacteria 9290
184 Ga0111539_10137927 3300009094 Bacteria 2856
185 Ga0111539_10490723 3300009094 Bacteria 1430
186 Ga0105245_10005709 3300009098 Bacteria 10929
187 Ga0105245_10009579 3300009098 Bacteria 8450
188 Ga0105245_10106858 3300009098 Bacteria 2598
189 Ga0105245_10293176 3300009098 Bacteria 1594
190 Ga0105247_10048574 3300009101 Bacteria 2606
191 Ga0114129_10093818 3300009147 Bacteria 4157
192 Ga0114129_10237413 3300009147 Bacteria 2452
193 Ga0114129_10288478 3300009147 Bacteria 2191
194 Ga0114129_10605793 3300009147 Bacteria 1419
195 Ga0114129_11324734 3300009147 Bacteria 891
196 Ga0105243_10059994 3300009148 Bacteria 3038
197 Ga0105243_10182874 3300009148 Bacteria 1824
198 Ga0105241_10024464 3300009174 Bacteria 4484
199 Ga0105241_10037839 3300009174 Bacteria 3636
200 Ga0105241_10166893 3300009174 Bacteria 1815
201 Ga0105241_10357174 3300009174 Bacteria 1270
202 Ga0105248_10209725 3300009177 Bacteria 2195
203 Ga0105237_10214138 3300009545 Bacteria 1926
204 Ga0105237_10316565 3300009545 Bacteria 1564
205 Ga0105238_10024258 3300009551 Bacteria 6183
206 Ga0105238_10050079 3300009551 Bacteria 4205
207 Ga0105238_10262466 3300009551 Bacteria 1707
208 Ga0105238_10325225 3300009551 Unclassified 1524
209 Ga0105238_10380254 3300009551 Bacteria 1403
210 Ga0105249_10365891 3300009553 Bacteria 1464
211 Ga0105249_10556299 3300009553 Bacteria 1198
212 Ga0105239_10013106 3300010375 Bacteria 9213
213 Ga0105239_10027327 3300010375 Bacteria 6281
214 Ga0105239_10089092 3300010375 Bacteria 3402
215 Ga0105239_10127349 3300010375 Bacteria 2831
216 Ga0105239_10138395 3300010375 Bacteria 2712
217 Ga0105239_10230954 3300010375 Bacteria 2075
218 Ga0105239_10299328 3300010375 Bacteria 1811
219 Ga0105239_10449687 3300010375 Bacteria 1461
220 Ga0105239_10452995 3300010375 Bacteria 1456
221 Ga0105239_10952906 3300010375 Unclassified 986
222 Ga0105239_11181108 3300010375 Bacteria 882
223 Ga0105246_10037140 3300011119 Bacteria 3268
224 Ga0105246_10152427 3300011119 Bacteria 1751
225 Ga0105246_10251244 3300011119 Bacteria 1403
226 Ga0105246_10668468 3300011119 Bacteria 906
227 Ga0157373_10067222 3300013100 Bacteria 2535
228 Ga0157373_10082356 3300013100 Bacteria 2268
229 Ga0157373_10147446 3300013100 Bacteria 1655
230 Ga0157371_10097469 3300013102 Bacteria 2084
231 Ga0157370_10064143 3300013104 Bacteria 3478
232 Ga0157370_10121078 3300013104 Bacteria 2443
233 Ga0157369_10105774 3300013105 Bacteria 2995
234 Ga0157374_10021035 3300013296 Bacteria 5798
235 Ga0157374_10089569 3300013296 Bacteria 2932
236 Ga0157374_10706017 3300013296 Bacteria 1022
237 Ga0157378_10103753 3300013297 Bacteria 2598
238 Ga0157378_10312605 3300013297 Bacteria 1524
239 Ga0163162_10162368 3300013306 Bacteria 2356
240 Ga0163162_10249006 3300013306 Bacteria 1909
241 Ga0163162_10261342 3300013306 Bacteria 1863
242 Ga0157372_10117200 3300013307 Bacteria 3054
243 Ga0157372_10125833 3300013307 Bacteria 2947
244 Ga0157372_10188492 3300013307 Bacteria 2388
245 Ga0157372_10499268 3300013307 Bacteria 1419
246 Ga0157375_10029081 3300013308 Bacteria 5192
247 Ga0157375_10130361 3300013308 Bacteria 2633
248 Ga0157375_10255431 3300013308 Bacteria 1914
249 Ga0163163_10305123 3300014325 Bacteria 1644
250 Ga0157380_10671428 3300014326 Bacteria 1037
251 Ga0157377_10003516 3300014745 Bacteria 7088
252 Ga0157377_10009136 3300014745 Bacteria 4853
253 Ga0157377_10046379 3300014745 Bacteria 2431
254 Ga0157377_10071625 3300014745 Bacteria 2005
255 Ga0157379_10284207 3300014968 Bacteria 1506
256 Ga0157376_10009886 3300014969 Bacteria 6957
257 Ga0206356_11230066 3300020070 Bacteria 1871
258 Ga0224712_10009526 3300022467 Bacteria 2931
259 Ga0207656_10081739 3300025321 Bacteria 1453
260 Ga0207692_10037710 3300025898 Bacteria 2366
261 Ga0207692_10077016 3300025898 Bacteria 1773
262 Ga0207710_10060459 3300025900 Bacteria 1717
263 Ga0207688_10000393 3300025901 Bacteria 20500
264 Ga0207688_10002962 3300025901 Bacteria 9241
265 Ga0207688_10036551 3300025901 Bacteria 2722
266 Ga0207680_10155501 3300025903 Bacteria 1528
267 Ga0207647_10038443 3300025904 Bacteria 3026
268 Ga0207647_10046541 3300025904 Bacteria 2703
269 Ga0207699_10016757 3300025906 Bacteria 3841
270 Ga0207645_10013585 3300025907 Bacteria 5482
271 Ga0207643_10005564 3300025908 Bacteria 6734
272 Ga0207705_10081389 3300025909 Bacteria 2360
273 Ga0207654_10143371 3300025911 Bacteria 1526
274 Ga0207654_10196889 3300025911 Bacteria 1324
275 Ga0207707_10035318 3300025912 Bacteria 4371
276 Ga0207707_10063728 3300025912 Bacteria 3208
277 Ga0207707_10075870 3300025912 Bacteria 2934
278 Ga0207695_10013434 3300025913 Bacteria 9767
279 Ga0207695_10087058 3300025913 Bacteria 3148
280 Ga0207695_10163683 3300025913 Bacteria 2154
281 Ga0207671_10090938 3300025914 Bacteria 2299
282 Ga0207671_10356507 3300025914 Bacteria 1160
283 Ga0207693_10010620 3300025915 Bacteria 7471
284 Ga0207693_10031432 3300025915 Bacteria 4194
285 Ga0207663_10025076 3300025916 Bacteria 3442
286 Ga0207663_10096038 3300025916 Bacteria 1979
287 Ga0207663_10164881 3300025916 Bacteria 1568
288 Ga0207663_10194600 3300025916 Bacteria 1458
289 Ga0207660_10150154 3300025917 Bacteria 1789
290 Ga0207660_10327359 3300025917 Bacteria 1225
291 Ga0207660_10486723 3300025917 Bacteria 1000
292 Ga0207657_10006345 3300025919 Bacteria 12283
293 Ga0207657_10125473 3300025919 Bacteria 2108
294 Ga0207657_10246511 3300025919 Bacteria 1425
295 Ga0207649_10004372 3300025920 Bacteria 7668
296 Ga0207649_10226647 3300025920 Bacteria 1334
297 Ga0207649_10417878 3300025920 Bacteria 1006
298 Ga0207652_10018886 3300025921 Bacteria 5659
299 Ga0207652_10060758 3300025921 Bacteria 3261
300 Ga0207652_10107311 3300025921 Bacteria 2473
301 Ga0207646_10042498 3300025922 Bacteria 4083
302 Ga0207681_10557015 3300025923 Bacteria 944
303 Ga0207694_10212715 3300025924 Bacteria 1575
304 Ga0207650_10102600 3300025925 Bacteria 2204
305 Ga0207659_10056002 3300025926 Bacteria 2822
306 Ga0207659_10147931 3300025926 Bacteria 1831
307 Ga0207659_10423035 3300025926 Bacteria 1117
308 Ga0207687_10009406 3300025927 Bacteria 6392
309 Ga0207687_10017219 3300025927 Bacteria 4754
310 Ga0207687_10085311 3300025927 Bacteria 2291
311 Ga0207700_10024757 3300025928 Bacteria 4159
312 Ga0207700_10438760 3300025928 Bacteria 1149
313 Ga0207664_10010525 3300025929 Bacteria 6532
314 Ga0207664_10047115 3300025929 Bacteria 3385
315 Ga0207644_10038216 3300025931 Bacteria 3380
316 Ga0207690_10088413 3300025932 Bacteria 2182
317 Ga0207690_10324828 3300025932 Bacteria 1210
318 Ga0207706_10024437 3300025933 Bacteria 5417
319 Ga0207706_10276625 3300025933 Bacteria 1465
320 Ga0207686_10337634 3300025934 Unclassified 1131
321 Ga0207709_10046830 3300025935 Bacteria 2626
322 Ga0207670_10061618 3300025936 Bacteria 2560
323 Ga0207704_10003128 3300025938 Bacteria 7484
324 Ga0207704_10322291 3300025938 Bacteria 1192
325 Ga0207665_10065783 3300025939 Bacteria 2465
326 Ga0207691_10045923 3300025940 Bacteria 4015
327 Ga0207691_10144569 3300025940 Bacteria 2094
328 Ga0207689_10001401 3300025942 Bacteria 22993
329 Ga0207689_10033394 3300025942 Bacteria 4276
330 Ga0207689_10262777 3300025942 Unclassified 1428
331 Ga0207689_10345454 3300025942 Bacteria 1236
332 Ga0207661_10001401 3300025944 Bacteria 16231
333 Ga0207661_10012512 3300025944 Bacteria 6167
334 Ga0207661_10021231 3300025944 Bacteria 4865
335 Ga0207661_10025210 3300025944 Bacteria 4519
336 Ga0207661_10246681 3300025944 Archaea 1586
337 Ga0207661_10338991 3300025944 Bacteria 1354
338 Ga0207661_10347288 3300025944 Bacteria 1338
339 Ga0207679_10019391 3300025945 Bacteria 4567
340 Ga0207679_10040243 3300025945 Bacteria 3345
341 Ga0207679_10103170 3300025945 Bacteria 2234
342 Ga0207679_10117397 3300025945 Bacteria 2111
343 Ga0207667_10078108 3300025949 Bacteria 3431
344 Ga0207667_10129433 3300025949 Bacteria 2600
345 Ga0207667_10176362 3300025949 Bacteria 2196
346 Ga0207712_10423478 3300025961 Bacteria 1124
347 Ga0207668_10712516 3300025972 Bacteria 883
348 Ga0207640_10199171 3300025981 Bacteria 1516
349 Ga0207640_10296628 3300025981 Bacteria 1277
350 Ga0207640_10355439 3300025981 Unclassified 1178
351 Ga0207640_10661069 3300025981 Bacteria 892
352 Ga0207677_10348764 3300026023 Bacteria 1239
353 Ga0207703_10182759 3300026035 Bacteria 1851
354 Ga0207639_10142354 3300026041 Bacteria 1999
355 Ga0207678_10000866 3300026067 Bacteria 27746
356 Ga0207678_10060576 3300026067 Bacteria 3256
357 Ga0207708_10001179 3300026075 Bacteria 19666
358 Ga0207708_10002388 3300026075 Bacteria 13793
359 Ga0207708_10073142 3300026075 Bacteria 2627
360 Ga0207702_10002076 3300026078 Bacteria 19367
361 Ga0207702_10009334 3300026078 Bacteria 8242
362 Ga0207702_10051273 3300026078 Bacteria 3486
363 Ga0207702_10195927 3300026078 Bacteria 1870
364 Ga0207702_10481402 3300026078 Archaea 1208
365 Ga0207702_10492795 3300026078 Bacteria 1194
366 Ga0207641_10614747 3300026088 Unclassified 1065
367 Ga0207641_10790029 3300026088 Bacteria 938
368 Ga0207676_10005818 3300026095 Bacteria 8717
369 Ga0207674_10033985 3300026116 Bacteria 5333
370 Ga0207674_10068814 3300026116 Bacteria 3562
371 Ga0207674_10118241 3300026116 Bacteria 2620
372 Ga0207674_10251859 3300026116 Bacteria 1713
373 Ga0207675_100095453 3300026118 Bacteria 2798
374 Ga0207683_10000507 3300026121 Bacteria 35942
375 Ga0207683_10030159 3300026121 Bacteria 4698
376 Ga0207683_10037872 3300026121 Bacteria 4201
377 Ga0207683_10485079 3300026121 Bacteria 1141
378 Ga0207698_10076434 3300026142 Bacteria 2680
379 Ga0207698_10350780 3300026142 Bacteria 1394
380 Ga0207698_10733755 3300026142 Unclassified 985
381 Ga0207428_10000196 3300027907 Bacteria 84609
382 Ga0207428_10007490 3300027907 Bacteria 9948
383 Ga0207428_10127015 3300027907 Bacteria 1953
384 Ga0268265_10328485 3300028380 Bacteria 1388
385 Ga0268264_10193575 3300028381 Bacteria 1855
386 Ga0268264_10723853 3300028381 Bacteria 990
387 Ga0265318_10058281 3300028577 Bacteria 1442
388 Ga0307409_100746639 3300031995 Bacteria 982
389 Ga0307416_101396095 3300032002 Bacteria 806
390 Ga0307415_100091943 3300032126 Bacteria 2199
391 Ga0373952_0008175 3300035092 Bacteria 1980
392 Ga0373941_0037781 3300035115 Bacteria 1475
393 Ga0373960_0032848 3300035121 Bacteria 1460
394 Ga0373942_0025616 3300035207 Bacteria 1522
395 Ga0373962_0007245 3300035242 Bacteria 2715
396 Ga0373933_0322606 3300035724 Bacteria 1002
397 Ga0373937_0129691 3300036401 Bacteria 2355
398 Ga0395900_0617007 3300037418 Bacteria 1024
399 Ga0395898_0009535 3300037466 Bacteria 10193
400 Ga0395898_0873636 3300037466 Bacteria 838
401 Ga0395901_0192474 3300038443 Bacteria 2139
402 Ga0395901_0197854 3300038443 Bacteria 2107
403 Ga0436365_0639292 3300039437 Bacteria 1480
404 Ga0439448_0016668 3300042005 Bacteria 2238
405 Ga0439463_004553 3300042016 Bacteria 3475
406 Ga0450914_002651 3300042118 Bacteria 1300
407 Ga0450920_030516 3300042122 Bacteria 1060
408 Ga0439464_0086261 3300042439 Bacteria 942
409 Ga0466972_0081456 3300044658 Bacteria 1541
410 Ga0466966_0010668 3300044684 Bacteria 6108
411 Ga0466966_0018399 3300044684 Bacteria 4609
412 Ga0466966_0071310 3300044684 Bacteria 2177
413 Ga0466966_0148153 3300044684 Bacteria 1432
414 Ga0466961_0045882 3300044693 Bacteria 2796
415 Ga0466961_0056673 3300044693 Bacteria 2497
416 Ga0466961_0074619 3300044693 Bacteria 2151
417 Ga0466961_0207622 3300044693 Bacteria 1210
418 Ga0466963_0002749 3300044694 Bacteria 9925
419 Ga0466963_0002877 3300044694 Bacteria 9725
420 Ga0466963_0060886 3300044694 Bacteria 2522
421 Ga0466963_0070005 3300044694 Bacteria 2359
422 Ga0466963_0305879 3300044694 Bacteria 1118
423 Ga0466964_0018462 3300044706 Bacteria 2677
424 Ga0466964_0021568 3300044706 Bacteria 2493
425 Ga0466970_0003022 3300044765 Bacteria 8157
426 Ga0466970_0027432 3300044765 Bacteria 2989
427 Ga0466970_0065642 3300044765 Bacteria 1948
428 Ga0466970_0342297 3300044765 Unclassified 848
429 Ga0466957_0002515 3300044842 Bacteria 9864
430 Ga0466957_0026122 3300044842 Bacteria 3463
431 Ga0466960_0019801 3300044901 Bacteria 2971
432 Ga0466960_0113935 3300044901 Bacteria 1408
433 Ga0466959_0028602 3300045049 Bacteria 4133
434 Ga0466959_0030282 3300045049 Bacteria 4008
435 Ga0466959_0065821 3300045049 Bacteria 2630
436 Ga0466959_0070714 3300045049 Bacteria 2528
437 Ga0466959_0103037 3300045049 Bacteria 2042
438 Ga0466959_0139123 3300045049 Bacteria 1717
439 Ga0466958_0011364 3300045836 Bacteria 5015
440 Ga0466958_0343244 3300045836 Bacteria 961
441 Ga0466967_0001544 3300045976 Bacteria 13482
442 Ga0466967_0001880 3300045976 Bacteria 12671
443 Ga0466967_0003456 3300045976 Bacteria 10311
444 Ga0466967_0091453 3300045976 Bacteria 2765
445 Ga0466967_0132624 3300045976 Bacteria 2314
446 Ga0466967_0188365 3300045976 Bacteria 1949
447 Ga0466967_0196569 3300045976 Bacteria 1908
448 Ga0466967_0213248 3300045976 Bacteria 1832
449 Ga0466967_0228126 3300045976 Bacteria 1772
450 Ga0466967_0256963 3300045976 Bacteria 1670
451 Ga0495641_0116858 3300046461 Bacteria 1190
452 Ga0495653_0201080 3300046463 Bacteria 1352
453 Ga0495582_0420540 3300046473 Bacteria 771
454 Ga0495618_0021393 3300046514 Bacteria 3988
455 Ga0495652_0549276 3300046529 Bacteria 794
456 Ga0495640_0058900 3300046533 Bacteria 2618
457 Ga0495586_0005238 3300046535 Bacteria 6939
458 Ga0495587_0262391 3300046536 Bacteria 970
459 Ga0495645_0119134 3300046543 Bacteria 1860
460 Ga0495635_0140328 3300046663 Bacteria 1646
461 Ga0495657_0092336 3300046675 Bacteria 1940
462 Ga0495674_0179732 3300047319 Bacteria 1762
463 Ga0495684_0050314 3300047471 Bacteria 3182
464 Ga0496100_0068041 3300048903 Bacteria 2367
465 Ga0496100_0162498 3300048903 Bacteria 1602
466 Ga0496100_0358176 3300048903 Bacteria 1103
467 Ga0496101_0034704 3300048904 Bacteria 3565
468 Ga0496101_0044731 3300048904 Bacteria 3169
469 Ga0496101_0091502 3300048904 Bacteria 2264
470 Ga0496101_0274814 3300048904 Bacteria 1316
471 Ga0496101_0567264 3300048904 Bacteria 897
472 Ga0496102_0011911 3300048905 Bacteria 7508
473 Ga0496102_0070420 3300048905 Bacteria 3211
474 Ga0496102_0176762 3300048905 Bacteria 2010
475 Ga0496102_0222443 3300048905 Bacteria 1780
476 Ga0496102_0263702 3300048905 Bacteria 1624
477 Ga0496102_0271633 3300048905 Bacteria 1598
478 Ga0496102_0309039 3300048905 Bacteria 1490
479 Ga0496103_0008739 3300048906 Bacteria 6010
480 Ga0496103_0021589 3300048906 Bacteria 3874
481 Ga0496103_0027801 3300048906 Bacteria 3429
482 Ga0496103_0062212 3300048906 Bacteria 2323
483 Ga0496103_0065072 3300048906 Bacteria 2274
484 Ga0496103_0275081 3300048906 Bacteria 1083
485 Ga0496104_0017334 3300048907 Bacteria 6555
486 Ga0496104_0027072 3300048907 Bacteria 5302
487 Ga0496104_0045430 3300048907 Bacteria 4131
488 Ga0496104_0064769 3300048907 Bacteria 3467
489 Ga0496104_0251012 3300048907 Bacteria 1682
490 Ga0496104_0637428 3300048907 Unclassified 975
491 Ga0496105_0042873 3300048908 Bacteria 3731
492 Ga0496105_0090878 3300048908 Bacteria 2521
493 Ga0496105_0143436 3300048908 Bacteria 1965
494 Ga0496105_0181503 3300048908 Bacteria 1723
495 Ga0496106_0036916 3300048909 Bacteria 3654
496 Ga0496106_0053647 3300048909 Bacteria 3045
497 Ga0496106_0056122 3300048909 Bacteria 2977
498 Ga0496106_0075879 3300048909 Bacteria 2576
499 Ga0496106_0096885 3300048909 Bacteria 2283
500 Ga0496106_0389684 3300048909 Bacteria 1120
501 Ga0496106_0404017 3300048909 Bacteria 1098
502 Ga0496107_0110495 3300048910 Bacteria 2020
503 Ga0496107_0183296 3300048910 Bacteria 1555
504 Ga0496107_0274204 3300048910 Bacteria 1255
505 Ga0496107_0354394 3300048910 Bacteria 1092
506 Ga0496107_0429261 3300048910 Bacteria 982
507 Ga0496108_0004142 3300048911 Bacteria 11659
508 Ga0496108_0007360 3300048911 Bacteria 8923
509 Ga0496108_0012012 3300048911 Bacteria 7044
510 Ga0496108_0058549 3300048911 Bacteria 3239
511 Ga0496108_0106323 3300048911 Bacteria 2396
512 Ga0496108_0173916 3300048911 Bacteria 1863
513 Ga0496108_0222271 3300048911 Bacteria 1641
514 Ga0496109_0004080 3300048912 Bacteria 12206
515 Ga0496109_0005033 3300048912 Bacteria 11043
516 Ga0496109_0006116 3300048912 Bacteria 10112
517 Ga0496109_0311709 3300048912 Bacteria 1484
518 Ga0496109_0382617 3300048912 Bacteria 1329
519 Ga0496109_0710797 3300048912 Bacteria 942
520 Ga0496109_0794327 3300048912 Archaea 884
521 Ga0496110_0004582 3300048913 Bacteria 10738
522 Ga0496110_0030673 3300048913 Bacteria 4635
523 Ga0496110_0045398 3300048913 Bacteria 3841
524 Ga0496110_0073170 3300048913 Bacteria 3041
525 Ga0496110_0089752 3300048913 Bacteria 2747
526 Ga0496110_0134023 3300048913 Bacteria 2238
527 Ga0496110_0191757 3300048913 Bacteria 1856
528 Ga0496110_0220183 3300048913 Bacteria 1726
529 Ga0496110_0272344 3300048913 Bacteria 1541
530 Ga0496110_0367391 3300048913 Bacteria 1311
531 Ga0496110_0576986 3300048913 Bacteria 1021
532 Ga0496111_0000612 3300048914 Bacteria 18851
533 Ga0496111_0007408 3300048914 Bacteria 7189
534 Ga0496111_0042850 3300048914 Bacteria 3251
535 Ga0496111_0129758 3300048914 Bacteria 1865
536 Ga0496111_0170043 3300048914 Bacteria 1619
537 Ga0496112_0007171 3300048915 Bacteria 9873
538 Ga0496112_0036455 3300048915 Bacteria 4798
539 Ga0496112_0057985 3300048915 Bacteria 3812
540 Ga0496112_0143635 3300048915 Bacteria 2355
541 Ga0496113_0048612 3300048916 Bacteria 3156
542 Ga0496113_0122448 3300048916 Bacteria 2035
543 Ga0496113_0183412 3300048916 Bacteria 1659
544 Ga0496114_0010418 3300048917 Bacteria 7395
545 Ga0496114_0010588 3300048917 Bacteria 7338
546 Ga0496114_0107905 3300048917 Bacteria 2383
547 Ga0496114_0207138 3300048917 Bacteria 1719
548 Ga0496114_0473287 3300048917 Bacteria 1108
549 Ga0496114_0488492 3300048917 Unclassified 1089
550 Ga0496115_0059364 3300048918 Bacteria 3080
551 Ga0496115_0226549 3300048918 Bacteria 1542
552 Ga0496115_0363195 3300048918 Bacteria 1179
553 Ga0501033_0264928 3300049570 Bacteria 1216
554 Ga0501036_0096083 3300049572 Bacteria 2505
555 Ga0501036_0570746 3300049572 Bacteria 939
556 Ga0501039_0014463 3300049575 Bacteria 6041
557 Ga0501040_0219529 3300049576 Bacteria 1352
558 Ga0501041_0128384 3300049577 Bacteria 1579
559 Ga0501041_0155565 3300049577 Bacteria 1428
560 Ga0501041_0217606 3300049577 Unclassified 1198
561 Ga0501042_0382546 3300049578 Bacteria 1019
562 Ga0501046_0009828 3300049580 Bacteria 8249
563 Ga0501046_0021339 3300049580 Bacteria 5345
564 Ga0501048_0066595 3300049582 Bacteria 2546
565 Ga0501048_0133230 3300049582 Bacteria 1756
566 Ga0501067_0019804 3300049583 Bacteria 3724
567 Ga0501069_0018641 3300049585 Bacteria 3747
568 Ga0501069_0030676 3300049585 Bacteria 2953
569 Ga0501070_0019635 3300049586 Bacteria 5666
570 Ga0501070_0067184 3300049586 Bacteria 2969
571 Ga0501071_0000430 3300049587 Bacteria 20980
572 Ga0501072_0000897 3300049588 Bacteria 21843
573 Ga0501072_0105258 3300049588 Bacteria 2243
574 Ga0501074_0092604 3300049590 Bacteria 2164
575 Ga0501075_0034134 3300049591 Bacteria 3786
576 Ga0501075_0144596 3300049591 Bacteria 1812
577 Ga0501075_0234455 3300049591 Bacteria 1399
578 Ga0501076_0003676 3300049592 Bacteria 10783
579 Ga0501076_0073887 3300049592 Bacteria 2730
580 Ga0501077_0002421 3300049593 Bacteria 11194
581 Ga0501077_0043754 3300049593 Bacteria 2846
582 Ga0501079_0002781 3300049741 Bacteria 12760
583 Ga0501080_0489741 3300049742 Bacteria 1100
584 Ga0501081_0005462 3300049743 Bacteria 8204
585 Ga0501081_0014696 3300049743 Bacteria 5164
586 Ga0501081_0314807 3300049743 Bacteria 1149
587 Ga0501083_0034929 3300049744 Bacteria 3436
588 Ga0501035_0215416 3300049822 Bacteria 1642
589 Ga0501045_0013094 3300049824 Bacteria 5850
590 Ga0501045_0120959 3300049824 Bacteria 1944
591 nmdc:mga0yw44_354970_c1 3300050492 Bacteria 987
592 nmdc:mga05p37_1099277_c1 3300050507 Unclassified 833
593 nmdc:mga05p37_1153884_c1 3300050507 Bacteria 805
594 nmdc:mga05p37_17839_c1 3300050507 Bacteria 8568
595 nmdc:mga09592_13054_c1 3300050508 Bacteria 6781
596 nmdc:mga09592_140257_c1 3300050508 Bacteria 2083
597 nmdc:mga08y16_22195_c1 3300050511 Bacteria 6699
598 nmdc:mga08y16_24344_c1 3300050511 Bacteria 6390
599 nmdc:mga08y16_578471_c1 3300050511 Bacteria 1134
600 nmdc:mga08y16_9494_c1 3300050511 Bacteria 10213
601 nmdc:mga0n895_109661_c1 3300050512 Bacteria 2775
602 nmdc:mga0n895_24689_c1 3300050512 Bacteria 5667
603 nmdc:mga0n895_463150_c1 3300050512 Bacteria 1279
604 nmdc:mga0n895_782739_c1 3300050512 Unclassified 945
605 nmdc:mga0rr50_595444_c1 3300050513 Bacteria 942
606 nmdc:mga0rr50_9871_c1 3300050513 Bacteria 6033
607 nmdc:mga08x19_1719_c1 3300050514 Bacteria 13467
608 nmdc:mga08x19_30846_c1 3300050514 Bacteria 3369
609 nmdc:mga08x19_44476_c1 3300050514 Bacteria 2835
610 nmdc:mga08x19_59484_c1 3300050514 Bacteria 2474
611 nmdc:mga0a205_112474_c1 3300050515 Bacteria 2622
612 nmdc:mga0a205_168838_c1 3300050515 Bacteria 2083
613 nmdc:mga0a205_200397_c1 3300050515 Bacteria 1887
614 nmdc:mga0a205_3963_c1 3300050515 Bacteria 13240
615 nmdc:mga0a205_617497_c1 3300050515 Unclassified 937
616 Ga0495601_0372325 3300053077 Bacteria 927
617 Ga0495612_0022366 3300053078 Bacteria 2535
618 Ga0495619_0254266 3300053085 Bacteria 1217
619 Ga0501084_0005384 3300054114 Bacteria 10491
620 Ga0501084_0127075 3300054114 Bacteria 2145
621 Ga0501082_0111220 3300060353 Bacteria 2371
622 Ga0501082_0421543 3300060353 Bacteria 1165
623 Ga0530510_0073188 3300061734 Bacteria 2487
624 Ga0530510_0139164 3300061734 Bacteria 1788
625 Ga0466961_0034925
626 Ga0070683_100015318
627 Ga0070683_100017542
628 Ga0070683_100025155
629 Ga0070683_100049373
630 Ga0070683_100262925
631 Ga0070690_100244629
632 Ga0070670_100007315
633 Ga0068869_100019510
634 Ga0068869_100034405
635 Ga0068869_100176839
636 Ga0068869_100178071
637 Ga0070666_10037007
638 Ga0070680_100018180
639 Ga0070680_100033320
640 Ga0070682_100006877
641 Ga0070682_100013832
642 Ga0070682_100017693
643 Ga0070682_100038492
644 Ga0070682_100067423
645 Ga0070682_100111271
646 Ga0070682_100234565
647 Ga0068868_100002874
648 Ga0068868_100017952
649 Ga0068868_100079104
650 Ga0068868_100464609
651 Ga0070660_100331106
652 Ga0070689_100010814
653 Ga0070689_100053594
654 Ga0070691_10009382
655 Ga0070691_10014149
656 Ga0070661_100326452
657 Ga0070692_10008875
658 Ga0070668_100379978
659 Ga0070669_100466673
660 Ga0070675_100022233
661 Ga0070675_100130327
662 Ga0070675_100164532
663 Ga0070671_100006431
664 Ga0070671_100101971
665 Ga0070671_100221015
666 Ga0070674_100233988
667 Ga0070673_100083074
668 Ga0070688_100056280
669 Ga0070659_100015410
670 Ga0070659_100026771
671 Ga0070659_100051366
672 Ga0070659_100692159
673 Ga0070709_10029314
674 Ga0070709_10162839
675 Ga0070714_100069246
676 Ga0070713_100219899
677 Ga0070713_100470636
678 Ga0070710_10055584
679 Ga0070701_10025732
680 Ga0070711_100067883
681 Ga0070711_100132640
682 Ga0070711_100300555
683 Ga0070711_100311955
684 Ga0070700_100001440
685 Ga0070700_100012039
686 Ga0070700_100076267
687 Ga0070708_100014056
688 Ga0070663_100006859
689 Ga0070663_100037025
690 Ga0070663_100058004
691 Ga0070678_100006880
692 Ga0070678_100791646
693 Ga0070662_100153827
694 Ga0070662_100387231
695 Ga0070681_10002072
696 Ga0070681_10086307
697 Ga0070681_10515274
698 Ga0070685_10097141
699 Ga0070707_100015000
700 Ga0070699_100007034
701 Ga0070679_100011572
702 Ga0070679_100023415
703 Ga0070679_100046910
704 Ga0070684_100014693
705 Ga0070684_100018166
706 Ga0070684_100018832
707 Ga0070684_100061640
708 Ga0070684_100145323
709 Ga0070684_100255517
710 Ga0068853_100202193
711 Ga0070672_100147236
712 Ga0070686_100082145
713 Ga0070686_100103477
714 Ga0070695_100252719
715 Ga0070695_100319113
716 Ga0070696_100052213
717 Ga0070696_100058558
718 Ga0070696_100584024
719 Ga0070693_100001973
720 Ga0070693_100044765
721 Ga0070665_100028709
722 Ga0070704_100019732
723 Ga0068855_100019063
724 Ga0068855_100076018
725 Ga0068855_100099434
726 Ga0068855_100115468
727 Ga0068855_100438617
728 Ga0070664_100033294
729 Ga0068857_100083105
730 Ga0068857_100157915
731 Ga0068857_100282481
732 Ga0068854_100043578
733 Ga0068856_100002734
734 Ga0068856_100051954
735 Ga0068856_100143412
736 Ga0068856_100158741
737 Ga0068856_100288650
738 Ga0068856_100328326
739 Ga0068856_100330708
740 Ga0068856_100547462
741 Ga0070702_100026080
742 Ga0070702_100027572
743 Ga0070702_100147010
744 Ga0068852_100103219
745 Ga0068852_100121657
746 Ga0068852_100123300
747 Ga0068852_100623063
748 Ga0068852_100710500
749 Ga0068859_100215167
750 Ga0068859_100264788
751 Ga0068864_100005205
752 Ga0068864_100168542
753 Ga0068866_10071144
754 Ga0068861_100032453
755 Ga0068851_10161395
756 Ga0068870_10000951
757 Ga0068863_100015559
758 Ga0068863_100691906
759 Ga0068858_100067430
760 Ga0068860_100270681
761 Ga0081455_10030832
762 Ga0081455_10066007
763 Ga0070717_10267263
764 Ga0075365_10156943
765 Ga0075363_100338603
766 Ga0075432_10013630
767 Ga0075432_10036804
768 Ga0070716_100064180
769 Ga0070712_100006959
770 Ga0070712_100435031
771 Ga0097621_100038116
772 Ga0097621_100075974
773 Ga0097621_100212298
774 Ga0097621_100254730
775 Ga0068871_100025724
776 Ga0068871_100191131
777 Ga0075428_100004576
778 Ga0075428_100138451
779 Ga0075428_100233558
780 Ga0075431_100082366
781 Ga0075433_10021256
782 Ga0075433_10141564
783 Ga0075433_10344019
784 Ga0075433_10379182
785 Ga0075434_100017106
786 Ga0075434_100100757
787 Ga0075434_100520266
788 Ga0075434_100740901
789 Ga0075434_100905338
790 Ga0075429_100009096
791 Ga0068865_100027298
792 Ga0068865_100192939
793 Ga0075436_100003011
794 Ga0075436_100007628
795 Ga0075436_100041973
796 Ga0075436_100047473
797 Ga0075436_100200535
798 Ga0097620_100215160
799 Ga0097620_100264779
800 Ga0075435_100003515
801 Ga0075435_100071248
802 Ga0105240_10024463
803 Ga0105240_10091933
804 Ga0105240_10404831
805 Ga0111539_10008396
806 Ga0111539_10012375
807 Ga0111539_10016063
808 Ga0111539_10137927
809 Ga0111539_10490723
810 Ga0105245_10005709
811 Ga0105245_10009579
812 Ga0105245_10106858
813 Ga0105245_10293176
814 Ga0105247_10048574
815 Ga0114129_10093818
816 Ga0114129_10237413
817 Ga0114129_10288478
818 Ga0114129_10605793
819 Ga0114129_11324734
820 Ga0105243_10059994
821 Ga0105243_10182874
822 Ga0105241_10024464
823 Ga0105241_10037839
824 Ga0105241_10166893
825 Ga0105241_10357174
826 Ga0105248_10209725
827 Ga0105237_10214138
828 Ga0105237_10316565
829 Ga0105238_10024258
830 Ga0105238_10050079
831 Ga0105238_10262466
832 Ga0105238_10325225
833 Ga0105238_10380254
834 Ga0105249_10365891
835 Ga0105249_10556299
836 Ga0105239_10013106
837 Ga0105239_10027327
838 Ga0105239_10089092
839 Ga0105239_10127349
840 Ga0105239_10138395
841 Ga0105239_10230954
842 Ga0105239_10299328
843 Ga0105239_10449687
844 Ga0105239_10452995
845 Ga0105239_10952906
846 Ga0105239_11181108
847 Ga0105246_10037140
848 Ga0105246_10152427
849 Ga0105246_10251244
850 Ga0105246_10668468
851 Ga0157373_10067222
852 Ga0157373_10082356
853 Ga0157373_10147446
854 Ga0157371_10097469
855 Ga0157370_10064143
856 Ga0157370_10121078
857 Ga0157369_10105774
858 Ga0157374_10021035
859 Ga0157374_10089569
860 Ga0157374_10706017
861 Ga0157378_10103753
862 Ga0157378_10312605
863 Ga0163162_10162368
864 Ga0163162_10249006
865 Ga0163162_10261342
866 Ga0157372_10117200
867 Ga0157372_10125833
868 Ga0157372_10188492
869 Ga0157372_10499268
870 Ga0157375_10029081
871 Ga0157375_10130361
872 Ga0157375_10255431
873 Ga0163163_10305123
874 Ga0157380_10671428
875 Ga0157377_10003516
876 Ga0157377_10009136
877 Ga0157377_10046379
878 Ga0157377_10071625
879 Ga0157379_10284207
880 Ga0157376_10009886
881 Ga0206356_11230066
882 Ga0224712_10009526
883 Ga0207656_10081739
884 Ga0207692_10037710
885 Ga0207692_10077016
886 Ga0207710_10060459
887 Ga0207688_10000393
888 Ga0207688_10002962
889 Ga0207688_10036551
890 Ga0207680_10155501
891 Ga0207647_10038443
892 Ga0207647_10046541
893 Ga0207699_10016757
894 Ga0207645_10013585
895 Ga0207643_10005564
896 Ga0207705_10081389
897 Ga0207654_10143371
898 Ga0207654_10196889
899 Ga0207707_10035318
900 Ga0207707_10063728
901 Ga0207707_10075870
902 Ga0207695_10013434
903 Ga0207695_10087058
904 Ga0207695_10163683
905 Ga0207671_10090938
906 Ga0207671_10356507
907 Ga0207693_10010620
908 Ga0207693_10031432
909 Ga0207663_10025076
910 Ga0207663_10096038
911 Ga0207663_10164881
912 Ga0207663_10194600
913 Ga0207660_10150154
914 Ga0207660_10327359
915 Ga0207660_10486723
916 Ga0207657_10006345
917 Ga0207657_10125473
918 Ga0207657_10246511
919 Ga0207649_10004372
920 Ga0207649_10226647
921 Ga0207649_10417878
922 Ga0207652_10018886
923 Ga0207652_10060758
924 Ga0207652_10107311
925 Ga0207646_10042498
926 Ga0207681_10557015
927 Ga0207694_10212715
928 Ga0207650_10102600
929 Ga0207659_10056002
930 Ga0207659_10147931
931 Ga0207659_10423035
932 Ga0207687_10009406
933 Ga0207687_10017219
934 Ga0207687_10085311
935 Ga0207700_10024757
936 Ga0207700_10438760
937 Ga0207664_10010525
938 Ga0207664_10047115
939 Ga0207644_10038216
940 Ga0207690_10088413
941 Ga0207690_10324828
942 Ga0207706_10024437
943 Ga0207706_10276625
944 Ga0207686_10337634
945 Ga0207709_10046830
946 Ga0207670_10061618
947 Ga0207704_10003128
948 Ga0207704_10322291
949 Ga0207665_10065783
950 Ga0207691_10045923
951 Ga0207691_10144569
952 Ga0207689_10001401
953 Ga0207689_10033394
954 Ga0207689_10262777
955 Ga0207689_10345454
956 Ga0207661_10001401
957 Ga0207661_10012512
958 Ga0207661_10021231
959 Ga0207661_10025210
960 Ga0207661_10246681
961 Ga0207661_10338991
962 Ga0207661_10347288
963 Ga0207679_10019391
964 Ga0207679_10040243
965 Ga0207679_10103170
966 Ga0207679_10117397
967 Ga0207667_10078108
968 Ga0207667_10129433
969 Ga0207667_10176362
970 Ga0207712_10423478
971 Ga0207668_10712516
972 Ga0207640_10199171
973 Ga0207640_10296628
974 Ga0207640_10355439
975 Ga0207640_10661069
976 Ga0207677_10348764
977 Ga0207703_10182759
978 Ga0207639_10142354
979 Ga0207678_10000866
980 Ga0207678_10060576
981 Ga0207708_10001179
982 Ga0207708_10002388
983 Ga0207708_10073142
984 Ga0207702_10002076
985 Ga0207702_10009334
986 Ga0207702_10051273
987 Ga0207702_10195927
988 Ga0207702_10481402
989 Ga0207702_10492795
990 Ga0207641_10614747
991 Ga0207641_10790029
992 Ga0207676_10005818
993 Ga0207674_10033985
994 Ga0207674_10068814
995 Ga0207674_10118241
996 Ga0207674_10251859
997 Ga0207675_100095453
998 Ga0207683_10000507
999 Ga0207683_10030159
1000 Ga0207683_10037872
1001 Ga0207683_10485079
1002 Ga0207698_10076434
1003 Ga0207698_10350780
1004 Ga0207698_10733755
1005 Ga0207428_10000196
1006 Ga0207428_10007490
1007 Ga0207428_10127015
1008 Ga0268265_10328485
1009 Ga0268264_10193575
1010 Ga0268264_10723853
1011 Ga0265318_10058281
1012 Ga0307409_100746639
1013 Ga0307416_101396095
1014 Ga0307415_100091943
1015 Ga0373952_0008175
1016 Ga0373941_0037781
1017 Ga0373960_0032848
1018 Ga0373942_0025616
1019 Ga0373962_0007245
1020 Ga0373933_0322606
1021 Ga0373937_0129691
1022 Ga0395900_0617007
1023 Ga0395898_0009535
1024 Ga0395898_0873636
1025 Ga0395901_0192474
1026 Ga0395901_0197854
1027 Ga0436365_0639292
1028 Ga0439448_0016668
1029 Ga0439463_004553
1030 Ga0450914_002651
1031 Ga0450920_030516
1032 Ga0439464_0086261
1033 Ga0466972_0081456
1034 Ga0466966_0010668
1035 Ga0466966_0018399
1036 Ga0466966_0071310
1037 Ga0466966_0148153
1038 Ga0466961_0045882
1039 Ga0466961_0056673
1040 Ga0466961_0074619
1041 Ga0466961_0207622
1042 Ga0466963_0002749
1043 Ga0466963_0002877
1044 Ga0466963_0060886
1045 Ga0466963_0070005
1046 Ga0466963_0305879
1047 Ga0466964_0018462
1048 Ga0466964_0021568
1049 Ga0466970_0003022
1050 Ga0466970_0027432
1051 Ga0466970_0065642
1052 Ga0466970_0342297
1053 Ga0466957_0002515
1054 Ga0466957_0026122
1055 Ga0466960_0019801
1056 Ga0466960_0113935
1057 Ga0466959_0028602
1058 Ga0466959_0030282
1059 Ga0466959_0065821
1060 Ga0466959_0070714
1061 Ga0466959_0103037
1062 Ga0466959_0139123
1063 Ga0466958_0011364
1064 Ga0466958_0343244
1065 Ga0466967_0001544
1066 Ga0466967_0001880
1067 Ga0466967_0003456
1068 Ga0466967_0091453
1069 Ga0466967_0132624
1070 Ga0466967_0188365
1071 Ga0466967_0196569
1072 Ga0466967_0213248
1073 Ga0466967_0228126
1074 Ga0466967_0256963
1075 Ga0495641_0116858
1076 Ga0495653_0201080
1077 Ga0495582_0420540
1078 Ga0495618_0021393
1079 Ga0495652_0549276
1080 Ga0495640_0058900
1081 Ga0495586_0005238
1082 Ga0495587_0262391
1083 Ga0495645_0119134
1084 Ga0495635_0140328
1085 Ga0495657_0092336
1086 Ga0495674_0179732
1087 Ga0495684_0050314
1088 Ga0496100_0068041
1089 Ga0496100_0162498
1090 Ga0496100_0358176
1091 Ga0496101_0034704
1092 Ga0496101_0044731
1093 Ga0496101_0091502
1094 Ga0496101_0274814
1095 Ga0496101_0567264
1096 Ga0496102_0011911
1097 Ga0496102_0070420
1098 Ga0496102_0176762
1099 Ga0496102_0222443
1100 Ga0496102_0263702
1101 Ga0496102_0271633
1102 Ga0496102_0309039
1103 Ga0496103_0008739
1104 Ga0496103_0021589
1105 Ga0496103_0027801
1106 Ga0496103_0062212
1107 Ga0496103_0065072
1108 Ga0496103_0275081
1109 Ga0496104_0017334
1110 Ga0496104_0027072
1111 Ga0496104_0045430
1112 Ga0496104_0064769
1113 Ga0496104_0251012
1114 Ga0496104_0637428
1115 Ga0496105_0042873
1116 Ga0496105_0090878
1117 Ga0496105_0143436
1118 Ga0496105_0181503
1119 Ga0496106_0036916
1120 Ga0496106_0053647
1121 Ga0496106_0056122
1122 Ga0496106_0075879
1123 Ga0496106_0096885
1124 Ga0496106_0389684
1125 Ga0496106_0404017
1126 Ga0496107_0110495
1127 Ga0496107_0183296
1128 Ga0496107_0274204
1129 Ga0496107_0354394
1130 Ga0496107_0429261
1131 Ga0496108_0004142
1132 Ga0496108_0007360
1133 Ga0496108_0012012
1134 Ga0496108_0058549
1135 Ga0496108_0106323
1136 Ga0496108_0173916
1137 Ga0496108_0222271
1138 Ga0496109_0004080
1139 Ga0496109_0005033
1140 Ga0496109_0006116
1141 Ga0496109_0311709
1142 Ga0496109_0382617
1143 Ga0496109_0710797
1144 Ga0496109_0794327
1145 Ga0496110_0004582
1146 Ga0496110_0030673
1147 Ga0496110_0045398
1148 Ga0496110_0073170
1149 Ga0496110_0089752
1150 Ga0496110_0134023
1151 Ga0496110_0191757
1152 Ga0496110_0220183
1153 Ga0496110_0272344
1154 Ga0496110_0367391
1155 Ga0496110_0576986
1156 Ga0496111_0000612
1157 Ga0496111_0007408
1158 Ga0496111_0042850
1159 Ga0496111_0129758
1160 Ga0496111_0170043
1161 Ga0496112_0007171
1162 Ga0496112_0036455
1163 Ga0496112_0057985
1164 Ga0496112_0143635
1165 Ga0496113_0048612
1166 Ga0496113_0122448
1167 Ga0496113_0183412
1168 Ga0496114_0010418
1169 Ga0496114_0010588
1170 Ga0496114_0107905
1171 Ga0496114_0207138
1172 Ga0496114_0473287
1173 Ga0496114_0488492
1174 Ga0496115_0059364
1175 Ga0496115_0226549
1176 Ga0496115_0363195
1177 Ga0501033_0264928
1178 Ga0501036_0096083
1179 Ga0501036_0570746
1180 Ga0501039_0014463
1181 Ga0501040_0219529
1182 Ga0501041_0128384
1183 Ga0501041_0155565
1184 Ga0501041_0217606
1185 Ga0501042_0382546
1186 Ga0501046_0009828
1187 Ga0501046_0021339
1188 Ga0501048_0066595
1189 Ga0501048_0133230
1190 Ga0501067_0019804
1191 Ga0501069_0018641
1192 Ga0501069_0030676
1193 Ga0501070_0019635
1194 Ga0501070_0067184
1195 Ga0501071_0000430
1196 Ga0501072_0000897
1197 Ga0501072_0105258
1198 Ga0501074_0092604
1199 Ga0501075_0034134
1200 Ga0501075_0144596
1201 Ga0501075_0234455
1202 Ga0501076_0003676
1203 Ga0501076_0073887
1204 Ga0501077_0002421
1205 Ga0501077_0043754
1206 Ga0501079_0002781
1207 Ga0501080_0489741
1208 Ga0501081_0005462
1209 Ga0501081_0014696
1210 Ga0501081_0314807
1211 Ga0501083_0034929
1212 Ga0501035_0215416
1213 Ga0501045_0013094
1214 Ga0501045_0120959
1215 nmdc:mga0yw44_354970_c1
1216 nmdc:mga05p37_1099277_c1
1217 nmdc:mga05p37_1153884_c1
1218 nmdc:mga05p37_17839_c1
1219 nmdc:mga09592_13054_c1
1220 nmdc:mga09592_140257_c1
1221 nmdc:mga08y16_22195_c1
1222 nmdc:mga08y16_24344_c1
1223 nmdc:mga08y16_578471_c1
1224 nmdc:mga08y16_9494_c1
1225 nmdc:mga0n895_109661_c1
1226 nmdc:mga0n895_24689_c1
1227 nmdc:mga0n895_463150_c1
1228 nmdc:mga0n895_782739_c1
1229 nmdc:mga0rr50_595444_c1
1230 nmdc:mga0rr50_9871_c1
1231 nmdc:mga08x19_1719_c1
1232 nmdc:mga08x19_30846_c1
1233 nmdc:mga08x19_44476_c1
1234 nmdc:mga08x19_59484_c1
1235 nmdc:mga0a205_112474_c1
1236 nmdc:mga0a205_168838_c1
1237 nmdc:mga0a205_200397_c1
1238 nmdc:mga0a205_3963_c1
1239 nmdc:mga0a205_617497_c1
1240 Ga0495601_0372325
1241 Ga0495612_0022366
1242 Ga0495619_0254266
1243 Ga0501084_0005384
1244 Ga0501084_0127075
1245 Ga0501082_0111220
1246 Ga0501082_0421543
1247 Ga0530510_0073188
1248 Ga0530510_0139164

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12698

ABC2_membrane_3

ABC-2 family transporter protein

73

263

0.83

PF01061

ABC2_membrane

ABC-2 type transporter

24

236

0.82

PF12730

ABC2_membrane_4

ABC-2 family transporter protein

27

205

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
7nez-assembly1.cif.gz_B structure of topotecan-bound abcg2 0.711 6 236
6hbu-assembly1.cif.gz_A cryo-em structure of the abcg2 e211q mutant bound to atp and magnesium 0.6881 6 236
5nj3-assembly1.cif.gz_A structure of an abc transporter: complete structure 0.681 2 241
8p8j-assembly1.cif.gz_B structure of 5d3-fab and nanobody(nb96)-bound abcg2 0.6803 6 236
6m96-assembly1.cif.gz_B-2 atp-bound conformation of the wzmwzt o antigen abc transporter 0.6797 2 242
ID Description Score Start End Superfamily
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7953 41 237 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7426 28 236 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7138 41 234 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6566 41 237 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6444 28 236 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A5B8U2U4-F1-model_v4 ABC transporter permease 0.9763 1 244 GO:0043190
GO:0140359
AF-A0A5B8U2U4-F1-model_v4 ABC transporter permease 0.9724 1 244 GO:0043190
GO:0140359
AF-A0A0D8FR57-F1-model_v4 ABC-2 family transporter protein 0.9545 1 244 GO:0016020
GO:0140359
AF-A0A0D8FR57-F1-model_v4 ABC-2 family transporter protein 0.9507 1 244 GO:0016020
GO:0140359
AF-A0A0Q0Y9C8-F1-model_v4 ABC transporter permease 0.9334 2 244 GO:0043190
GO:0140359

Map