F470061

General Info

Members Datasets Scaffolds Average Seq Length
621 486 305 500

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2757320392|2757570116
Length 577
Sequence KSGSLLLEHFIFRWKRWRGNTPLCPAGHLPLKGGDYAFMNVRHQSQTSEISQSPPLRGRWLASQRGVPRKAGASLTIGIVFLALTGLLAPQAHAQSNIVRLAQNGGAKRINLGLNKSVVIDLPQDAYDILVANPDVADAVTRTSRRIYLFGKQVGQTNIFVFGPNGEQIASLDLQIERDVAGLNHYLKKYIPGSEITVELMNDNVILTGTVQTPQDSAKAAKLAGLFVSGGEATTGQYNKGASAQTGGGGVSIIDNPDEEARRTSKIVNLITIIGDDQVTLKVTVAEVSRSVMKQLGVNMIGWGVADGITYGGVSDAVAGAVGKAITNSGTVISGKVGSGHLDAYLNAMELAGAMKTLAEPTLTAISGEKAVFKVGGEYNIISGQDVEEDETGEKTPVIEYDKIEYGIGLEFMPVVLSPGRISLKVRTAVSEPTMEGSVSLSTGGRTPATNIISLRKRLADTTVELPSGGSMMIAGLIRDETRQSISGLPGLSRIPVLGTLFRSREFVRNETELVIIVTPYLVRPVARNALARPDDNLAPASDPAGYILGQVNRVYGTPQAQPPSGRYHGVVGYIYK

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
3 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
4 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
5 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
6 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
7 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
8 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
9 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
10 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
11 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
12 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
13 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
14 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
15 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
16 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
17 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
18 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
19 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
20 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
21 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
22 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
23 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
24 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
25 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
26 2519899620 Rhizobium sp. Pop5 Isolate Nodule
27 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
28 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
29 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
30 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
31 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
32 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
33 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
34 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
35 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
36 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
37 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
38 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
39 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
40 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
41 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
42 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
43 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
44 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
45 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
46 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
47 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
48 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
49 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
50 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
51 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
52 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
53 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
54 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
55 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
56 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
57 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
58 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
59 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
60 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
61 2643221558 Rhizobium sp. Root149 Isolate Unclassified
62 2643221582 Rhizobium sp. Root651 Isolate Unclassified
63 2643221599 Rhizobium sp. Root708 Isolate Unclassified
64 2643221693 Rhizobium sp. Root491 Isolate Unclassified
65 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
66 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
67 2718217882 Rhizobium sp. N741 Isolate Nodule
68 2718217927 Rhizobium sp. N324 Isolate Nodule
69 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
70 2718218009 Rhizobium sp. N561 Isolate Nodule
71 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
72 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
73 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
74 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
75 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
76 2718218363 Rhizobium sp. N113 Isolate Nodule
77 2718218365 Rhizobium sp. N731 Isolate Nodule
78 2718218366 Rhizobium sp. N621 Isolate Nodule
79 2718218423 Rhizobium sp. N941 Isolate Nodule
80 2721755514 Rhizobium sp. N6212 Isolate Nodule
81 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
82 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
83 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
84 2721755809 Rhizobium sp. N541 Isolate Nodule
85 2721755810 Rhizobium sp. N871 Isolate Nodule
86 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
87 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
88 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
89 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
90 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
91 2728369365 Rhizobium sp. N1341 Isolate Nodule
92 2728369397 Rhizobium sp. N1314 Isolate Nodule
93 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
94 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
95 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
96 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
97 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
98 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
99 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
100 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
101 2791355256 Rhizobium sp. M10 Isolate Nodule
102 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
103 2791355260 Rhizobium sp. L9 Isolate Nodule
104 2791355261 Rhizobium sp. J15 Isolate Nodule
105 2791355262 Rhizobium sp. M1 Isolate Nodule
106 2791355263 Rhizobium chutanense C5 Isolate Nodule
107 2791355264 Rhizobium sp. S9 Isolate Nodule
108 2791355265 Rhizobium sp. H4 Isolate Nodule
109 2791355266 Rhizobium sp. L43 Isolate Nodule
110 2791355267 Rhizobium sp. L18 Isolate Nodule
111 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
112 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
113 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
114 2802429633 Rhizobium anhuiense J3 Isolate Nodule
115 2802429634 Rhizobium anhuiense S10 Isolate Nodule
116 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
117 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
118 2802429637 Rhizobium anhuiense C15 Isolate Nodule
119 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
120 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
121 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
122 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
123 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
124 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
125 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
126 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
127 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
128 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
129 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
130 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
131 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
132 2838048938 Rhizobium pisi 27/80 Isolate Nodule
133 2838061910 Rhizobium phaseoli L15 Isolate Nodule
134 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
135 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
136 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
137 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
138 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
139 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
140 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
141 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
142 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
143 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
144 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
145 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
146 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
147 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
148 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
149 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
150 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
151 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
152 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
153 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
154 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
155 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
156 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
157 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
158 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
159 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
160 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
161 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
162 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
163 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
164 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
165 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
166 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
167 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
168 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
169 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
170 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
171 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
172 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
173 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
174 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
175 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
176 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
177 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
178 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
179 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
180 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
181 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
182 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
183 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
184 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
185 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
186 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
187 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
188 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
189 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
190 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
191 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
192 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
193 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
194 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
195 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
196 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
197 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
198 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
199 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
200 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
201 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
202 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
203 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
204 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
205 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
206 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
207 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
208 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
209 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
210 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
211 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
212 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
213 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
214 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
215 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
216 2854911287 Brucella lupini LUP21 Isolate Unclassified
217 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
218 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
219 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
220 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
221 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
222 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
223 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
224 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
225 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
226 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
227 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
228 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
229 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
230 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
231 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
232 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
233 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
234 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
235 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
236 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
237 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
238 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
239 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
240 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
241 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
242 2933599457 Rhizobium phaseoli M3 Isolate Nodule
243 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
244 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
245 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
246 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
247 2936381700 Rhizobium chutanense C16 Isolate Unclassified
248 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
249 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
250 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
251 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
252 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
253 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
254 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
255 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
256 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
257 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
258 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
259 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
260 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
261 2996887358 Rhizobium sp. R711 Isolate Nodule
262 2996893221 Rhizobium sp. R635 Isolate Nodule
263 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
264 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
265 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
266 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
267 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
268 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
269 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
270 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
271 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
272 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
273 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
274 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
275 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
276 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
277 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
278 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
279 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
280 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
281 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
282 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
283 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
284 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
285 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
286 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
287 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
288 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
289 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
290 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
291 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
292 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
293 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
294 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
295 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
296 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
297 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
298 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
299 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
300 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
301 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
302 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
303 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
304 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
305 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
306 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
307 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
308 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
309 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
310 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
311 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
312 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
313 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
314 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
315 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
316 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
317 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
318 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
319 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
320 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
321 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
322 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
323 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
324 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
325 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
326 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
327 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
328 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
329 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
330 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
331 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
332 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
333 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
334 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
335 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
336 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
339 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
340 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
341 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
343 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
344 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
345 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
346 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
347 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
348 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
349 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
350 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
351 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
352 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
353 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
354 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
355 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
356 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
357 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
358 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
359 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
360 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
361 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
362 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
363 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
364 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
365 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
366 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
367 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
368 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
369 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
370 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
371 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
372 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
373 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
374 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
375 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
376 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
377 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
378 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
379 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
380 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
381 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
382 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
383 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
384 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
385 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
386 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
387 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
388 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
389 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
390 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
391 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
392 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
393 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
394 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
395 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
396 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
397 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
398 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
399 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
400 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
401 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
402 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
403 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
404 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
405 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
406 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
407 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
408 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
409 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
410 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
411 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
412 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
413 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
414 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
415 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
416 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
417 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
418 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
419 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
420 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
421 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
422 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
423 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
424 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
425 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
426 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
427 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
428 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
429 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
430 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
431 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
432 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
433 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
434 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
435 3300053152 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 endosphere Metagenome Endosphere
436 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
437 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
438 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
439 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
440 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
441 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
442 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
443 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
444 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
445 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
446 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
447 8005258706 Rhizobium sp. R693 Isolate Nodule
448 8005275841 Rhizobium sp. N4311 Isolate Nodule
449 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
450 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
451 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
452 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
453 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
454 8005321885 Rhizobium sp. R72 Isolate Nodule
455 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
456 8005382845 Rhizobium sp. R634 Isolate Nodule
457 8005395548 Rhizobium sp. R339 Isolate Nodule
458 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
459 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
460 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
461 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
462 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
463 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
464 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
465 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
466 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
467 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
468 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
469 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
470 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
471 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
472 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
473 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
474 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
475 8018176218 Rhizobium sp. N122 Isolate Nodule
476 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
477 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
478 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
479 8024501048 Rhizobium sp. H4 Isolate Nodule
480 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
481 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
482 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
483 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
484 8056382006 Rhizobium croatiense 13T Isolate Nodule
485 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
486 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 48.95
Metatranscriptomes 0.16
Isolates 50.89

Biome Distribution

Category Percentage (%)
Aerial Root 0.64
Bulb 0
Endosphere 19.16
Nodule 34.14
Rhizoplane 1.61
Rhizosphere 25.6
Stem 0
Stem Tuber 0
Unclassified 18.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000671 3300001979 Bacteria 14823
2 JGI25155J39150_1000110 3300002704 Bacteria 43893
3 JGI25156J39149_1000192 3300002705 Bacteria 44040
4 JGI25162J39368_1000302 3300002737 Bacteria 45304
5 JGI25162J39368_1000517 3300002737 Bacteria 28879
6 JGI25154J39366_1000196 3300002738 Bacteria 44040
7 JGI25157J39369_1000228 3300002741 Bacteria 44040
8 JGI25152J39213_1001974 3300002773 Bacteria 8122
9 JGI25152J39213_1002972 3300002773 Bacteria 6028
10 JGI25159J45721_1002611 3300002987 Bacteria 6742
11 JGI25151J46595_10000660 3300003187 Bacteria 29371
12 JGI25151J46595_10001587 3300003187 Bacteria 15099
13 JGI25165J46597_1000720 3300003214 Bacteria 25923
14 JGI25165J46597_1001110 3300003214 Bacteria 17044
15 JGI25153J46596_10006110 3300003215 Bacteria 6176
16 JGI25153J46596_10007891 3300003215 Bacteria 5166
17 JGI25153J46596_10007897 3300003215 Bacteria 5162
18 JGI25153J46596_10011445 3300003215 Bacteria 3920
19 JGI25153J46596_10011453 3300003215 Bacteria 3918
20 rootL2_10018866 3300003322 Bacteria 9681
21 rootL2_10268344 3300003322 Bacteria 2247
22 rootH1_10049455 3300003323 Bacteria 3706
23 rootH1_10109211 3300003323 Bacteria 2873
24 JGI25160J50197_1004876 3300003354 Bacteria 5710
25 JGI25160J50197_1020065 3300003354 Bacteria 2029
26 JGI25161J50226_1000078 3300003374 Bacteria 83416
27 Ga0006562J51391_1010447 3300003578 Bacteria 6410
28 Ga0055526_1003112 3300003771 Bacteria 10753
29 Ga0055526_1004162 3300003771 Bacteria 8804
30 Ga0055526_1005073 3300003771 Bacteria 7684
31 Ga0055524_1006263 3300003775 Bacteria 5184
32 Ga0055524_1014723 3300003775 Bacteria 2884
33 Ga0055528_1000113 3300003790 Bacteria 65323
34 Ga0055528_1001190 3300003790 Bacteria 16795
35 Ga0055540_1000959 3300003792 Bacteria 18731
36 Ga0055540_1011371 3300003792 Bacteria 2875
37 Ga0058692_1002467 3300003856 Bacteria 6179
38 Ga0058692_1003512 3300003856 Bacteria 4830
39 Ga0058692_1004751 3300003856 Bacteria 3979
40 Ga0055543_1001119 3300004625 Bacteria 11519
41 Ga0065165_1010070 3300005262 Bacteria 4148
42 Ga0065165_1030265 3300005262 Bacteria 1724
43 Ga0070668_100039769 3300005347 Bacteria 3597
44 Ga0070665_100023549 3300005548 Bacteria 6200
45 Ga0070665_100026253 3300005548 Bacteria 5866
46 Ga0068855_100155244 3300005563 Bacteria 2601
47 Ga0075365_10035357 3300006038 Bacteria 3231
48 Ga0075368_10000802 3300006042 Bacteria 9657
49 Ga0075363_100027191 3300006048 Bacteria 2931
50 Ga0075363_100068266 3300006048 Bacteria 1928
51 Ga0075362_10019480 3300006177 Bacteria 2822
52 Ga0075367_10055384 3300006178 Bacteria 2354
53 Ga0075369_10002838 3300006186 Bacteria 6241
54 Ga0075366_10001209 3300006195 Bacteria 12817
55 Ga0075370_10009887 3300006353 Bacteria 4970
56 Ga0079104_1000082 3300006946 Bacteria 137722
57 Ga0079104_1000972 3300006946 Bacteria 22433
58 Ga0099826_10000075 3300006948 Bacteria 52009
59 Ga0105240_10002912 3300009093 Bacteria 27002
60 Ga0105240_10153446 3300009093 Unclassified 2741
61 Ga0105248_10089184 3300009177 Bacteria 3471
62 Ga0105237_10042754 3300009545 Bacteria 4568
63 Ga0123341_1000642 3300009765 Bacteria 22722
64 Ga0123342_1004326 3300009766 Bacteria 21741
65 Ga0123342_1007872 3300009766 Bacteria 13807
66 Ga0105239_10075793 3300010375 Bacteria 3699
67 Ga0157373_10001761 3300013100 Bacteria 16478
68 Ga0157371_10000004 3300013102 Bacteria 512593
69 Ga0157370_10001712 3300013104 Bacteria 27010
70 Ga0157370_10002827 3300013104 Bacteria 20746
71 Ga0157369_10104280 3300013105 Bacteria 3020
72 Ga0182007_10015388 3300015262 Bacteria 2855
73 Ga0214542_1024621 3300021321 Bacteria 3322
74 Ga0209435_100087 3300025206 Bacteria 44093
75 Ga0209436_100022 3300025208 Bacteria 96695
76 Ga0209672_102571 3300025228 Bacteria 4334
77 Ga0209437_100050 3300025233 Bacteria 394010
78 Ga0209437_100205 3300025233 Bacteria 115669
79 Ga0207425_1007957 3300025245 Bacteria 2751
80 Ga0207425_1010208 3300025245 Bacteria 2296
81 Ga0209646_1000285 3300025246 Bacteria 44093
82 Ga0209026_1000347 3300025250 Bacteria 44093
83 Ga0209677_100223 3300025253 Bacteria 40538
84 Ga0209759_1000482 3300025256 Bacteria 44093
85 Ga0209759_1011424 3300025256 Bacteria 2525
86 Ga0209129_1000066 3300025258 Bacteria 226820
87 Ga0209129_1001039 3300025258 Bacteria 16421
88 Ga0209129_1001233 3300025258 Bacteria 14657
89 Ga0209129_1001336 3300025258 Bacteria 13945
90 Ga0209129_1002224 3300025258 Bacteria 9715
91 Ga0209233_1000037 3300025261 Bacteria 554620
92 Ga0209233_1000187 3300025261 Bacteria 133091
93 Ga0209233_1000232 3300025261 Bacteria 96361
94 Ga0209673_1000024 3300025273 Bacteria 409632
95 Ga0209673_1000911 3300025273 Bacteria 37766
96 Ga0209673_1001370 3300025273 Bacteria 23982
97 Ga0209673_1001606 3300025273 Bacteria 19790
98 Ga0209673_1002065 3300025273 Bacteria 15151
99 Ga0209673_1002144 3300025273 Bacteria 14664
100 Ga0209130_1000002 3300025284 Bacteria 722648
101 Ga0209025_1000060 3300025294 Bacteria 305017
102 Ga0209025_1000274 3300025294 Bacteria 119322
103 Ga0209025_1000275 3300025294 Bacteria 119220
104 Ga0209025_1000377 3300025294 Bacteria 92728
105 Ga0209025_1004510 3300025294 Bacteria 12026
106 Ga0209025_1006199 3300025294 Bacteria 9388
107 Ga0209025_1006318 3300025294 Bacteria 9249
108 Ga0209025_1018562 3300025294 Bacteria 3930
109 Ga0209564_1000262 3300025295 Bacteria 112256
110 Ga0209564_1000486 3300025295 Bacteria 66011
111 Ga0209758_1000971 3300025297 Bacteria 38600
112 Ga0209758_1001494 3300025297 Bacteria 27240
113 Ga0209758_1001499 3300025297 Bacteria 27145
114 Ga0209758_1001505 3300025297 Bacteria 27113
115 Ga0209758_1003461 3300025297 Bacteria 14311
116 Ga0209758_1022518 3300025297 Bacteria 2884
117 Ga0209256_1000715 3300025299 Bacteria 44055
118 Ga0209256_1000868 3300025299 Bacteria 37527
119 Ga0209256_1009017 3300025299 Bacteria 4468
120 Ga0209256_1018050 3300025299 Bacteria 2313
121 Ga0207426_1000013 3300025302 Bacteria 721897
122 Ga0207426_1000142 3300025302 Bacteria 194023
123 Ga0207426_1002277 3300025302 Bacteria 12665
124 Ga0209051_1000170 3300025303 Bacteria 119026
125 Ga0209051_1002082 3300025303 Bacteria 15092
126 Ga0209051_1005899 3300025303 Bacteria 7031
127 Ga0209257_1001982 3300025304 Bacteria 22011
128 Ga0207695_10000036 3300025913 Bacteria 477897
129 Ga0207695_10063999 3300025913 Bacteria 3789
130 Ga0207671_10003518 3300025914 Bacteria 15549
131 Ga0209281_1000043 3300027111 Bacteria 341543
132 Ga0209371_1000009 3300027312 Bacteria 963030
133 Ga0209371_1000306 3300027312 Bacteria 54622
134 Ga0209371_1000732 3300027312 Bacteria 27595
135 Ga0209371_1007055 3300027312 Bacteria 4002
136 Ga0209813_10000777 3300027866 Bacteria 7240
137 Ga0268266_10026837 3300028379 Bacteria 4901
138 Ga0307515_10000029 3300028794 Bacteria 365410
139 Ga0307515_10005232 3300028794 Bacteria 26381
140 Ga0268256_1000010 3300030500 Bacteria 963034
141 Ga0268256_1000751 3300030500 Bacteria 23733
142 Ga0268256_1007047 3300030500 Bacteria 4076
143 Ga0316181_1279897 3300030744 Bacteria 6827
144 Ga0265328_10000010 3300031239 Bacteria 163171
145 Ga0265325_10005736 3300031241 Bacteria 7627
146 Ga0307513_10000259 3300031456 Bacteria 76155
147 Ga0307406_10013754 3300031901 Bacteria 4642
148 Ga0307414_10049997 3300032004 Bacteria 2894
149 Ga0307414_10183150 3300032004 Bacteria 1687
150 Ga0316574_0125618 3300035398 Bacteria 1649
151 Ga0373927_0000562 3300035695 Bacteria 28305
152 Ga0373925_0004513 3300037068 Bacteria 10520
153 Ga0395900_0070260 3300037418 Bacteria 3600
154 Ga0395905_0000374 3300037471 Bacteria 63889
155 Ga0395905_0048405 3300037471 Bacteria 3984
156 Ga0395905_0162795 3300037471 Bacteria 2096
157 Ga0436360_0712770 3300039438 Bacteria 1867
158 Ga0436360_1084906 3300039438 Bacteria 3027
159 Ga0439438_021709 3300041405 Bacteria 1788
160 Ga0451835_1212239 3300041492 Bacteria 3432
161 Ga0451845_0300942 3300041501 Bacteria 3486
162 Ga0451851_0260731 3300041507 Bacteria 1883
163 Ga0451853_0782162 3300041512 Bacteria 2442
164 Ga0439462_0018800 3300042015 Bacteria 1796
165 Ga0466966_0017522 3300044684 Bacteria 4732
166 Ga0466970_0002736 3300044765 Bacteria 8522
167 Ga0466959_0042430 3300045049 Bacteria 3355
168 Ga0466967_0041615 3300045976 Bacteria 3964
169 Ga0495638_0000566 3300046460 Bacteria 41838
170 Ga0495638_0020386 3300046460 Bacteria 4381
171 Ga0495638_0022432 3300046460 Bacteria 4145
172 Ga0495638_0088928 3300046460 Bacteria 1864
173 Ga0495605_0002376 3300046474 Bacteria 11684
174 Ga0495583_0012862 3300046506 Bacteria 4706
175 Ga0495606_0003236 3300046507 Bacteria 17503
176 Ga0495606_0014595 3300046507 Bacteria 6114
177 Ga0495606_0017263 3300046507 Bacteria 5466
178 Ga0495606_0037098 3300046507 Bacteria 3312
179 Ga0495610_0004503 3300046512 Bacteria 10267
180 Ga0495610_0014054 3300046512 Bacteria 4725
181 Ga0495620_0018256 3300046515 Bacteria 3476
182 Ga0495620_0034968 3300046515 Bacteria 2265
183 Ga0495631_0005279 3300046518 Bacteria 6788
184 Ga0495632_0003607 3300046519 Bacteria 10888
185 Ga0495632_0010890 3300046519 Bacteria 5345
186 Ga0495632_0031638 3300046519 Bacteria 2732
187 Ga0495643_0004568 3300046522 Bacteria 9640
188 Ga0495643_0016056 3300046522 Bacteria 4407
189 Ga0495648_0011431 3300046524 Bacteria 6688
190 Ga0495654_0013412 3300046530 Bacteria 4387
191 Ga0495609_0024341 3300046538 Bacteria 2778
192 Ga0495633_0011222 3300046558 Bacteria 4844
193 Ga0495668_0014971 3300046616 Bacteria 4538
194 Ga0495625_0016237 3300046660 Bacteria 5864
195 Ga0495625_0046807 3300046660 Bacteria 3119
196 Ga0495661_0036011 3300046665 Bacteria 3102
197 Ga0495588_0001058 3300046674 Bacteria 11943
198 Ga0495624_0124845 3300046690 Bacteria 1580
199 Ga0495671_0060412 3300046692 Bacteria 1871
200 Ga0495600_0025590 3300046809 Bacteria 3803
201 Ga0495660_0022891 3300046810 Bacteria 3565
202 Ga0495604_0023153 3300047317 Bacteria 4957
203 Ga0495672_0039307 3300047320 Bacteria 2877
204 Ga0495681_0007095 3300047470 Bacteria 7229
205 Ga0495686_0002334 3300047472 Bacteria 18121
206 Ga0495686_0013805 3300047472 Bacteria 5595
207 Ga0495686_0029591 3300047472 Bacteria 3562
208 Ga0496102_0024411 3300048905 Bacteria 5374
209 Ga0496103_0016030 3300048906 Bacteria 4470
210 Ga0496106_0002238 3300048909 Bacteria 14427
211 Ga0496116_0021774 3300048919 Bacteria 4824
212 Ga0496117_0000002 3300048920 Bacteria 2483758
213 Ga0496117_0002038 3300048920 Bacteria 26746
214 Ga0496117_0002089 3300048920 Bacteria 26294
215 Ga0496117_0030530 3300048920 Bacteria 4133
216 Ga0496117_0042984 3300048920 Bacteria 3292
217 Ga0496117_0056527 3300048920 Bacteria 2732
218 Ga0496118_0002110 3300048921 Bacteria 27869
219 Ga0496118_0004517 3300048921 Bacteria 16444
220 Ga0496118_0008715 3300048921 Bacteria 10421
221 Ga0496118_0027220 3300048921 Bacteria 4845
222 Ga0496119_0020988 3300048922 Bacteria 4736
223 Ga0496119_0033953 3300048922 Bacteria 3370
224 Ga0496120_0001226 3300048923 Bacteria 32437
225 Ga0496121_0000001 3300048924 Bacteria 1830318
226 Ga0496121_0000426 3300048924 Bacteria 82870
227 Ga0496121_0002514 3300048924 Bacteria 27846
228 Ga0496121_0031495 3300048924 Bacteria 4844
229 Ga0496121_0058863 3300048924 Bacteria 3172
230 Ga0496122_0000001 3300048925 Bacteria 1827766
231 Ga0496122_0000018 3300048925 Bacteria 426350
232 Ga0496122_0000321 3300048925 Bacteria 105353
233 Ga0496122_0058984 3300048925 Bacteria 2836
234 Ga0496122_0063146 3300048925 Bacteria 2705
235 Ga0496123_0000001 3300048926 Bacteria 1831497
236 Ga0496123_0000015 3300048926 Bacteria 426088
237 Ga0496123_0000454 3300048926 Bacteria 72735
238 Ga0496123_0028650 3300048926 Bacteria 4117
239 Ga0496123_0070547 3300048926 Bacteria 2186
240 Ga0496124_0000558 3300048927 Bacteria 63070
241 Ga0496124_0012361 3300048927 Bacteria 8430
242 Ga0496124_0014392 3300048927 Bacteria 7649
243 Ga0496124_0022854 3300048927 Bacteria 5725
244 Ga0496124_0026740 3300048927 Bacteria 5197
245 Ga0496124_0028588 3300048927 Bacteria 4986
246 Ga0496124_0054344 3300048927 Bacteria 3390
247 Ga0496124_0057117 3300048927 Bacteria 3290
248 Ga0496125_0000001 3300048928 Bacteria 1766138
249 Ga0496125_0000628 3300048928 Bacteria 59302
250 Ga0496125_0025877 3300048928 Bacteria 5363
251 Ga0496125_0026712 3300048928 Bacteria 5249
252 Ga0496126_0000378 3300048929 Bacteria 92187
253 Ga0496126_0005535 3300048929 Bacteria 14379
254 Ga0496126_0057711 3300048929 Bacteria 3502
255 Ga0501031_0019357 3300049568 Bacteria 4435
256 Ga0501032_0038251 3300049569 Bacteria 3269
257 Ga0501032_0060051 3300049569 Bacteria 2550
258 Ga0501033_0000260 3300049570 Bacteria 50590
259 Ga0501034_0019971 3300049571 Bacteria 6842
260 Ga0501034_0052053 3300049571 Bacteria 4127
261 Ga0501036_0036914 3300049572 Bacteria 4134
262 Ga0501036_0048460 3300049572 Bacteria 3597
263 Ga0501037_0102731 3300049573 Bacteria 2061
264 Ga0501038_0022763 3300049574 Bacteria 5610
265 Ga0501047_0084993 3300049581 Bacteria 3041
266 Ga0501047_0202152 3300049581 Bacteria 1848
267 Ga0501067_0045965 3300049583 Bacteria 2423
268 Ga0501073_0035757 3300049589 Bacteria 3529
269 Ga0501073_0043669 3300049589 Bacteria 3161
270 Ga0501280_000780 3300049776 Bacteria 6932
271 Ga0501035_0001529 3300049822 Bacteria 23577
272 Ga0501044_0072199 3300049823 Bacteria 3509
273 nmdc:mga03683_26683_c1 3300050489 Bacteria 2281
274 nmdc:mga00v17_47_c1 3300050491 Bacteria 77934
275 nmdc:mga0yw44_22938_c1 3300050492 Bacteria 3509
276 nmdc:mga0yw44_24384_c1 3300050492 Bacteria 3423
277 nmdc:mga0k408_2459_c1 3300050493 Bacteria 9850
278 nmdc:mga06z11_10376_c1 3300050494 Bacteria 3967
279 nmdc:mga04h51_745_c1 3300050495 Bacteria 7521
280 nmdc:mga0sz30_516_c1 3300050516 Bacteria 14413
281 Ga0495601_0061454 3300053077 Bacteria 2385
282 Ga0500578_0004631 3300053086 Bacteria 9578
283 Ga0500578_0009746 3300053086 Bacteria 6239
284 Ga0500560_000072 3300053107 Bacteria 9691
285 Ga0500569_007804 3300053109 Bacteria 2419
286 Ga0500608_009888 3300053122 Bacteria 4072
287 Ga0500618_000203 3300053125 Bacteria 47421
288 Ga0500618_001422 3300053125 Bacteria 10688
289 Ga0500618_001766 3300053125 Bacteria 9153
290 Ga0500658_0000327 3300053134 Bacteria 21066
291 Ga0500561_0000124 3300053137 Bacteria 14851
292 Ga0500568_0001169 3300053139 Bacteria 17543
293 Ga0500568_0003650 3300053139 Bacteria 8471
294 Ga0500590_003223 3300053148 Bacteria 7467
295 Ga0500606_028190 3300053152 Bacteria 1783
296 Ga0500616_0002500 3300053153 Bacteria 15220
297 Ga0500616_0006023 3300053153 Bacteria 8063
298 Ga0500616_0013568 3300053153 Bacteria 4723
299 Ga0500622_0000189 3300053156 Bacteria 65129
300 Ga0500622_0002842 3300053156 Bacteria 12134
301 Ga0500622_0028099 3300053156 Bacteria 2962
302 Ga0500624_000906 3300053157 Bacteria 6256
303 Ga0500633_0003322 3300053160 Bacteria 3492
304 Ga0500634_0050475 3300053161 Bacteria 2240
305 Ga0501082_0058359 3300060353 Bacteria 3325

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2958115193 2958118096 409
2 iso_pu_bacteria 8004703790 8004708999 409
3 3300031239 Ga0265328_10000010 Ga0265328_1000001085 421
4 3300044684 Ga0466966_0017522 Ga0466966_0017522_2471_4003 424
5 3300045049 Ga0466959_0042430 Ga0466959_0042430_309_1841 424
6 3300049581 Ga0501047_0202152 Ga0501047_0202152_439_1830 434
7 3300039438 Ga0436360_0712770 Ga0436360_0712770_299_1744 442
8 3300035398 Ga0316574_0125618 Ga0316574_0125618_111_1592 443
9 3300049570 Ga0501033_0000260 Ga0501033_0000260_2276_3847 443
10 3300049822 Ga0501035_0001529 Ga0501035_0001529_2212_3783 443
11 3300009093 Ga0105240_10153446 Ga0105240_101534462 444
12 3300025913 Ga0207695_10063999 Ga0207695_100639992 444
13 3300039438 Ga0436360_1084906 Ga0436360_1084906_351_1820 445
14 3300048928 Ga0496125_0000628 Ga0496125_0000628_50595_52025 446
15 3300048927 Ga0496124_0000558 Ga0496124_0000558_2610_4085 447
16 3300048929 Ga0496126_0000378 Ga0496126_0000378_43105_44580 447
17 3300031241 Ga0265325_10005736 Ga0265325_100057364 449
18 iso_pu_bacteria 2874102143 2874102949 452
19 3300005563 Ga0068855_100155244 Ga0068855_1001552442 453
20 3300009545 Ga0105237_10042754 Ga0105237_100427543 455
21 3300002773 JGI25152J39213_1002972 JGI25152J39213_10029722 458
22 iso_pu_bacteria 2919119836 2919121887 459
23 3300003187 JGI25151J46595_10001587 JGI25151J46595_100015874 461
24 3300006042 Ga0075368_10000802 Ga0075368_1000080211 461
25 3300013100 Ga0157373_10001761 Ga0157373_100017618 461
26 3300013102 Ga0157371_10000004 Ga0157371_10000004156 461
27 3300013104 Ga0157370_10002827 Ga0157370_100028273 461
28 3300025294 Ga0209025_1000377 Ga0209025_100037754 461
29 3300027866 Ga0209813_10000777 Ga0209813_100007775 461
30 3300048920 Ga0496117_0000002 Ga0496117_0000002_2321668_2323236 461
31 3300048920 Ga0496117_0002038 Ga0496117_0002038_14062_15537 461
32 3300048921 Ga0496118_0004517 Ga0496118_0004517_2444_4012 461
33 3300048923 Ga0496120_0001226 Ga0496120_0001226_11878_13446 461
34 3300048925 Ga0496122_0000001 Ga0496122_0000001_1665675_1667243 461
35 3300048925 Ga0496122_0000321 Ga0496122_0000321_60430_61905 461
36 3300048926 Ga0496123_0000001 Ga0496123_0000001_1669406_1670974 461
37 3300048926 Ga0496123_0000454 Ga0496123_0000454_43444_44919 461
38 3300048927 Ga0496124_0026740 Ga0496124_0026740_1001_2569 461
39 3300050489 nmdc:mga03683_26683_c1 nmdc:mga03683_26683_c1_141_1709 461
40 3300050491 nmdc:mga00v17_47_c1 nmdc:mga00v17_47_c1_41791_43359 461
41 3300050492 nmdc:mga0yw44_24384_c1 nmdc:mga0yw44_24384_c1_780_2348 461
42 3300050495 nmdc:mga04h51_745_c1 nmdc:mga04h51_745_c1_2793_4361 461
43 3300050516 nmdc:mga0sz30_516_c1 nmdc:mga0sz30_516_c1_12614_14182 461
44 3300053137 Ga0500561_0000124 Ga0500561_0000124_9156_10724 461
45 iso_pu_bacteria 2889790730 2889795861 461
46 iso_pu_bacteria 2889914905 2889917762 461
47 3300025228 Ga0209672_102571 Ga0209672_1025716 462
48 3300048929 Ga0496126_0005535 Ga0496126_0005535_10254_11744 462
49 3300046690 Ga0495624_0124845 Ga0495624_0124845_80_1477 463
50 iso_pu_bacteria 2818991272 2819244194 463
51 iso_pu_bacteria 2847686936 2847691892 464
52 iso_pu_bacteria 2854911287 2854913840 464
53 iso_pu_bacteria 2937891427 2937897589 464
54 iso_pu_bacteria 2599185236 2599718729 466
55 iso_pu_bacteria 2838729681 2838731477 466
56 iso_pu_bacteria 2838742623 2838744418 466
57 iso_pu_bacteria 2841851746 2841852958 466
58 iso_pu_bacteria 2842156927 2842160285 466
59 iso_pu_bacteria 2842180545 2842184049 466
60 iso_pu_bacteria 2842243621 2842245900 466
61 iso_pu_bacteria 2842257432 2842260278 466
62 iso_pu_bacteria 2844454524 2844456575 466
63 3300049571 Ga0501034_0052053 Ga0501034_0052053_1643_3190 467
64 3300053125 Ga0500618_001422 Ga0500618_001422_2304_3812 467
65 iso_pu_bacteria 2894817345 2894817398 467
66 3300003578 Ga0006562J51391_1010447 Ga0006562J51391_10104474 468
67 3300053157 Ga0500624_000906 Ga0500624_000906_188_1756 468
68 iso_pu_bacteria 2839993093 2839993997 468
69 iso_pu_bacteria 2904578770 2904579286 468
70 3300025297 Ga0209758_1022518 Ga0209758_10225182 469
71 3300046507 Ga0495606_0014595 Ga0495606_0014595_2062_3486 469
72 3300046512 Ga0495610_0014054 Ga0495610_0014054_1493_2917 469
73 3300046522 Ga0495643_0004568 Ga0495643_0004568_7379_8803 469
74 3300053086 Ga0500578_0004631 Ga0500578_0004631_2481_3905 469
75 3300053152 Ga0500606_028190 Ga0500606_028190_20_1444 469
76 3300053153 Ga0500616_0006023 Ga0500616_0006023_966_2390 469
77 iso_pu_bacteria 2765235802 2765464069 469
78 iso_pu_bacteria 2767802442 2770196758 469
79 iso_pu_bacteria 2996336353 2996336772 469
80 3300035695 Ga0373927_0000562 Ga0373927_0000562_3639_5186 470
81 3300037068 Ga0373925_0004513 Ga0373925_0004513_6951_8498 470
82 3300042015 Ga0439462_0018800 Ga0439462_0018800_17_1444 470
83 iso_pu_bacteria 2837678835 2837681235 470
84 3300005548 Ga0070665_100026253 Ga0070665_1000262532 471
85 iso_pu_bacteria 2511231027 2511389180 471
86 iso_pu_bacteria 2842871566 2842873212 471
87 iso_pu_bacteria 2928521798 2928522142 471
88 iso_pu_bacteria 2954011201 2954014439 471
89 3300003856 Ga0058692_1003512 Ga0058692_10035123 472
90 3300027312 Ga0209371_1000009 Ga0209371_1000009841 472
91 3300027312 Ga0209371_1000732 Ga0209371_100073233 472
92 3300030500 Ga0268256_1000010 Ga0268256_1000010840 472
93 iso_pu_bacteria 2894652903 2894653034 472
94 iso_pu_bacteria 8045864390 8045866145 472
95 3300048925 Ga0496122_0000018 Ga0496122_0000018_262112_263632 473
96 3300048926 Ga0496123_0000015 Ga0496123_0000015_262112_263632 473
97 3300053156 Ga0500622_0000189 Ga0500622_0000189_52341_53903 473
98 iso_pu_bacteria 2657244999 2657682699 473
99 iso_pu_bacteria 2791355253 2793283733 473
100 iso_pu_bacteria 2802429268 2804753921 473
101 iso_pu_bacteria 3002141150 3002142436 473
102 3300003856 Ga0058692_1004751 Ga0058692_10047512 474
103 3300027312 Ga0209371_1007055 Ga0209371_10070554 474
104 3300030500 Ga0268256_1007047 Ga0268256_10070472 474
105 3300048924 Ga0496121_0000426 Ga0496121_0000426_65652_67127 474
106 3300049569 Ga0501032_0060051 Ga0501032_0060051_50_1486 474
107 3300049589 Ga0501073_0035757 Ga0501073_0035757_47_1483 474
108 iso_pu_bacteria 2558860100 2558865239 474
109 iso_pu_bacteria 2775506902 2776272789 474
110 iso_pu_bacteria 2775506904 2776284733 474
111 iso_pu_bacteria 2840764183 2840769564 474
112 iso_pu_bacteria 2585427590 2585823860 475
113 iso_pu_bacteria 8054558443 8054558747 475
114 3300046460 Ga0495638_0022432 Ga0495638_0022432_659_2233 476
115 iso_pu_bacteria 2643221558 2643812532 476
116 iso_pu_bacteria 2989771324 2989774557 476
117 3300021321 Ga0214542_1024621 Ga0214542_10246213 477
118 iso_pu_bacteria 2757320392 2757570116 477
119 iso_pu_bacteria 2891373044 2891374808 477
120 iso_pu_bacteria 2989349275 2989351982 477
121 3300006946 Ga0079104_1000972 Ga0079104_100097215 478
122 iso_pu_bacteria 2821123053 2821123244 479
123 iso_pu_bacteria 2838736955 2838739733 479
124 iso_pu_bacteria 2841840854 2841844143 479
125 iso_pu_bacteria 2842140634 2842143864 479
126 iso_pu_bacteria 2854896431 2854900845 479
127 iso_pu_bacteria 2857531043 2857533804 479
128 iso_pu_bacteria 2929138655 2929138660 479
129 iso_pu_bacteria 8056875544 8056878665 479
130 3300031901 Ga0307406_10013754 Ga0307406_100137545 480
131 iso_pu_bacteria 2841846520 2841846681 480
132 iso_pu_bacteria 2841859092 2841860789 480
133 iso_pu_bacteria 2842124991 2842127290 480
134 iso_pu_bacteria 2842515876 2842517574 480
135 iso_pu_bacteria 2899845264 2899845766 480
136 iso_pu_bacteria 2926760298 2926761844 480
137 iso_pu_bacteria 8005246636 8005247899 480
138 3300032004 Ga0307414_10183150 Ga0307414_101831502 481
139 3300049568 Ga0501031_0019357 Ga0501031_0019357_649_2124 481
140 3300049569 Ga0501032_0038251 Ga0501032_0038251_1492_2967 481
141 3300049572 Ga0501036_0048460 Ga0501036_0048460_1636_3111 481
142 3300049573 Ga0501037_0102731 Ga0501037_0102731_306_1781 481
143 3300049823 Ga0501044_0072199 Ga0501044_0072199_1311_2786 481
144 iso_pu_bacteria 2818991461 2819685835 481
145 3300037471 Ga0395905_0048405 Ga0395905_0048405_193_1776 482
146 3300003856 Ga0058692_1002467 Ga0058692_10024674 483
147 3300005548 Ga0070665_100023549 Ga0070665_1000235493 483
148 3300006946 Ga0079104_1000082 Ga0079104_1000082109 483
149 3300006948 Ga0099826_10000075 Ga0099826_1000007514 483
150 3300025294 Ga0209025_1000060 Ga0209025_100006044 483
151 3300027111 Ga0209281_1000043 Ga0209281_1000043105 483
152 3300027312 Ga0209371_1000306 Ga0209371_100030642 483
153 3300030500 Ga0268256_1000751 Ga0268256_100075115 483
154 3300030744 Ga0316181_1279897 Ga0316181_12798979 483
155 3300037418 Ga0395900_0070260 Ga0395900_0070260_1936_3477 483
156 3300037471 Ga0395905_0000374 Ga0395905_0000374_37406_38962 483
157 3300037471 Ga0395905_0162795 Ga0395905_0162795_255_1838 483
158 3300046519 Ga0495632_0010890 Ga0495632_0010890_1286_2797 483
159 3300046674 Ga0495588_0001058 Ga0495588_0001058_3427_5010 483
160 3300046692 Ga0495671_0060412 Ga0495671_0060412_66_1649 483
161 3300047470 Ga0495681_0007095 Ga0495681_0007095_4461_6044 483
162 3300048920 Ga0496117_0030530 Ga0496117_0030530_2440_4017 483
163 3300048924 Ga0496121_0000001 Ga0496121_0000001_91898_93475 483
164 3300048927 Ga0496124_0012361 Ga0496124_0012361_5621_7198 483
165 3300048927 Ga0496124_0014392 Ga0496124_0014392_5375_6856 483
166 3300048928 Ga0496125_0000001 Ga0496125_0000001_205353_206930 483
167 3300048928 Ga0496125_0025877 Ga0496125_0025877_2991_4559 483
168 3300050494 nmdc:mga06z11_10376_c1 nmdc:mga06z11_10376_c1_1170_2753 483
169 3300053107 Ga0500560_000072 Ga0500560_000072_2896_4464 483
170 3300053125 Ga0500618_000203 Ga0500618_000203_24493_25977 483
171 iso_pu_bacteria 2537561587 2537877358 483
172 iso_pu_bacteria 2554235003 2554246255 483
173 iso_pu_bacteria 2558860242 2559293477 483
174 iso_pu_bacteria 2599185210 2599604359 483
175 iso_pu_bacteria 2600255279 2601609504 483
176 iso_pu_bacteria 2600255308 2601746279 483
177 iso_pu_bacteria 2643221582 2643920635 483
178 iso_pu_bacteria 2643221693 2644519556 483
179 iso_pu_bacteria 2808606387 2808986752 483
180 iso_pu_bacteria 2818991439 2819556826 483
181 iso_pu_bacteria 2838675328 2838677561 483
182 iso_pu_bacteria 2838714209 2838716450 483
183 iso_pu_bacteria 2838719591 2838719750 483
184 iso_pu_bacteria 2838724970 2838727201 483
185 iso_pu_bacteria 2842130223 2842132454 483
186 iso_pu_bacteria 2842152218 2842152377 483
187 iso_pu_bacteria 2842170452 2842172695 483
188 iso_pu_bacteria 2842175837 2842175996 483
189 iso_pu_bacteria 2842187318 2842189557 483
190 iso_pu_bacteria 2842211629 2842213871 483
191 iso_pu_bacteria 2842224351 2842224511 483
192 iso_pu_bacteria 2899792073 2899794383 483
193 iso_pu_bacteria 2919114240 2919116667 483
194 iso_pu_bacteria 2926754445 2926754676 483
195 iso_pu_bacteria 2933006813 2933007024 483
196 iso_pu_bacteria 2933011516 2933015385 483
197 iso_pu_bacteria 2933594066 2933594226 483
198 iso_pu_bacteria 2979089926 2979092890 483
199 iso_pu_bacteria 2979095461 2979099721 483
200 iso_pu_bacteria 2979100975 2979104859 483
201 iso_pu_bacteria 2984509177 2984513341 483
202 iso_pu_bacteria 2984518228 2984520290 483
203 iso_pu_bacteria 2984537506 2984539588 483
204 iso_pu_bacteria 2984601300 2984601814 483
205 iso_pu_bacteria 650716007 650738714 483
206 iso_pu_bacteria 8003570095 8003572261 483
207 3300028794 Ga0307515_10000029 Ga0307515_10000029125 484
208 3300031456 Ga0307513_10000259 Ga0307513_1000025930 484
209 3300046460 Ga0495638_0020386 Ga0495638_0020386_1959_3542 484
210 3300046558 Ga0495633_0011222 Ga0495633_0011222_429_2000 484
211 3300048921 Ga0496118_0027220 Ga0496118_0027220_1724_3298 484
212 3300049776 Ga0501280_000780 Ga0501280_000780_5352_6899 484
213 3300053161 Ga0500634_0050475 Ga0500634_0050475_153_1724 484
214 iso_pu_bacteria 2513237146 2513924157 484
215 iso_pu_bacteria 2599185170 2599419888 484
216 iso_pu_bacteria 2838035591 2838039581 484
217 iso_pu_bacteria 8054460903 8054461033 484
218 3300032004 Ga0307414_10049997 Ga0307414_100499972 485
219 3300053122 Ga0500608_009888 Ga0500608_009888_2326_3903 485
220 3300046507 Ga0495606_0017263 Ga0495606_0017263_2619_4124 486
221 iso_pu_bacteria 2534681796 2535514561 488
222 iso_pu_bacteria 2718217882 2719183345 489
223 iso_pu_bacteria 2718218009 2719734062 489
224 iso_pu_bacteria 2718218363 2721149457 489
225 iso_pu_bacteria 2718218365 2721160860 489
226 iso_pu_bacteria 2718218366 2721166294 489
227 iso_pu_bacteria 2721755514 2722842464 489
228 iso_pu_bacteria 2721755810 2724046818 489
229 iso_pu_bacteria 2728369365 2730166580 489
230 iso_pu_bacteria 2728369397 2730300492 489
231 iso_pu_bacteria 2791355260 2793323470 489
232 iso_pu_bacteria 2791355261 2793327584 489
233 iso_pu_bacteria 2791355264 2793350274 489
234 iso_pu_bacteria 2838022645 2838026858 489
235 iso_pu_bacteria 2842198810 2842202425 489
236 iso_pu_bacteria 8005301065 8005305492 489
237 iso_pu_bacteria 8005382845 8005384095 489
238 iso_pu_bacteria 8005395548 8005399627 489
239 iso_pu_bacteria 8005688590 8005692755 489
240 3300002773 JGI25152J39213_1001974 JGI25152J39213_10019743 490
241 3300003354 JGI25160J50197_1020065 JGI25160J50197_10200652 490
242 3300005347 Ga0070668_100039769 Ga0070668_1000397692 490
243 3300006178 Ga0075367_10055384 Ga0075367_100553842 490
244 3300009177 Ga0105248_10089184 Ga0105248_100891843 490
245 3300025273 Ga0209673_1002144 Ga0209673_10021442 490
246 3300025302 Ga0207426_1002277 Ga0207426_100227711 490
247 3300049571 Ga0501034_0019971 Ga0501034_0019971_997_2484 490
248 3300049572 Ga0501036_0036914 Ga0501036_0036914_1283_2770 490
249 3300049574 Ga0501038_0022763 Ga0501038_0022763_1626_3113 490
250 3300049581 Ga0501047_0084993 Ga0501047_0084993_364_1851 490
251 3300049589 Ga0501073_0043669 Ga0501073_0043669_1240_2727 490
252 iso_pu_bacteria 2509276033 2509444571 490
253 iso_pu_bacteria 2510065019 2510135682 490
254 iso_pu_bacteria 2510461076 2510897155 490
255 iso_pu_bacteria 2513237084 2513570843 490
256 iso_pu_bacteria 2513237085 2513574942 490
257 iso_pu_bacteria 2513237093 2513633726 490
258 iso_pu_bacteria 2513237103 2513707573 490
259 iso_pu_bacteria 2513237162 2514024102 490
260 iso_pu_bacteria 2515075009 2515114846 490
261 iso_pu_bacteria 2515154113 2515635797 490
262 iso_pu_bacteria 2515154114 2515641411 490
263 iso_pu_bacteria 2515154116 2515659300 490
264 iso_pu_bacteria 2515154134 2515741169 490
265 iso_pu_bacteria 2516653077 2517038465 490
266 iso_pu_bacteria 2516653085 2517078740 490
267 iso_pu_bacteria 2517093000 2517097482 490
268 iso_pu_bacteria 2517287029 2517408938 490
269 iso_pu_bacteria 2519899620 2520379168 490
270 iso_pu_bacteria 2529292951 2530648331 490
271 iso_pu_bacteria 2585427526 2585523945 490
272 iso_pu_bacteria 2585427528 2585542089 490
273 iso_pu_bacteria 2585427593 2585840701 490
274 iso_pu_bacteria 2615840624 2616293948 490
275 iso_pu_bacteria 2718217927 2719388105 490
276 iso_pu_bacteria 2718217997 2719667728 490
277 iso_pu_bacteria 2718218199 2720494148 490
278 iso_pu_bacteria 2718218232 2720615611 490
279 iso_pu_bacteria 2718218233 2720622394 490
280 iso_pu_bacteria 2718218235 2720633748 490
281 iso_pu_bacteria 2718218269 2720777448 490
282 iso_pu_bacteria 2718218423 2721401738 490
283 iso_pu_bacteria 2721755556 2723029045 490
284 iso_pu_bacteria 2721755684 2723562662 490
285 iso_pu_bacteria 2721755685 2723569355 490
286 iso_pu_bacteria 2721755809 2724040552 490
287 iso_pu_bacteria 2721755819 2724092055 490
288 iso_pu_bacteria 2721755822 2724106620 490
289 iso_pu_bacteria 2721755823 2724112428 490
290 iso_pu_bacteria 2724679232 2725949654 490
291 iso_pu_bacteria 2728369352 2730109981 490
292 iso_pu_bacteria 2738541333 2739037338 490
293 iso_pu_bacteria 2765235942 2766067148 490
294 iso_pu_bacteria 2791355256 2793298473 490
295 iso_pu_bacteria 2791355259 2793315687 490
296 iso_pu_bacteria 2791355262 2793335655 490
297 iso_pu_bacteria 2791355263 2793341049 490
298 iso_pu_bacteria 2791355265 2793354785 490
299 iso_pu_bacteria 2791355266 2793358518 490
300 iso_pu_bacteria 2802429605 2805928894 490
301 iso_pu_bacteria 2802429606 2805934515 490
302 iso_pu_bacteria 2802429633 2806047065 490
303 iso_pu_bacteria 2802429634 2806054936 490
304 iso_pu_bacteria 2802429635 2806061836 490
305 iso_pu_bacteria 2802429636 2806069641 490
306 iso_pu_bacteria 2802429637 2806075988 490
307 iso_pu_bacteria 2838016132 2838020955 490
308 iso_pu_bacteria 2838042994 2838044843 490
309 iso_pu_bacteria 2838048938 2838052896 490
310 iso_pu_bacteria 2838061910 2838064689 490
311 iso_pu_bacteria 2838068647 2838070534 490
312 iso_pu_bacteria 2838668709 2838672518 490
313 iso_pu_bacteria 2838680041 2838685597 490
314 iso_pu_bacteria 2838686498 2838689827 490
315 iso_pu_bacteria 2838694306 2838695947 490
316 iso_pu_bacteria 2838701080 2838705159 490
317 iso_pu_bacteria 2838707686 2838713346 490
318 iso_pu_bacteria 2841864319 2841869110 490
319 iso_pu_bacteria 2842077413 2842082580 490
320 iso_pu_bacteria 2842110456 2842112735 490
321 iso_pu_bacteria 2842118031 2842123861 490
322 iso_pu_bacteria 2842146304 2842150153 490
323 iso_pu_bacteria 2842163707 2842165737 490
324 iso_pu_bacteria 2842192696 2842196351 490
325 iso_pu_bacteria 2842205361 2842208924 490
326 iso_pu_bacteria 2842217011 2842219413 490
327 iso_pu_bacteria 2842229732 2842231631 490
328 iso_pu_bacteria 2842237096 2842242916 490
329 iso_pu_bacteria 2842250916 2842254839 490
330 iso_pu_bacteria 2842264693 2842267166 490
331 iso_pu_bacteria 2842271015 2842273689 490
332 iso_pu_bacteria 2842278818 2842282386 490
333 iso_pu_bacteria 2842285085 2842290073 490
334 iso_pu_bacteria 2842291075 2842296989 490
335 iso_pu_bacteria 2842304105 2842308459 490
336 iso_pu_bacteria 2842311132 2842312237 490
337 iso_pu_bacteria 2842317721 2842321831 490
338 iso_pu_bacteria 2842341865 2842344643 490
339 iso_pu_bacteria 2842363717 2842367782 490
340 iso_pu_bacteria 2842370503 2842376017 490
341 iso_pu_bacteria 2842377471 2842383227 490
342 iso_pu_bacteria 2842384541 2842390360 490
343 iso_pu_bacteria 2842395702 2842397828 490
344 iso_pu_bacteria 2842402390 2842407683 490
345 iso_pu_bacteria 2842409023 2842414314 490
346 iso_pu_bacteria 2842415677 2842420826 490
347 iso_pu_bacteria 2842422224 2842424148 490
348 iso_pu_bacteria 2842428310 2842431138 490
349 iso_pu_bacteria 2842434925 2842437473 490
350 iso_pu_bacteria 2842441272 2842444288 490
351 iso_pu_bacteria 2842447887 2842451285 490
352 iso_pu_bacteria 2842462802 2842465281 490
353 iso_pu_bacteria 2842469257 2842472250 490
354 iso_pu_bacteria 2842489311 2842494121 490
355 iso_pu_bacteria 2842495871 2842501234 490
356 iso_pu_bacteria 2857516855 2857520871 490
357 iso_pu_bacteria 2933570622 2933574908 490
358 iso_pu_bacteria 2933586486 2933588376 490
359 iso_pu_bacteria 2933599457 2933601339 490
360 iso_pu_bacteria 2935894831 2935899965 490
361 iso_pu_bacteria 2935901341 2935902338 490
362 iso_pu_bacteria 2936367885 2936369528 490
363 iso_pu_bacteria 2936375103 2936380269 490
364 iso_pu_bacteria 2936381700 2936385274 490
365 iso_pu_bacteria 2996893221 2996897612 490
366 iso_pu_bacteria 8005275841 8005278307 490
367 iso_pu_bacteria 8005282627 8005282659 490
368 iso_pu_bacteria 8005289223 8005291635 490
369 iso_pu_bacteria 8005307578 8005310268 490
370 iso_pu_bacteria 8005376324 8005378085 490
371 iso_pu_bacteria 8005430974 8005433780 490
372 iso_pu_bacteria 8005460587 8005465542 490
373 iso_pu_bacteria 8005497431 8005498125 490
374 iso_pu_bacteria 8005556819 8005559992 490
375 iso_pu_bacteria 8005563573 8005564513 490
376 iso_pu_bacteria 8005570704 8005571200 490
377 iso_pu_bacteria 8005619151 8005619334 490
378 iso_pu_bacteria 8005626139 8005627899 490
379 iso_pu_bacteria 8005668836 8005669533 490
380 iso_pu_bacteria 8005695170 8005701444 490
381 iso_pu_bacteria 8018127388 8018132550 490
382 iso_pu_bacteria 8018163183 8018167590 490
383 iso_pu_bacteria 8018176218 8018176603 490
384 iso_pu_bacteria 8023680758 8023681255 490
385 iso_pu_bacteria 8024479707 8024481914 490
386 iso_pu_bacteria 8024501048 8024506350 490
387 iso_pu_bacteria 8056382006 8056382666 490
388 iso_pu_bacteria 8057874678 8057878684 490
389 iso_pu_bacteria 2582581299 2585230962 491
390 iso_pu_bacteria 2643221599 2644004404 491
391 iso_pu_bacteria 3005452660 3005456319 491
392 3300003792 Ga0055540_1011371 Ga0055540_10113713 492
393 3300025303 Ga0209051_1005899 Ga0209051_10058995 492
394 iso_pu_bacteria 2509276021 2509388981 492
395 iso_pu_bacteria 2510917028 2511185310 492
396 iso_pu_bacteria 2513237138 2513865346 492
397 iso_pu_bacteria 2513237144 2513911011 492
398 iso_pu_bacteria 2513237146 2513924319 492
399 iso_pu_bacteria 2582581294 2585201297 492
400 iso_pu_bacteria 2582581867 2585399116 492
401 iso_pu_bacteria 2585427590 2585818734 492
402 iso_pu_bacteria 2599185170 2599419723 492
403 iso_pu_bacteria 2791355267 2793368970 492
404 iso_pu_bacteria 2838035591 2838039744 492
405 iso_pu_bacteria 2838661181 2838664022 492
406 iso_pu_bacteria 2919100787 2919101849 492
407 iso_pu_bacteria 2923556063 2923556165 492
408 iso_pu_bacteria 2996887358 2996887952 492
409 iso_pu_bacteria 3005409236 3005410648 492
410 iso_pu_bacteria 639633055 639646081 492
411 iso_pu_bacteria 8005258706 8005261482 492
412 iso_pu_bacteria 8005321885 8005322479 492
413 iso_pu_bacteria 8005542996 8005543218 492
414 iso_pu_bacteria 8024486573 8024488578 492
415 iso_pu_bacteria 8056375014 8056381173 492
416 3300003322 rootL2_10268344 rootL2_102683442 493
417 3300049583 Ga0501067_0045965 Ga0501067_0045965_364_1863 493
418 3300053125 Ga0500618_001766 Ga0500618_001766_2655_4190 493
419 3300060353 Ga0501082_0058359 Ga0501082_0058359_498_1997 493
420 iso_pu_bacteria 2510917022 2511136844 493
421 iso_pu_bacteria 2582581304 2585256437 493
422 iso_pu_bacteria 2582581307 2585273471 493
423 iso_pu_bacteria 2582581315 2585328188 493
424 iso_pu_bacteria 2585427531 2585564000 493
425 iso_pu_bacteria 2585427608 2585900331 493
426 iso_pu_bacteria 2585427609 2585909292 493
427 iso_pu_bacteria 2585428125 2587984606 493
428 iso_pu_bacteria 2615840626 2616311174 493
429 iso_pu_bacteria 2842509118 2842514516 493
430 iso_pu_bacteria 8005682033 8005687444 493
431 3300003187 JGI25151J46595_10000660 JGI25151J46595_1000066017 494
432 3300003215 JGI25153J46596_10007891 JGI25153J46596_100078914 494
433 3300003215 JGI25153J46596_10007897 JGI25153J46596_100078974 494
434 3300003354 JGI25160J50197_1004876 JGI25160J50197_10048768 494
435 3300003771 Ga0055526_1004162 Ga0055526_10041624 494
436 3300003771 Ga0055526_1005073 Ga0055526_10050734 494
437 3300003775 Ga0055524_1014723 Ga0055524_10147232 494
438 3300003790 Ga0055528_1001190 Ga0055528_100119017 494
439 3300003792 Ga0055540_1000959 Ga0055540_10009594 494
440 3300004625 Ga0055543_1001119 Ga0055543_100111911 494
441 3300005262 Ga0065165_1030265 Ga0065165_10302652 494
442 3300006038 Ga0075365_10035357 Ga0075365_100353572 494
443 3300006048 Ga0075363_100068266 Ga0075363_1000682662 494
444 3300006177 Ga0075362_10019480 Ga0075362_100194803 494
445 3300006195 Ga0075366_10001209 Ga0075366_100012094 494
446 3300006353 Ga0075370_10009887 Ga0075370_100098872 494
447 3300009765 Ga0123341_1000642 Ga0123341_100064218 494
448 3300009766 Ga0123342_1007872 Ga0123342_100787212 494
449 3300025245 Ga0207425_1010208 Ga0207425_10102082 494
450 3300025258 Ga0209129_1001039 Ga0209129_10010396 494
451 3300025273 Ga0209673_1000911 Ga0209673_100091121 494
452 3300025273 Ga0209673_1001370 Ga0209673_100137020 494
453 3300025273 Ga0209673_1001606 Ga0209673_10016062 494
454 3300025273 Ga0209673_1002065 Ga0209673_100206515 494
455 3300025294 Ga0209025_1000274 Ga0209025_100027420 494
456 3300025295 Ga0209564_1000486 Ga0209564_10004863 494
457 3300025297 Ga0209758_1000971 Ga0209758_100097119 494
458 3300025297 Ga0209758_1001494 Ga0209758_100149413 494
459 3300025299 Ga0209256_1000715 Ga0209256_100071513 494
460 3300025299 Ga0209256_1009017 Ga0209256_10090173 494
461 3300025299 Ga0209256_1018050 Ga0209256_10180502 494
462 3300025302 Ga0207426_1000142 Ga0207426_100014298 494
463 3300025303 Ga0209051_1000170 Ga0209051_100017099 494
464 3300025304 Ga0209257_1001982 Ga0209257_100198218 494
465 3300028794 Ga0307515_10005232 Ga0307515_1000523222 494
466 3300041405 Ga0439438_021709 Ga0439438_021709_181_1680 494
467 3300041492 Ga0451835_1212239 Ga0451835_1212239_37_1536 494
468 3300041501 Ga0451845_0300942 Ga0451845_0300942_1160_2659 494
469 3300041507 Ga0451851_0260731 Ga0451851_0260731_32_1531 494
470 3300041512 Ga0451853_0782162 Ga0451853_0782162_158_1657 494
471 3300046460 Ga0495638_0088928 Ga0495638_0088928_234_1733 494
472 3300046507 Ga0495606_0037098 Ga0495606_0037098_1393_2892 494
473 3300046512 Ga0495610_0004503 Ga0495610_0004503_3203_4702 494
474 3300046515 Ga0495620_0018256 Ga0495620_0018256_37_1536 494
475 3300046515 Ga0495620_0034968 Ga0495620_0034968_474_1973 494
476 3300046519 Ga0495632_0031638 Ga0495632_0031638_98_1597 494
477 3300046524 Ga0495648_0011431 Ga0495648_0011431_2944_4443 494
478 3300046530 Ga0495654_0013412 Ga0495654_0013412_1628_3127 494
479 3300046616 Ga0495668_0014971 Ga0495668_0014971_2901_4400 494
480 3300046660 Ga0495625_0016237 Ga0495625_0016237_2782_4281 494
481 3300046665 Ga0495661_0036011 Ga0495661_0036011_1577_3076 494
482 3300046810 Ga0495660_0022891 Ga0495660_0022891_817_2316 494
483 3300047472 Ga0495686_0013805 Ga0495686_0013805_2658_4157 494
484 3300047472 Ga0495686_0029591 Ga0495686_0029591_971_2470 494
485 3300048920 Ga0496117_0042984 Ga0496117_0042984_315_1814 494
486 3300048921 Ga0496118_0008715 Ga0496118_0008715_7337_8836 494
487 3300050492 nmdc:mga0yw44_22938_c1 nmdc:mga0yw44_22938_c1_637_2136 494
488 3300050493 nmdc:mga0k408_2459_c1 nmdc:mga0k408_2459_c1_1836_3335 494
489 3300053086 Ga0500578_0009746 Ga0500578_0009746_2680_4179 494
490 3300053134 Ga0500658_0000327 Ga0500658_0000327_6485_7984 494
491 3300053153 Ga0500616_0013568 Ga0500616_0013568_1393_2892 494
492 3300053156 Ga0500622_0028099 Ga0500622_0028099_1374_2873 494
493 iso_pu_bacteria 2510917030 2511200508 494
494 iso_pu_bacteria 2582581298 2585223272 494
495 iso_pu_bacteria 2585427529 2585546132 494
496 iso_pu_bacteria 3005445848 3005450109 494
497 3300046506 Ga0495583_0012862 Ga0495583_0012862_81_1589 495
498 iso_pu_bacteria 2582581308 2585283565 495
499 iso_pu_bacteria 2585427527 2585536031 495
500 iso_pu_bacteria 2585427530 2585556641 495
501 iso_pu_bacteria 2615840698 2616556092 495
502 iso_pu_bacteria 2667528174 2671115822 495
503 iso_pu_bacteria 2818991448 2819608866 495
504 iso_pu_bacteria 2818991453 2819643292 495
505 iso_pu_bacteria 2838029111 2838033968 495
506 iso_pu_bacteria 2842475841 2842480714 495
507 iso_pu_bacteria 2842502639 2842507243 495
508 iso_pu_bacteria 2919408235 2919408341 495
509 iso_pu_bacteria 3005416602 3005423284 495
510 iso_pu_bacteria 8005314921 8005315611 495
511 iso_pu_bacteria 8005484373 8005484480 495
512 iso_pu_bacteria 8005645114 8005647401 495
513 3300002987 JGI25159J45721_1002611 JGI25159J45721_10026114 496
514 3300003215 JGI25153J46596_10006110 JGI25153J46596_100061103 496
515 3300003215 JGI25153J46596_10011445 JGI25153J46596_100114452 496
516 3300003215 JGI25153J46596_10011453 JGI25153J46596_100114532 496
517 3300003374 JGI25161J50226_1000078 JGI25161J50226_100007850 496
518 3300003771 Ga0055526_1003112 Ga0055526_100311210 496
519 3300003775 Ga0055524_1006263 Ga0055524_10062632 496
520 3300003790 Ga0055528_1000113 Ga0055528_100011361 496
521 3300005262 Ga0065165_1010070 Ga0065165_10100703 496
522 3300006048 Ga0075363_100027191 Ga0075363_1000271913 496
523 3300006186 Ga0075369_10002838 Ga0075369_100028382 496
524 3300009766 Ga0123342_1004326 Ga0123342_10043268 496
525 3300025208 Ga0209436_100022 Ga0209436_10002290 496
526 3300025245 Ga0207425_1007957 Ga0207425_10079572 496
527 3300025258 Ga0209129_1000066 Ga0209129_1000066150 496
528 3300025258 Ga0209129_1001233 Ga0209129_10012332 496
529 3300025258 Ga0209129_1001336 Ga0209129_10013364 496
530 3300025258 Ga0209129_1002224 Ga0209129_10022244 496
531 3300025273 Ga0209673_1000024 Ga0209673_1000024114 496
532 3300025284 Ga0209130_1000002 Ga0209130_1000002573 496
533 3300025294 Ga0209025_1000275 Ga0209025_100027553 496
534 3300025294 Ga0209025_1004510 Ga0209025_10045105 496
535 3300025294 Ga0209025_1006199 Ga0209025_100619910 496
536 3300025294 Ga0209025_1006318 Ga0209025_10063187 496
537 3300025294 Ga0209025_1018562 Ga0209025_10185624 496
538 3300025295 Ga0209564_1000262 Ga0209564_100026270 496
539 3300025297 Ga0209758_1001499 Ga0209758_10014994 496
540 3300025297 Ga0209758_1001505 Ga0209758_10015054 496
541 3300025297 Ga0209758_1003461 Ga0209758_10034619 496
542 3300025299 Ga0209256_1000868 Ga0209256_100086829 496
543 3300025302 Ga0207426_1000013 Ga0207426_1000013573 496
544 3300025303 Ga0209051_1002082 Ga0209051_100208217 496
545 3300046460 Ga0495638_0000566 Ga0495638_0000566_13452_14957 496
546 3300046474 Ga0495605_0002376 Ga0495605_0002376_2502_4007 496
547 3300046507 Ga0495606_0003236 Ga0495606_0003236_2437_3951 496
548 3300046518 Ga0495631_0005279 Ga0495631_0005279_949_2454 496
549 3300046519 Ga0495632_0003607 Ga0495632_0003607_1452_2957 496
550 3300046522 Ga0495643_0016056 Ga0495643_0016056_386_1897 496
551 3300046538 Ga0495609_0024341 Ga0495609_0024341_37_1542 496
552 3300046660 Ga0495625_0046807 Ga0495625_0046807_1517_3022 496
553 3300046809 Ga0495600_0025590 Ga0495600_0025590_1479_2981 496
554 3300047317 Ga0495604_0023153 Ga0495604_0023153_2082_3584 496
555 3300047320 Ga0495672_0039307 Ga0495672_0039307_1092_2597 496
556 3300047472 Ga0495686_0002334 Ga0495686_0002334_2506_4020 496
557 3300048909 Ga0496106_0002238 Ga0496106_0002238_4756_6267 496
558 3300048920 Ga0496117_0056527 Ga0496117_0056527_759_2270 496
559 3300048924 Ga0496121_0031495 Ga0496121_0031495_2691_4205 496
560 3300048924 Ga0496121_0058863 Ga0496121_0058863_459_1970 496
561 3300048925 Ga0496122_0063146 Ga0496122_0063146_527_2032 496
562 3300048926 Ga0496123_0070547 Ga0496123_0070547_85_1596 496
563 3300048927 Ga0496124_0022854 Ga0496124_0022854_2213_3724 496
564 3300048927 Ga0496124_0028588 Ga0496124_0028588_2402_3907 496
565 3300048927 Ga0496124_0054344 Ga0496124_0054344_1114_2619 496
566 3300053077 Ga0495601_0061454 Ga0495601_0061454_179_1681 496
567 3300053109 Ga0500569_007804 Ga0500569_007804_98_1603 496
568 3300053139 Ga0500568_0001169 Ga0500568_0001169_3189_4694 496
569 3300053139 Ga0500568_0003650 Ga0500568_0003650_1820_3331 496
570 3300053148 Ga0500590_003223 Ga0500590_003223_2765_4267 496
571 3300053153 Ga0500616_0002500 Ga0500616_0002500_7109_8614 496
572 3300053156 Ga0500622_0002842 Ga0500622_0002842_8125_9636 496
573 3300053160 Ga0500633_0003322 Ga0500633_0003322_544_2055 496
574 iso_pu_bacteria 2842482326 2842487242 496
575 3300003323 rootH1_10109211 rootH1_101092112 497
576 3300010375 Ga0105239_10075793 Ga0105239_100757933 497
577 3300025256 Ga0209759_1011424 Ga0209759_10114242 497
578 3300025914 Ga0207671_10003518 Ga0207671_1000351814 497
579 3300044765 Ga0466970_0002736 Ga0466970_0002736_4326_5852 497
580 3300045976 Ga0466967_0041615 Ga0466967_0041615_2394_3920 497
581 3300048919 Ga0496116_0021774 Ga0496116_0021774_1104_2603 497
582 3300048924 Ga0496121_0002514 Ga0496121_0002514_1789_3288 497
583 iso_pu_bacteria 2582581316 2585330599 497
584 3300001979 JGI24740J21852_10000671 JGI24740J21852_1000067115 499
585 3300002704 JGI25155J39150_1000110 JGI25155J39150_100011021 499
586 3300002705 JGI25156J39149_1000192 JGI25156J39149_100019222 499
587 3300002737 JGI25162J39368_1000302 JGI25162J39368_100030225 499
588 3300002737 JGI25162J39368_1000517 JGI25162J39368_10005178 499
589 3300002738 JGI25154J39366_1000196 JGI25154J39366_100019623 499
590 3300002741 JGI25157J39369_1000228 JGI25157J39369_100022823 499
591 3300003214 JGI25165J46597_1000720 JGI25165J46597_10007203 499
592 3300003214 JGI25165J46597_1001110 JGI25165J46597_100111011 499
593 3300003322 rootL2_10018866 rootL2_1001886611 499
594 3300003323 rootH1_10049455 rootH1_100494552 499
595 3300009093 Ga0105240_10002912 Ga0105240_100029123 499
596 3300013104 Ga0157370_10001712 Ga0157370_100017123 499
597 3300013105 Ga0157369_10104280 Ga0157369_101042803 499
598 3300015262 Ga0182007_10015388 Ga0182007_100153882 499
599 3300025206 Ga0209435_100087 Ga0209435_10008723 499
600 3300025233 Ga0209437_100050 Ga0209437_10005091 499
601 3300025233 Ga0209437_100205 Ga0209437_10020593 499
602 3300025246 Ga0209646_1000285 Ga0209646_100028523 499
603 3300025250 Ga0209026_1000347 Ga0209026_100034723 499
604 3300025253 Ga0209677_100223 Ga0209677_10022312 499
605 3300025256 Ga0209759_1000482 Ga0209759_100048223 499
606 3300025261 Ga0209233_1000037 Ga0209233_1000037133 499
607 3300025261 Ga0209233_1000187 Ga0209233_1000187113 499
608 3300025261 Ga0209233_1000232 Ga0209233_100023270 499
609 3300025913 Ga0207695_10000036 Ga0207695_10000036482 499
610 3300028379 Ga0268266_10026837 Ga0268266_100268374 499
611 3300048905 Ga0496102_0024411 Ga0496102_0024411_1120_2625 499
612 3300048906 Ga0496103_0016030 Ga0496103_0016030_534_2039 499
613 3300048920 Ga0496117_0002089 Ga0496117_0002089_24671_26176 499
614 3300048921 Ga0496118_0002110 Ga0496118_0002110_1789_3294 499
615 3300048922 Ga0496119_0020988 Ga0496119_0020988_2101_3606 499
616 3300048922 Ga0496119_0033953 Ga0496119_0033953_989_2488 499
617 3300048925 Ga0496122_0058984 Ga0496122_0058984_1131_2636 499
618 3300048926 Ga0496123_0028650 Ga0496123_0028650_1522_3021 499
619 3300048927 Ga0496124_0057117 Ga0496124_0057117_1251_2750 499
620 3300048928 Ga0496125_0026712 Ga0496125_0026712_2632_4137 499
621 3300048929 Ga0496126_0057711 Ga0496126_0057711_487_1992 499

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13629

T2SS-T3SS_pil_N

Pilus formation protein N terminal region

106

177

0.97

PF00263

Secretin

Bacterial type II and III secretion system protein

348

524

0.9

Feature Viewer

pLDDT pTM Quality
64.07 0.47 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map