F469994

General Info

Members Datasets Scaffolds Average Seq Length
621 281 621 283

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10021184|Ga0157378_100211846
Length 335
Sequence MSHTESRKERFVESPCRTSHWQKAKRSSNLFEVSFETRSDFCLNEPTGSYVKIYNITGYLIILAYLLACMYSAPPHWGPWRGMLIGGAYFILCWFLGGLYLADVLHLGIAHRSLDYKEWFIKTVTMVTNTFAIYVDPIAWVNRHRLHHKHSDHPGDPNKLSDDGFWRTLYLCMMPYQCKENLAGDKILKSRTFRIAASPFFAIPVQIFSFWLLWKLAGSLLFTLVMWVGMRIFALWVNMIQNYWTHTRRFGYRRYHDEDDNAMNIGEWLPVTATFSACLQNNHHHYEGLLRLSHDKSEYDFGFLTVKVMRSLGLVTATRSGAEIPKDIPLDALGF

Samples

Sample ID Description Type Environment
1 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
118 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
119 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
187 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
188 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
189 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
192 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
193 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
194 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
195 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
196 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
197 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
198 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
199 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
200 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
201 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
202 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
203 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
204 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
205 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
206 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
207 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
208 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
211 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
212 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
213 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
214 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
215 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
216 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
217 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
218 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
219 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
220 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
221 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
222 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
223 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
224 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
225 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
226 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
227 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
228 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
229 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
230 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
231 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
232 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
233 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
234 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
235 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
236 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
237 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
238 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
239 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
240 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
241 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
242 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
243 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
244 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
245 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
246 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
247 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
248 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
249 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
250 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
251 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
252 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
253 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
254 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
255 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
256 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
257 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
258 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
259 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
260 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
261 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
262 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
263 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
264 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
265 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
266 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
267 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
268 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
269 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
270 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
271 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
272 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
273 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
274 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
275 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
276 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
277 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
278 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
279 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
280 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
281 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.13
Nodule 0
Rhizoplane 3.06
Rhizosphere 94.85
Stem 0
Stem Tuber 0
Unclassified 0.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10021092 3300001991 Bacteria 1243
2 rootL2_10033750 3300003322 Bacteria 1874
3 rootH1_10031980 3300003323 Bacteria 6285
4 Ga0065712_10069049 3300005290 Bacteria 8163
5 Ga0065715_10024814 3300005293 Bacteria 1916
6 Ga0065715_10036964 3300005293 Bacteria 1240
7 Ga0065715_10112861 3300005293 Bacteria 2513
8 Ga0065715_10113544 3300005293 Unclassified 2485
9 Ga0065715_10143614 3300005293 Bacteria 1818
10 Ga0065715_10194679 3300005293 Unclassified 1395
11 Ga0065707_10000678 3300005295 Bacteria 18643
12 Ga0070658_10303263 3300005327 Unclassified 1362
13 Ga0070676_10022896 3300005328 Bacteria 3506
14 Ga0070676_10027408 3300005328 Bacteria 3231
15 Ga0070676_10324080 3300005328 Bacteria 1052
16 Ga0070683_100011805 3300005329 Bacteria 7566
17 Ga0070683_100023642 3300005329 Bacteria 5498
18 Ga0070690_100042724 3300005330 Bacteria 2871
19 Ga0070690_100072890 3300005330 Bacteria 2234
20 Ga0070690_100107793 3300005330 Unclassified 1855
21 Ga0070670_100481102 3300005331 Bacteria 1103
22 Ga0068869_100009992 3300005334 Bacteria 6170
23 Ga0068869_100030447 3300005334 Bacteria 3788
24 Ga0068869_100304113 3300005334 Unclassified 1289
25 Ga0070666_10056567 3300005335 Bacteria 2649
26 Ga0070666_10187165 3300005335 Bacteria 1454
27 Ga0070680_100049594 3300005336 Bacteria 3423
28 Ga0070680_100059949 3300005336 Bacteria 3114
29 Ga0070682_100010640 3300005337 Bacteria 5227
30 Ga0070682_100089918 3300005337 Unclassified 2006
31 Ga0068868_100001613 3300005338 Bacteria 15382
32 Ga0068868_100055431 3300005338 Bacteria 3127
33 Ga0068868_100061139 3300005338 Bacteria 2984
34 Ga0068868_100080560 3300005338 Bacteria 2610
35 Ga0070660_100008847 3300005339 Bacteria 7058
36 Ga0070660_100030704 3300005339 Bacteria 4032
37 Ga0070689_100035604 3300005340 Bacteria 3804
38 Ga0070691_10060911 3300005341 Bacteria 1815
39 Ga0070661_100017817 3300005344 Bacteria 5041
40 Ga0070661_100020336 3300005344 Bacteria 4733
41 Ga0070661_100058534 3300005344 Unclassified 2824
42 Ga0070668_100003846 3300005347 Bacteria 11082
43 Ga0070669_100003738 3300005353 Bacteria 10994
44 Ga0070669_100016855 3300005353 Bacteria 5215
45 Ga0070669_100091373 3300005353 Unclassified 2283
46 Ga0070675_100007041 3300005354 Bacteria 8647
47 Ga0070675_100081418 3300005354 Bacteria 2700
48 Ga0070675_100384695 3300005354 Bacteria 1249
49 Ga0070675_100601620 3300005354 Unclassified 997
50 Ga0070674_100048435 3300005356 Bacteria 2917
51 Ga0070674_100077800 3300005356 Bacteria 2362
52 Ga0070674_100181528 3300005356 Unclassified 1612
53 Ga0070673_100390299 3300005364 Bacteria 1243
54 Ga0070673_100416796 3300005364 Unclassified 1203
55 Ga0070688_100067514 3300005365 Unclassified 2278
56 Ga0070659_100026695 3300005366 Bacteria 4445
57 Ga0070659_100057244 3300005366 Bacteria 3073
58 Ga0070659_100422016 3300005366 Bacteria 1128
59 Ga0070667_100018774 3300005367 Bacteria 5734
60 Ga0070667_100419494 3300005367 Unclassified 1220
61 Ga0070667_100633567 3300005367 Unclassified 986
62 Ga0070709_10066606 3300005434 Bacteria 2311
63 Ga0070709_10076676 3300005434 Unclassified 2172
64 Ga0070709_10125818 3300005434 Unclassified 1743
65 Ga0070714_100000123 3300005435 Bacteria 61492
66 Ga0070714_100023222 3300005435 Bacteria 5091
67 Ga0070714_100148138 3300005435 Unclassified 2113
68 Ga0070714_100182155 3300005435 Unclassified 1912
69 Ga0070713_100059810 3300005436 Bacteria 3184
70 Ga0070713_100084718 3300005436 Unclassified 2713
71 Ga0070711_100005305 3300005439 Bacteria 7696
72 Ga0070711_100032874 3300005439 Bacteria 3452
73 Ga0070711_100052163 3300005439 Bacteria 2813
74 Ga0070705_100000663 3300005440 Bacteria 19708
75 Ga0070694_100001150 3300005444 Bacteria 15195
76 Ga0070694_100052387 3300005444 Bacteria 2758
77 Ga0070663_100008376 3300005455 Bacteria 6355
78 Ga0070663_100041450 3300005455 Bacteria 3229
79 Ga0070662_100022071 3300005457 Unclassified 4353
80 Ga0070662_100092230 3300005457 Bacteria 2276
81 Ga0070681_10003152 3300005458 Bacteria 15334
82 Ga0068867_100009422 3300005459 Bacteria 6888
83 Ga0068867_100016970 3300005459 Bacteria 5174
84 Ga0068867_100434737 3300005459 Bacteria 1115
85 Ga0070707_100004315 3300005468 Bacteria 13324
86 Ga0070707_100416540 3300005468 Bacteria 1304
87 Ga0070698_100140325 3300005471 Bacteria 2368
88 Ga0070699_100051162 3300005518 Bacteria 3576
89 Ga0070699_100325699 3300005518 Unclassified 1381
90 Ga0070679_100003174 3300005530 Bacteria 15016
91 Ga0070679_100140815 3300005530 Bacteria 2392
92 Ga0070684_100003724 3300005535 Bacteria 11503
93 Ga0070684_100036988 3300005535 Bacteria 4185
94 Ga0070684_100135468 3300005535 Bacteria 2224
95 Ga0070697_100008830 3300005536 Bacteria 7863
96 Ga0070697_100094699 3300005536 Bacteria 2475
97 Ga0068853_100052882 3300005539 Bacteria 3497
98 Ga0068853_100090113 3300005539 Unclassified 2695
99 Ga0068853_100124880 3300005539 Bacteria 2298
100 Ga0070672_100213398 3300005543 Bacteria 1617
101 Ga0070686_100027428 3300005544 Bacteria 3447
102 Ga0070686_100197980 3300005544 Unclassified 1438
103 Ga0070695_100000212 3300005545 Bacteria 28184
104 Ga0070695_100009596 3300005545 Bacteria 5764
105 Ga0070695_100021230 3300005545 Unclassified 3970
106 Ga0070696_100000342 3300005546 Bacteria 28263
107 Ga0070693_100043247 3300005547 Unclassified 2543
108 Ga0070693_100128465 3300005547 Unclassified 1581
109 Ga0070665_100001100 3300005548 Bacteria 33366
110 Ga0070665_100127018 3300005548 Bacteria 2552
111 Ga0070704_100099598 3300005549 Archaea 2186
112 Ga0068855_100022005 3300005563 Bacteria 7645
113 Ga0070664_100000932 3300005564 Bacteria 22876
114 Ga0068857_100000442 3300005577 Bacteria 29452
115 Ga0068857_100001653 3300005577 Bacteria 17904
116 Ga0068857_100352266 3300005577 Bacteria 1363
117 Ga0068854_100001434 3300005578 Bacteria 14427
118 Ga0068854_100058554 3300005578 Bacteria 2781
119 Ga0068856_100000917 3300005614 Bacteria 31559
120 Ga0068856_100003158 3300005614 Bacteria 16799
121 Ga0070702_100018028 3300005615 Bacteria 3654
122 Ga0070702_100056937 3300005615 Unclassified 2260
123 Ga0070702_100094015 3300005615 Bacteria 1824
124 Ga0068852_100026368 3300005616 Bacteria 4722
125 Ga0068852_100115362 3300005616 Bacteria 2449
126 Ga0068859_100000714 3300005617 Bacteria 33489
127 Ga0068859_100093113 3300005617 Bacteria 3065
128 Ga0068864_100033719 3300005618 Bacteria 4353
129 Ga0068864_100050254 3300005618 Bacteria 3588
130 Ga0068864_100452521 3300005618 Bacteria 1228
131 Ga0068866_10007929 3300005718 Bacteria 4458
132 Ga0068866_10019181 3300005718 Bacteria 3107
133 Ga0068866_10023697 3300005718 Bacteria 2858
134 Ga0068861_100163197 3300005719 Bacteria 1840
135 Ga0068851_10186170 3300005834 Bacteria 1152
136 Ga0068863_100014480 3300005841 Bacteria 7595
137 Ga0068863_100052371 3300005841 Bacteria 3869
138 Ga0068863_100077099 3300005841 Bacteria 3154
139 Ga0068858_100002139 3300005842 Bacteria 20024
140 Ga0068858_100059202 3300005842 Bacteria 3540
141 Ga0068858_100129461 3300005842 Bacteria 2365
142 Ga0068858_100189223 3300005842 Bacteria 1945
143 Ga0068860_100003784 3300005843 Bacteria 15568
144 Ga0068860_100014306 3300005843 Bacteria 7780
145 Ga0068860_100014493 3300005843 Bacteria 7717
146 Ga0068860_100124105 3300005843 Bacteria 2475
147 Ga0068862_100017030 3300005844 Bacteria 6046
148 Ga0068862_100052116 3300005844 Bacteria 3500
149 Ga0068862_100052753 3300005844 Bacteria 3480
150 Ga0068862_100053056 3300005844 Bacteria 3470
151 Ga0068862_100307964 3300005844 Archaea 1459
152 Ga0068862_100331722 3300005844 Unclassified 1407
153 Ga0070717_10117584 3300006028 Bacteria 2274
154 Ga0070717_10201162 3300006028 Unclassified 1745
155 Ga0070715_10053962 3300006163 Bacteria 1739
156 Ga0070716_100007249 3300006173 Bacteria 5453
157 Ga0070716_100024242 3300006173 Bacteria 3228
158 Ga0070716_100044487 3300006173 Bacteria 2488
159 Ga0070716_100083268 3300006173 Unclassified 1915
160 Ga0070716_100214092 3300006173 Unclassified 1290
161 Ga0070712_100002091 3300006175 Bacteria 12260
162 Ga0070712_100010248 3300006175 Bacteria 5909
163 Ga0070712_100062998 3300006175 Bacteria 2624
164 Ga0075362_10000228 3300006177 Bacteria 15674
165 Ga0075362_10102924 3300006177 Unclassified 1337
166 Ga0075367_10005874 3300006178 Bacteria 6152
167 Ga0075366_10003831 3300006195 Bacteria 8010
168 Ga0075366_10145880 3300006195 Bacteria 1432
169 Ga0097621_100004225 3300006237 Bacteria 9974
170 Ga0097621_100038748 3300006237 Bacteria 3825
171 Ga0097621_100061936 3300006237 Unclassified 3070
172 Ga0097621_100203119 3300006237 Unclassified 1721
173 Ga0097621_100297113 3300006237 Bacteria 1426
174 Ga0068871_100004186 3300006358 Bacteria 9991
175 Ga0068871_100017036 3300006358 Bacteria 5488
176 Ga0068871_100033688 3300006358 Bacteria 4058
177 Ga0068871_100036145 3300006358 Bacteria 3931
178 Ga0068871_100090402 3300006358 Bacteria 2550
179 Ga0068871_100151462 3300006358 Unclassified 1978
180 Ga0068871_100170941 3300006358 Unclassified 1863
181 Ga0075428_100008493 3300006844 Bacteria 11393
182 Ga0075428_100138746 3300006844 Bacteria 2643
183 Ga0075428_100243538 3300006844 Bacteria 1940
184 Ga0075430_100018752 3300006846 Bacteria 5888
185 Ga0075433_10122648 3300006852 Bacteria 2308
186 Ga0075433_10220768 3300006852 Bacteria 1684
187 Ga0075434_100001290 3300006871 Bacteria 20908
188 Ga0075434_100032547 3300006871 Bacteria 5141
189 Ga0075434_100270384 3300006871 Bacteria 1719
190 Ga0075434_100323337 3300006871 Unclassified 1563
191 Ga0075434_100492122 3300006871 Unclassified 1247
192 Ga0068865_100011639 3300006881 Bacteria 5513
193 Ga0068865_100058967 3300006881 Bacteria 2683
194 Ga0068865_100162061 3300006881 Bacteria 1707
195 Ga0068865_100163236 3300006881 Unclassified 1701
196 Ga0068865_100281853 3300006881 Unclassified 1323
197 Ga0075436_100001976 3300006914 Bacteria 14140
198 Ga0075436_100009496 3300006914 Bacteria 6653
199 Ga0097620_100000714 3300006931 Bacteria 33489
200 Ga0097620_100093116 3300006931 Bacteria 3065
201 Ga0075435_100010778 3300007076 Bacteria 6694
202 Ga0075435_100013603 3300007076 Bacteria 6060
203 Ga0075435_100019396 3300007076 Bacteria 5194
204 Ga0075435_100023710 3300007076 Bacteria 4751
205 Ga0075435_100097373 3300007076 Bacteria 2434
206 Ga0075435_100104965 3300007076 Unclassified 2345
207 Ga0075435_100207217 3300007076 Bacteria 1662
208 Ga0099794_10006654 3300007265 Unclassified 4694
209 Ga0099794_10032704 3300007265 Bacteria 2443
210 Ga0099794_10079018 3300007265 Unclassified 1620
211 Ga0099794_10176703 3300007265 Unclassified 1089
212 Ga0105251_10060846 3300009011 Unclassified 1777
213 Ga0105240_10023460 3300009093 Bacteria 8157
214 Ga0105240_10156870 3300009093 Bacteria 2706
215 Ga0105240_10276320 3300009093 Bacteria 1932
216 Ga0111539_10052204 3300009094 Bacteria 4867
217 Ga0111539_10058321 3300009094 Bacteria 4580
218 Ga0111539_10294913 3300009094 Unclassified 1887
219 Ga0111539_10317730 3300009094 Bacteria 1812
220 Ga0105245_10102507 3300009098 Bacteria 2650
221 Ga0105245_10566046 3300009098 Unclassified 1160
222 Ga0105245_10581692 3300009098 Bacteria 1144
223 Ga0105247_10050787 3300009101 Bacteria 2552
224 Ga0105247_10159760 3300009101 Bacteria 1491
225 Ga0114129_10125277 3300009147 Unclassified 3533
226 Ga0114129_10516999 3300009147 Unclassified 1557
227 Ga0105243_10031438 3300009148 Bacteria 4093
228 Ga0105241_10011928 3300009174 Bacteria 6383
229 Ga0105241_10014749 3300009174 Bacteria 5720
230 Ga0105241_10178609 3300009174 Bacteria 1759
231 Ga0105241_10191681 3300009174 Bacteria 1702
232 Ga0105242_10020850 3300009176 Bacteria 5141
233 Ga0105242_10030613 3300009176 Bacteria 4297
234 Ga0105242_10033189 3300009176 Bacteria 4132
235 Ga0105242_10423534 3300009176 Archaea 1248
236 Ga0105248_10030534 3300009177 Bacteria 6018
237 Ga0105237_10060274 3300009545 Unclassified 3797
238 Ga0105237_10070511 3300009545 Bacteria 3491
239 Ga0105237_10097734 3300009545 Bacteria 2927
240 Ga0105237_10102605 3300009545 Bacteria 2852
241 Ga0105237_10201063 3300009545 Bacteria 1992
242 Ga0105238_10023968 3300009551 Bacteria 6222
243 Ga0105238_10068429 3300009551 Unclassified 3552
244 Ga0105238_10206403 3300009551 Bacteria 1941
245 Ga0105238_10391190 3300009551 Unclassified 1382
246 Ga0105249_10137474 3300009553 Bacteria 2340
247 Ga0105249_10148504 3300009553 Bacteria 2254
248 Ga0105249_10300536 3300009553 Bacteria 1610
249 Ga0105249_10599049 3300009553 Unclassified 1156
250 Ga0105249_10616199 3300009553 Bacteria 1141
251 Ga0105239_10051087 3300010375 Bacteria 4533
252 Ga0105239_10122505 3300010375 Bacteria 2889
253 Ga0105239_10186624 3300010375 Bacteria 2321
254 Ga0105239_10342510 3300010375 Bacteria 1687
255 Ga0105239_10992156 3300010375 Bacteria 965
256 Ga0105239_11041045 3300010375 Bacteria 941
257 Ga0105246_10008240 3300011119 Bacteria 6402
258 Ga0105246_10011169 3300011119 Bacteria 5566
259 Ga0157371_10002531 3300013102 Bacteria 17360
260 Ga0157371_10009000 3300013102 Bacteria 7896
261 Ga0157370_10378268 3300013104 Bacteria 1304
262 Ga0157369_10026983 3300013105 Bacteria 6370
263 Ga0157369_10054471 3300013105 Bacteria 4319
264 Ga0157369_10144141 3300013105 Unclassified 2519
265 Ga0157374_10051608 3300013296 Bacteria 3827
266 Ga0157374_10151114 3300013296 Bacteria 2258
267 Ga0157374_10362468 3300013296 Bacteria 1441
268 Ga0157378_10013851 3300013297 Bacteria 7054
269 Ga0157378_10017861 3300013297 Bacteria 6226
270 Ga0157378_10021184 3300013297 Bacteria 5718
271 Ga0157378_10060610 3300013297 Bacteria 3376
272 Ga0157378_10449380 3300013297 Bacteria 1279
273 Ga0163162_10001837 3300013306 Bacteria 19975
274 Ga0163162_10015898 3300013306 Bacteria 7354
275 Ga0163162_10131861 3300013306 Bacteria 2608
276 Ga0163162_10288319 3300013306 Archaea 1773
277 Ga0157372_10022162 3300013307 Bacteria 6871
278 Ga0157372_10171854 3300013307 Bacteria 2507
279 Ga0157372_10285307 3300013307 Bacteria 1920
280 Ga0157372_10496834 3300013307 Unclassified 1423
281 Ga0157375_10000926 3300013308 Bacteria 25450
282 Ga0157375_10096870 3300013308 Bacteria 3024
283 Ga0157375_10356278 3300013308 Bacteria 1629
284 Ga0163163_10001045 3300014325 Bacteria 23465
285 Ga0163163_10087036 3300014325 Bacteria 3134
286 Ga0163163_10246228 3300014325 Unclassified 1838
287 Ga0163163_10369904 3300014325 Bacteria 1490
288 Ga0163163_10691456 3300014325 Unclassified 1083
289 Ga0157380_10025668 3300014326 Bacteria 4470
290 Ga0157380_10086965 3300014326 Bacteria 2570
291 Ga0182008_10006186 3300014497 Bacteria 6727
292 Ga0157377_10006871 3300014745 Bacteria 5457
293 Ga0157379_10120942 3300014968 Bacteria 2355
294 Ga0157379_10493434 3300014968 Bacteria 1134
295 Ga0157376_10000008 3300014969 Bacteria 351192
296 Ga0157376_10014148 3300014969 Bacteria 5976
297 Ga0157376_10209596 3300014969 Bacteria 1798
298 Ga0157376_10283956 3300014969 Unclassified 1560
299 Ga0163161_10062830 3300017792 Bacteria 2705
300 Ga0224572_1004415 3300024225 Bacteria 2445
301 Ga0207427_101369 3300025231 Bacteria 8969
302 Ga0207666_1001439 3300025271 Bacteria 2803
303 Ga0207697_10017770 3300025315 Bacteria 2922
304 Ga0207642_10006910 3300025899 Bacteria 3801
305 Ga0207642_10025406 3300025899 Unclassified 2396
306 Ga0207642_10289064 3300025899 Bacteria 946
307 Ga0207688_10044406 3300025901 Bacteria 2477
308 Ga0207680_10044025 3300025903 Bacteria 2622
309 Ga0207647_10000693 3300025904 Bacteria 26376
310 Ga0207647_10004401 3300025904 Bacteria 10445
311 Ga0207647_10005796 3300025904 Bacteria 9009
312 Ga0207647_10059356 3300025904 Bacteria 2341
313 Ga0207647_10175108 3300025904 Bacteria 1248
314 Ga0207685_10171391 3300025905 Unclassified 999
315 Ga0207699_10052954 3300025906 Bacteria 2405
316 Ga0207645_10006290 3300025907 Bacteria 8535
317 Ga0207645_10045903 3300025907 Unclassified 2791
318 Ga0207645_10048393 3300025907 Bacteria 2715
319 Ga0207643_10008423 3300025908 Bacteria 5534
320 Ga0207705_10236740 3300025909 Bacteria 1390
321 Ga0207684_10049788 3300025910 Bacteria 3554
322 Ga0207654_10016071 3300025911 Bacteria 3892
323 Ga0207654_10042046 3300025911 Unclassified 2584
324 Ga0207707_10001132 3300025912 Bacteria 25271
325 Ga0207707_10291980 3300025912 Unclassified 1411
326 Ga0207695_10011852 3300025913 Bacteria 10515
327 Ga0207695_10030416 3300025913 Bacteria 5943
328 Ga0207695_10050110 3300025913 Bacteria 4395
329 Ga0207695_10091436 3300025913 Bacteria 3057
330 Ga0207671_10041626 3300025914 Bacteria 3400
331 Ga0207671_10134742 3300025914 Bacteria 1898
332 Ga0207671_10224004 3300025914 Unclassified 1474
333 Ga0207671_10356844 3300025914 Unclassified 1160
334 Ga0207693_10002042 3300025915 Bacteria 17708
335 Ga0207693_10006247 3300025915 Bacteria 9879
336 Ga0207693_10013435 3300025915 Bacteria 6603
337 Ga0207693_10104950 3300025915 Unclassified 2216
338 Ga0207693_10213259 3300025915 Bacteria 1517
339 Ga0207663_10024240 3300025916 Bacteria 3493
340 Ga0207663_10028594 3300025916 Bacteria 3264
341 Ga0207663_10043599 3300025916 Bacteria 2748
342 Ga0207663_10048161 3300025916 Bacteria 2636
343 Ga0207663_10101790 3300025916 Unclassified 1931
344 Ga0207663_10107532 3300025916 Unclassified 1887
345 Ga0207663_10119086 3300025916 Bacteria 1804
346 Ga0207663_10361902 3300025916 Unclassified 1101
347 Ga0207660_10021689 3300025917 Bacteria 4322
348 Ga0207660_10116322 3300025917 Bacteria 2019
349 Ga0207660_10218589 3300025917 Bacteria 1494
350 Ga0207662_10005190 3300025918 Bacteria 6913
351 Ga0207662_10012438 3300025918 Bacteria 4740
352 Ga0207657_10002904 3300025919 Bacteria 18395
353 Ga0207657_10010709 3300025919 Bacteria 9132
354 Ga0207649_10000805 3300025920 Bacteria 20142
355 Ga0207649_10028410 3300025920 Unclassified 3293
356 Ga0207649_10049606 3300025920 Bacteria 2593
357 Ga0207652_10032433 3300025921 Bacteria 4392
358 Ga0207646_10001082 3300025922 Bacteria 34670
359 Ga0207646_10348499 3300025922 Bacteria 1338
360 Ga0207681_10065019 3300025923 Unclassified 2520
361 Ga0207694_10014336 3300025924 Bacteria 5976
362 Ga0207650_10000541 3300025925 Bacteria 30916
363 Ga0207650_10003584 3300025925 Bacteria 10652
364 Ga0207650_10033277 3300025925 Bacteria 3732
365 Ga0207650_10051627 3300025925 Bacteria 3043
366 Ga0207659_10069120 3300025926 Bacteria 2571
367 Ga0207659_10530889 3300025926 Unclassified 999
368 Ga0207687_10044605 3300025927 Bacteria 3061
369 Ga0207700_10025389 3300025928 Bacteria 4113
370 Ga0207700_10026093 3300025928 Bacteria 4069
371 Ga0207700_10052049 3300025928 Unclassified 3059
372 Ga0207664_10000151 3300025929 Bacteria 55974
373 Ga0207664_10034005 3300025929 Bacteria 3922
374 Ga0207664_10158186 3300025929 Unclassified 1930
375 Ga0207664_10336802 3300025929 Bacteria 1333
376 Ga0207664_10623601 3300025929 Unclassified 969
377 Ga0207690_10007013 3300025932 Bacteria 6680
378 Ga0207706_10000422 3300025933 Bacteria 45508
379 Ga0207706_10011326 3300025933 Bacteria 8125
380 Ga0207706_10059770 3300025933 Bacteria 3357
381 Ga0207706_10165994 3300025933 Unclassified 1940
382 Ga0207686_10061030 3300025934 Unclassified 2389
383 Ga0207686_10257465 3300025934 Bacteria 1278
384 Ga0207709_10155063 3300025935 Bacteria 1591
385 Ga0207670_10014075 3300025936 Bacteria 4736
386 Ga0207669_10053980 3300025937 Bacteria 2425
387 Ga0207669_10059107 3300025937 Bacteria 2343
388 Ga0207704_10018029 3300025938 Unclassified 3676
389 Ga0207704_10037565 3300025938 Unclassified 2798
390 Ga0207704_10240806 3300025938 Unclassified 1352
391 Ga0207665_10003604 3300025939 Bacteria 10343
392 Ga0207665_10006549 3300025939 Bacteria 7722
393 Ga0207665_10021583 3300025939 Bacteria 4236
394 Ga0207665_10054345 3300025939 Bacteria 2700
395 Ga0207665_10061121 3300025939 Bacteria 2553
396 Ga0207665_10293879 3300025939 Unclassified 1212
397 Ga0207691_10013015 3300025940 Bacteria 7967
398 Ga0207711_10003693 3300025941 Bacteria 13202
399 Ga0207711_10049334 3300025941 Unclassified 3604
400 Ga0207711_10066058 3300025941 Unclassified 3128
401 Ga0207689_10006458 3300025942 Bacteria 10366
402 Ga0207689_10021789 3300025942 Bacteria 5388
403 Ga0207689_10022628 3300025942 Bacteria 5281
404 Ga0207689_10024913 3300025942 Bacteria 5015
405 Ga0207689_10108082 3300025942 Bacteria 2286
406 Ga0207661_10000122 3300025944 Bacteria 49562
407 Ga0207661_10113114 3300025944 Bacteria 2300
408 Ga0207679_10000870 3300025945 Bacteria 19277
409 Ga0207667_10019087 3300025949 Bacteria 7665
410 Ga0207667_10059034 3300025949 Bacteria 4020
411 Ga0207667_10623184 3300025949 Bacteria 1086
412 Ga0207651_10055104 3300025960 Unclassified 2728
413 Ga0207712_10006304 3300025961 Bacteria 7481
414 Ga0207712_10101111 3300025961 Bacteria 2143
415 Ga0207640_10006013 3300025981 Bacteria 6632
416 Ga0207658_10029528 3300025986 Bacteria 3873
417 Ga0207658_10124752 3300025986 Unclassified 2059
418 Ga0207658_10356105 3300025986 Unclassified 1276
419 Ga0207677_10004810 3300026023 Bacteria 7291
420 Ga0207677_10077465 3300026023 Bacteria 2371
421 Ga0207703_10001646 3300026035 Bacteria 20097
422 Ga0207703_10071609 3300026035 Bacteria 2864
423 Ga0207639_10045561 3300026041 Bacteria 3304
424 Ga0207639_10065775 3300026041 Bacteria 2815
425 Ga0207639_10119809 3300026041 Unclassified 2160
426 Ga0207678_10006987 3300026067 Bacteria 10021
427 Ga0207678_10010978 3300026067 Bacteria 7956
428 Ga0207708_10029102 3300026075 Bacteria 4185
429 Ga0207708_10209444 3300026075 Bacteria 1558
430 Ga0207702_10023459 3300026078 Bacteria 5117
431 Ga0207702_10053189 3300026078 Bacteria 3427
432 Ga0207702_10195372 3300026078 Unclassified 1872
433 Ga0207641_10000006 3300026088 Bacteria 442569
434 Ga0207641_10008817 3300026088 Bacteria 8330
435 Ga0207641_10035064 3300026088 Bacteria 4178
436 Ga0207641_10066104 3300026088 Bacteria 3095
437 Ga0207648_10004897 3300026089 Bacteria 13649
438 Ga0207648_10014821 3300026089 Bacteria 7191
439 Ga0207648_10058037 3300026089 Bacteria 3376
440 Ga0207648_10077629 3300026089 Unclassified 2895
441 Ga0207648_10123753 3300026089 Unclassified 2275
442 Ga0207648_10454049 3300026089 Archaea 1167
443 Ga0207676_10002394 3300026095 Bacteria 13374
444 Ga0207676_10049232 3300026095 Unclassified 3276
445 Ga0207676_10049793 3300026095 Bacteria 3262
446 Ga0207674_10000537 3300026116 Bacteria 49684
447 Ga0207674_10001759 3300026116 Bacteria 27722
448 Ga0207674_10111201 3300026116 Bacteria 2714
449 Ga0207675_100019494 3300026118 Bacteria 6329
450 Ga0207675_100090911 3300026118 Bacteria 2870
451 Ga0207683_10008965 3300026121 Bacteria 8520
452 Ga0207698_10063348 3300026142 Unclassified 2893
453 Ga0209588_1003190 3300027671 Bacteria 4525
454 Ga0207428_10057949 3300027907 Bacteria 3075
455 Ga0207428_10078500 3300027907 Bacteria 2583
456 Ga0207428_10109057 3300027907 Bacteria 2132
457 Ga0268266_10000153 3300028379 Bacteria 131887
458 Ga0268266_10018739 3300028379 Bacteria 5896
459 Ga0268265_10008649 3300028380 Bacteria 6880
460 Ga0268265_10269091 3300028380 Bacteria 1519
461 Ga0268264_10010247 3300028381 Bacteria 7759
462 Ga0268264_10115491 3300028381 Bacteria 2358
463 Ga0268264_10191092 3300028381 Bacteria 1866
464 Ga0268264_10255651 3300028381 Bacteria 1629
465 Ga0307509_10010784 3300031507 Bacteria 11143
466 Ga0307406_10048452 3300031901 Unclassified 2684
467 Ga0307406_10115841 3300031901 Bacteria 1853
468 Ga0307407_10011264 3300031903 Unclassified 4250
469 Ga0307409_100263058 3300031995 Bacteria 1584
470 Ga0307416_100086286 3300032002 Bacteria 2675
471 Ga0307416_100096860 3300032002 Unclassified 2553
472 Ga0307416_100126073 3300032002 Bacteria 2293
473 Ga0316214_1009453 3300033545 Bacteria 1316
474 Ga0316212_1016526 3300033547 Unclassified 1041
475 Ga0373959_0007585 3300034820 Bacteria 1826
476 Ga0373926_0019759 3300035083 Unclassified 2324
477 Ga0373934_0005963 3300035086 Bacteria 4511
478 Ga0373923_0010349 3300035111 Bacteria 3390
479 Ga0373936_0008394 3300035113 Bacteria 3888
480 Ga0373936_0029722 3300035113 Bacteria 2152
481 Ga0373945_0019458 3300035116 Unclassified 2319
482 Ga0373945_0046750 3300035116 Bacteria 1580
483 Ga0373953_0026335 3300035117 Unclassified 2227
484 Ga0373954_0072186 3300035118 Bacteria 1641
485 Ga0373960_0030037 3300035121 Bacteria 1511
486 Ga0373943_0000734 3300035170 Bacteria 14279
487 Ga0373943_0085918 3300035170 Bacteria 1621
488 Ga0373924_0005824 3300035410 Bacteria 4387
489 Ga0373924_0006511 3300035410 Bacteria 4187
490 Ga0373935_0018267 3300035692 Bacteria 4263
491 Ga0373935_0027419 3300035692 Bacteria 3520
492 Ga0373935_0033847 3300035692 Bacteria 3182
493 Ga0373935_0044677 3300035692 Unclassified 2793
494 Ga0373935_0049405 3300035692 Bacteria 2666
495 Ga0373935_0140849 3300035692 Bacteria 1629
496 Ga0373927_0000754 3300035695 Bacteria 24720
497 Ga0373933_0040694 3300035724 Bacteria 2739
498 Ga0373947_0000528 3300035725 Bacteria 22310
499 Ga0373947_0002984 3300035725 Bacteria 10095
500 Ga0373947_0013631 3300035725 Bacteria 4656
501 Ga0373937_0020692 3300036401 Bacteria 5901
502 Ga0373937_0412330 3300036401 Unclassified 1282
503 Ga0373925_0001845 3300037068 Bacteria 17631
504 Ga0373925_0004780 3300037068 Bacteria 10204
505 Ga0373925_0084658 3300037068 Bacteria 2416
506 Ga0395900_0353860 3300037418 Bacteria 1442
507 Ga0395905_0287269 3300037471 Bacteria 1532
508 Ga0242420_010991 3300038996 Unclassified 1512
509 Ga0436360_0977840 3300039438 Bacteria 12962
510 Ga0451853_0601748 3300041512 Bacteria 1076
511 Ga0466967_0017338 3300045976 Bacteria 5713
512 Ga0466967_0046679 3300045976 Bacteria 3773
513 Ga0495590_0000175 3300046457 Bacteria 37474
514 Ga0495629_0005723 3300046459 Bacteria 9275
515 Ga0495638_0185456 3300046460 Bacteria 1184
516 Ga0495651_0098629 3300046462 Bacteria 2180
517 Ga0495580_0000108 3300046472 Bacteria 55508
518 Ga0495580_0005408 3300046472 Bacteria 10555
519 Ga0495580_0096968 3300046472 Bacteria 2051
520 Ga0495580_0187053 3300046472 Bacteria 1429
521 Ga0495582_0010157 3300046473 Bacteria 5185
522 Ga0495582_0012719 3300046473 Unclassified 4638
523 Ga0495582_0097146 3300046473 Unclassified 1647
524 Ga0495639_0019273 3300046475 Unclassified 2977
525 Ga0495662_0042533 3300046476 Bacteria 2193
526 Ga0495594_0058332 3300046499 Bacteria 2132
527 Ga0495618_0253010 3300046514 Bacteria 1105
528 Ga0495630_0024605 3300046517 Bacteria 4450
529 Ga0495630_0171617 3300046517 Bacteria 1652
530 Ga0495666_0034022 3300046526 Bacteria 2488
531 Ga0495666_0076974 3300046526 Bacteria 1581
532 Ga0495642_0026558 3300046528 Unclassified 2300
533 Ga0495665_0003170 3300046531 Bacteria 8902
534 Ga0495640_0010832 3300046533 Bacteria 7035
535 Ga0495587_0062696 3300046536 Bacteria 2176
536 Ga0495621_0102327 3300046539 Unclassified 1091
537 Ga0495668_0048806 3300046616 Bacteria 2348
538 Ga0495625_0097703 3300046660 Bacteria 2021
539 Ga0495635_0036911 3300046663 Bacteria 3384
540 Ga0495659_0031677 3300046664 Unclassified 1846
541 Ga0495623_0071204 3300046679 Bacteria 2164
542 Ga0495623_0125175 3300046679 Bacteria 1544
543 Ga0495646_0348609 3300046680 Unclassified 776
544 Ga0495658_0234208 3300046683 Unclassified 1152
545 Ga0495669_0057623 3300046684 Bacteria 1753
546 Ga0495649_0046062 3300046694 Bacteria 2376
547 Ga0495581_0019569 3300047315 Unclassified 3929
548 Ga0495581_0121185 3300047315 Unclassified 1522
549 Ga0495674_0150196 3300047319 Unclassified 1954
550 Ga0495676_0005055 3300047321 Bacteria 12100
551 Ga0495680_0031898 3300047322 Bacteria 4283
552 Ga0495675_0315359 3300047444 Unclassified 926
553 Ga0495677_0082476 3300047445 Unclassified 1206
554 Ga0495677_0084334 3300047445 Bacteria 1193
555 Ga0495684_0015514 3300047471 Bacteria 5864
556 Ga0495593_0064183 3300047673 Unclassified 1917
557 Ga0495614_0054323 3300048089 Bacteria 1718
558 Ga0496101_0280035 3300048904 Bacteria 1303
559 Ga0496101_0365651 3300048904 Bacteria 1134
560 Ga0496102_0026378 3300048905 Bacteria 5182
561 Ga0496102_0149961 3300048905 Bacteria 2190
562 Ga0496102_0180314 3300048905 Bacteria 1990
563 Ga0496104_0250793 3300048907 Bacteria 1683
564 Ga0496106_0145653 3300048909 Bacteria 1866
565 Ga0496108_0000258 3300048911 Bacteria 45782
566 Ga0496108_0088054 3300048911 Unclassified 2638
567 Ga0496109_0000781 3300048912 Bacteria 26465
568 Ga0496109_0095978 3300048912 Bacteria 2746
569 Ga0496110_0009726 3300048913 Bacteria 7787
570 Ga0496111_0248741 3300048914 Bacteria 1320
571 Ga0496112_0000081 3300048915 Bacteria 62594
572 Ga0496112_0052552 3300048915 Bacteria 3999
573 Ga0496112_0171605 3300048915 Bacteria 2134
574 Ga0496113_0180653 3300048916 Unclassified 1673
575 Ga0496114_0090229 3300048917 Unclassified 2601
576 Ga0496115_0100316 3300048918 Unclassified 2373
577 Ga0501071_0042927 3300049587 Bacteria 3241
578 Ga0501074_0024476 3300049590 Bacteria 4389
579 Ga0501079_0087610 3300049741 Bacteria 2410
580 Ga0501080_0080621 3300049742 Bacteria 3025
581 Ga0501080_0336770 3300049742 Bacteria 1364
582 Ga0501081_0013952 3300049743 Bacteria 5291
583 Ga0501083_0001125 3300049744 Bacteria 17899
584 Ga0501083_0024856 3300049744 Bacteria 4149
585 Ga0501045_0214020 3300049824 Unclassified 1435
586 nmdc:mga03683_81819_c1 3300050489 Unclassified 1395
587 nmdc:mga05p37_109864_c1 3300050507 Unclassified 3392
588 nmdc:mga05p37_19582_c1 3300050507 Bacteria 8186
589 nmdc:mga05p37_203520_c1 3300050507 Bacteria 2396
590 nmdc:mga05p37_263768_c1 3300050507 Bacteria 2060
591 nmdc:mga05p37_372366_c1 3300050507 Bacteria 1676
592 nmdc:mga05p37_487639_c1 3300050507 Unclassified 1418
593 nmdc:mga09592_152248_c1 3300050508 Bacteria 1996
594 nmdc:mga06r32_356892_c1 3300050510 Unclassified 1446
595 nmdc:mga06r32_772_c1 3300050510 Bacteria 28263
596 nmdc:mga08y16_167076_c1 3300050511 Bacteria 2286
597 nmdc:mga08y16_22475_c1 3300050511 Bacteria 6658
598 nmdc:mga08y16_6910_c1 3300050511 Bacteria 11899
599 nmdc:mga08y16_85833_c1 3300050511 Bacteria 3281
600 nmdc:mga0n895_140048_c1 3300050512 Unclassified 2447
601 nmdc:mga0n895_2498_c1 3300050512 Bacteria 14388
602 nmdc:mga0n895_30980_c1 3300050512 Bacteria 5116
603 nmdc:mga0n895_33308_c1 3300050512 Bacteria 4951
604 nmdc:mga0n895_3497_c1 3300050512 Bacteria 12688
605 nmdc:mga0n895_545380_c1 3300050512 Unclassified 1166
606 nmdc:mga0rr50_17711_c1 3300050513 Bacteria 4764
607 nmdc:mga0rr50_193491_c1 3300050513 Bacteria 1668
608 nmdc:mga0rr50_31228_c1 3300050513 Bacteria 3781
609 nmdc:mga0rr50_3238_c1 3300050513 Bacteria 9326
610 nmdc:mga08x19_202301_c1 3300050514 Bacteria 1362
611 nmdc:mga08x19_24077_c1 3300050514 Bacteria 3781
612 nmdc:mga08x19_307507_c1 3300050514 Unclassified 1102
613 nmdc:mga0a205_20565_c1 3300050515 Bacteria 6229
614 nmdc:mga0a205_265451_c1 3300050515 Bacteria 1594
615 nmdc:mga0a205_498_c1 3300050515 Bacteria 30776
616 Ga0495601_0044209 3300053077 Bacteria 2800
617 Ga0495601_0088827 3300053077 Bacteria 1987
618 Ga0495619_0013452 3300053085 Bacteria 5156
619 Ga0501084_0001975 3300054114 Bacteria 16382
620 Ga0501084_0058087 3300054114 Bacteria 3237
621 Ga0501084_0115254 3300054114 Bacteria 2259

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046680 Ga0495646_0348609 Ga0495646_0348609_35_745 229
2 3300046473 Ga0495582_0010157 Ga0495582_0010157_66_830 239
3 3300036401 Ga0373937_0412330 Ga0373937_0412330_352_1173 251
4 3300006358 Ga0068871_100170941 Ga0068871_1001709412 254
5 3300006844 Ga0075428_100243538 Ga0075428_1002435382 256
6 3300046539 Ga0495621_0102327 Ga0495621_0102327_41_859 256
7 3300050507 nmdc:mga05p37_263768_c1 nmdc:mga05p37_263768_c1_1208_2026 256
8 3300005435 Ga0070714_100000123 Ga0070714_1000001232 257
9 3300005439 Ga0070711_100032874 Ga0070711_1000328742 257
10 3300025916 Ga0207663_10107532 Ga0207663_101075322 257
11 3300025929 Ga0207664_10000151 Ga0207664_1000015111 257
12 3300005293 Ga0065715_10194679 Ga0065715_101946792 258
13 3300006358 Ga0068871_100151462 Ga0068871_1001514622 259
14 3300006177 Ga0075362_10000228 Ga0075362_100002287 261
15 3300006178 Ga0075367_10005874 Ga0075367_100058747 261
16 3300006195 Ga0075366_10003831 Ga0075366_100038314 261
17 3300007265 Ga0099794_10032704 Ga0099794_100327042 262
18 3300050512 nmdc:mga0n895_2498_c1 nmdc:mga0n895_2498_c1_6760_7596 262
19 3300050513 nmdc:mga0rr50_17711_c1 nmdc:mga0rr50_17711_c1_3543_4379 262
20 3300005336 Ga0070680_100059949 Ga0070680_1000599491 263
21 3300007265 Ga0099794_10079018 Ga0099794_100790182 263
22 3300014325 Ga0163163_10087036 Ga0163163_100870363 263
23 3300025917 Ga0207660_10116322 Ga0207660_101163222 263
24 3300032002 Ga0307416_100096860 Ga0307416_1000968602 263
25 3300033545 Ga0316214_1009453 Ga0316214_10094532 263
26 3300033547 Ga0316212_1016526 Ga0316212_10165261 263
27 3300005842 Ga0068858_100189223 Ga0068858_1001892232 264
28 3300006237 Ga0097621_100297113 Ga0097621_1002971132 264
29 3300014497 Ga0182008_10006186 Ga0182008_100061863 264
30 3300024225 Ga0224572_1004415 Ga0224572_10044152 264
31 3300035113 Ga0373936_0008394 Ga0373936_0008394_327_1187 264
32 3300035692 Ga0373935_0018267 Ga0373935_0018267_481_1341 264
33 3300037068 Ga0373925_0084658 Ga0373925_0084658_1109_1969 264
34 3300041512 Ga0451853_0601748 Ga0451853_0601748_92_949 264
35 3300053077 Ga0495601_0088827 Ga0495601_0088827_500_1360 264
36 3300014969 Ga0157376_10283956 Ga0157376_102839562 265
37 3300048904 Ga0496101_0365651 Ga0496101_0365651_24_881 265
38 3300048917 Ga0496114_0090229 Ga0496114_0090229_1345_2292 265
39 3300009545 Ga0105237_10201063 Ga0105237_102010632 266
40 3300005293 Ga0065715_10113544 Ga0065715_101135442 267
41 3300005330 Ga0070690_100107793 Ga0070690_1001077932 267
42 3300005353 Ga0070669_100091373 Ga0070669_1000913732 267
43 3300005367 Ga0070667_100419494 Ga0070667_1004194942 267
44 3300005615 Ga0070702_100056937 Ga0070702_1000569372 267
45 3300005842 Ga0068858_100059202 Ga0068858_1000592022 267
46 3300025918 Ga0207662_10012438 Ga0207662_100124386 267
47 3300025923 Ga0207681_10065019 Ga0207681_100650192 267
48 3300025942 Ga0207689_10024913 Ga0207689_100249135 267
49 3300025986 Ga0207658_10124752 Ga0207658_101247522 267
50 3300026035 Ga0207703_10071609 Ga0207703_100716092 267
51 3300026142 Ga0207698_10063348 Ga0207698_100633482 267
52 3300046472 Ga0495580_0187053 Ga0495580_0187053_274_1131 267
53 3300005290 Ga0065712_10069049 Ga0065712_100690494 268
54 3300005293 Ga0065715_10024814 Ga0065715_100248141 268
55 3300005293 Ga0065715_10036964 Ga0065715_100369642 268
56 3300005293 Ga0065715_10143614 Ga0065715_101436142 268
57 3300005328 Ga0070676_10324080 Ga0070676_103240801 268
58 3300005330 Ga0070690_100072890 Ga0070690_1000728902 268
59 3300005331 Ga0070670_100481102 Ga0070670_1004811021 268
60 3300005334 Ga0068869_100009992 Ga0068869_1000099926 268
61 3300005335 Ga0070666_10187165 Ga0070666_101871651 268
62 3300005337 Ga0070682_100089918 Ga0070682_1000899182 268
63 3300005338 Ga0068868_100001613 Ga0068868_1000016137 268
64 3300005344 Ga0070661_100058534 Ga0070661_1000585342 268
65 3300005353 Ga0070669_100003738 Ga0070669_1000037382 268
66 3300005354 Ga0070675_100081418 Ga0070675_1000814182 268
67 3300005354 Ga0070675_100384695 Ga0070675_1003846952 268
68 3300005356 Ga0070674_100048435 Ga0070674_1000484353 268
69 3300005356 Ga0070674_100181528 Ga0070674_1001815282 268
70 3300005364 Ga0070673_100390299 Ga0070673_1003902991 268
71 3300005364 Ga0070673_100416796 Ga0070673_1004167962 268
72 3300005365 Ga0070688_100067514 Ga0070688_1000675142 268
73 3300005366 Ga0070659_100422016 Ga0070659_1004220162 268
74 3300005457 Ga0070662_100022071 Ga0070662_1000220712 268
75 3300005459 Ga0068867_100434737 Ga0068867_1004347372 268
76 3300005535 Ga0070684_100003724 Ga0070684_1000037248 268
77 3300005536 Ga0070697_100094699 Ga0070697_1000946993 268
78 3300005539 Ga0068853_100090113 Ga0068853_1000901132 268
79 3300005544 Ga0070686_100197980 Ga0070686_1001979801 268
80 3300005547 Ga0070693_100043247 Ga0070693_1000432472 268
81 3300005563 Ga0068855_100022005 Ga0068855_1000220052 268
82 3300005564 Ga0070664_100000932 Ga0070664_1000009327 268
83 3300005577 Ga0068857_100000442 Ga0068857_10000044219 268
84 3300005577 Ga0068857_100352266 Ga0068857_1003522661 268
85 3300005578 Ga0068854_100001434 Ga0068854_10000143413 268
86 3300005614 Ga0068856_100000917 Ga0068856_10000091716 268
87 3300005614 Ga0068856_100003158 Ga0068856_10000315812 268
88 3300005617 Ga0068859_100000714 Ga0068859_10000071423 268
89 3300005618 Ga0068864_100033719 Ga0068864_1000337192 268
90 3300005718 Ga0068866_10019181 Ga0068866_100191812 268
91 3300005841 Ga0068863_100052371 Ga0068863_1000523712 268
92 3300005842 Ga0068858_100002139 Ga0068858_10000213914 268
93 3300005844 Ga0068862_100307964 Ga0068862_1003079642 268
94 3300006163 Ga0070715_10053962 Ga0070715_100539622 268
95 3300006173 Ga0070716_100044487 Ga0070716_1000444872 268
96 3300006175 Ga0070712_100002091 Ga0070712_10000209115 268
97 3300006177 Ga0075362_10102924 Ga0075362_101029242 268
98 3300006237 Ga0097621_100203119 Ga0097621_1002031192 268
99 3300006358 Ga0068871_100036145 Ga0068871_1000361453 268
100 3300006358 Ga0068871_100090402 Ga0068871_1000904022 268
101 3300006844 Ga0075428_100008493 Ga0075428_1000084932 268
102 3300006844 Ga0075428_100138746 Ga0075428_1001387462 268
103 3300006846 Ga0075430_100018752 Ga0075430_1000187524 268
104 3300006881 Ga0068865_100011639 Ga0068865_1000116393 268
105 3300006931 Ga0097620_100000714 Ga0097620_10000071423 268
106 3300007076 Ga0075435_100023710 Ga0075435_1000237102 268
107 3300007076 Ga0075435_100097373 Ga0075435_1000973732 268
108 3300009094 Ga0111539_10294913 Ga0111539_102949132 268
109 3300009147 Ga0114129_10125277 Ga0114129_101252772 268
110 3300009545 Ga0105237_10060274 Ga0105237_100602744 268
111 3300013104 Ga0157370_10378268 Ga0157370_103782681 268
112 3300013105 Ga0157369_10026983 Ga0157369_100269832 268
113 3300013306 Ga0163162_10288319 Ga0163162_102883192 268
114 3300013307 Ga0157372_10022162 Ga0157372_100221622 268
115 3300013307 Ga0157372_10285307 Ga0157372_102853072 268
116 3300013308 Ga0157375_10000926 Ga0157375_100009263 268
117 3300025271 Ga0207666_1001439 Ga0207666_10014392 268
118 3300025899 Ga0207642_10025406 Ga0207642_100254062 268
119 3300025899 Ga0207642_10289064 Ga0207642_102890641 268
120 3300025903 Ga0207680_10044025 Ga0207680_100440252 268
121 3300025904 Ga0207647_10005796 Ga0207647_100057965 268
122 3300025904 Ga0207647_10175108 Ga0207647_101751081 268
123 3300025905 Ga0207685_10171391 Ga0207685_101713911 268
124 3300025911 Ga0207654_10042046 Ga0207654_100420462 268
125 3300025914 Ga0207671_10134742 Ga0207671_101347422 268
126 3300025915 Ga0207693_10002042 Ga0207693_1000204216 268
127 3300025916 Ga0207663_10028594 Ga0207663_100285942 268
128 3300025920 Ga0207649_10028410 Ga0207649_100284102 268
129 3300025925 Ga0207650_10003584 Ga0207650_1000358410 268
130 3300025925 Ga0207650_10033277 Ga0207650_100332772 268
131 3300025926 Ga0207659_10069120 Ga0207659_100691201 268
132 3300025928 Ga0207700_10026093 Ga0207700_100260932 268
133 3300025929 Ga0207664_10336802 Ga0207664_103368022 268
134 3300025933 Ga0207706_10059770 Ga0207706_100597704 268
135 3300025933 Ga0207706_10165994 Ga0207706_101659942 268
136 3300025937 Ga0207669_10059107 Ga0207669_100591072 268
137 3300025938 Ga0207704_10018029 Ga0207704_100180292 268
138 3300025939 Ga0207665_10061121 Ga0207665_100611212 268
139 3300025942 Ga0207689_10022628 Ga0207689_100226285 268
140 3300025949 Ga0207667_10019087 Ga0207667_100190872 268
141 3300025949 Ga0207667_10623184 Ga0207667_106231841 268
142 3300025981 Ga0207640_10006013 Ga0207640_100060135 268
143 3300026023 Ga0207677_10004810 Ga0207677_100048103 268
144 3300026035 Ga0207703_10001646 Ga0207703_100016468 268
145 3300026041 Ga0207639_10119809 Ga0207639_101198092 268
146 3300026075 Ga0207708_10209444 Ga0207708_102094443 268
147 3300026078 Ga0207702_10023459 Ga0207702_100234593 268
148 3300026078 Ga0207702_10195372 Ga0207702_101953722 268
149 3300026088 Ga0207641_10066104 Ga0207641_100661041 268
150 3300026089 Ga0207648_10077629 Ga0207648_100776292 268
151 3300026089 Ga0207648_10123753 Ga0207648_101237532 268
152 3300026089 Ga0207648_10454049 Ga0207648_104540491 268
153 3300026095 Ga0207676_10049232 Ga0207676_100492322 268
154 3300026116 Ga0207674_10001759 Ga0207674_1000175918 268
155 3300026118 Ga0207675_100019494 Ga0207675_1000194945 268
156 3300027907 Ga0207428_10078500 Ga0207428_100785002 268
157 3300031507 Ga0307509_10010784 Ga0307509_100107847 268
158 3300031901 Ga0307406_10115841 Ga0307406_101158412 268
159 3300031903 Ga0307407_10011264 Ga0307407_100112642 268
160 3300031995 Ga0307409_100263058 Ga0307409_1002630581 268
161 3300032002 Ga0307416_100086286 Ga0307416_1000862863 268
162 3300032002 Ga0307416_100126073 Ga0307416_1001260731 268
163 3300035086 Ga0373934_0005963 Ga0373934_0005963_1633_2487 268
164 3300035111 Ga0373923_0010349 Ga0373923_0010349_329_1183 268
165 3300035116 Ga0373945_0046750 Ga0373945_0046750_21_875 268
166 3300035117 Ga0373953_0026335 Ga0373953_0026335_902_1756 268
167 3300035118 Ga0373954_0072186 Ga0373954_0072186_49_903 268
168 3300035170 Ga0373943_0000734 Ga0373943_0000734_8665_9519 268
169 3300035410 Ga0373924_0005824 Ga0373924_0005824_166_1020 268
170 3300035692 Ga0373935_0033847 Ga0373935_0033847_1069_1923 268
171 3300035695 Ga0373927_0000754 Ga0373927_0000754_16300_17154 268
172 3300035724 Ga0373933_0040694 Ga0373933_0040694_193_1047 268
173 3300035725 Ga0373947_0000528 Ga0373947_0000528_13102_13956 268
174 3300036401 Ga0373937_0020692 Ga0373937_0020692_271_1125 268
175 3300037068 Ga0373925_0001845 Ga0373925_0001845_16292_17146 268
176 3300045976 Ga0466967_0017338 Ga0466967_0017338_1307_2161 268
177 3300045976 Ga0466967_0046679 Ga0466967_0046679_2466_3326 268
178 3300046457 Ga0495590_0000175 Ga0495590_0000175_8538_9392 268
179 3300046460 Ga0495638_0185456 Ga0495638_0185456_31_885 268
180 3300046462 Ga0495651_0098629 Ga0495651_0098629_1141_1995 268
181 3300046514 Ga0495618_0253010 Ga0495618_0253010_219_1073 268
182 3300046517 Ga0495630_0024605 Ga0495630_0024605_3288_4142 268
183 3300046660 Ga0495625_0097703 Ga0495625_0097703_20_874 268
184 3300046679 Ga0495623_0071204 Ga0495623_0071204_893_1747 268
185 3300046679 Ga0495623_0125175 Ga0495623_0125175_586_1440 268
186 3300046694 Ga0495649_0046062 Ga0495649_0046062_541_1395 268
187 3300048907 Ga0496104_0250793 Ga0496104_0250793_794_1648 268
188 3300048909 Ga0496106_0145653 Ga0496106_0145653_340_1194 268
189 3300048915 Ga0496112_0171605 Ga0496112_0171605_391_1245 268
190 3300048916 Ga0496113_0180653 Ga0496113_0180653_203_1057 268
191 3300049587 Ga0501071_0042927 Ga0501071_0042927_627_1481 268
192 3300049590 Ga0501074_0024476 Ga0501074_0024476_3448_4302 268
193 3300049741 Ga0501079_0087610 Ga0501079_0087610_520_1374 268
194 3300049742 Ga0501080_0080621 Ga0501080_0080621_542_1396 268
195 3300049742 Ga0501080_0336770 Ga0501080_0336770_411_1265 268
196 3300049743 Ga0501081_0013952 Ga0501081_0013952_1801_2655 268
197 3300049744 Ga0501083_0001125 Ga0501083_0001125_15617_16471 268
198 3300049744 Ga0501083_0024856 Ga0501083_0024856_2375_3229 268
199 3300049824 Ga0501045_0214020 Ga0501045_0214020_493_1347 268
200 3300050489 nmdc:mga03683_81819_c1 nmdc:mga03683_81819_c1_281_1135 268
201 3300050507 nmdc:mga05p37_109864_c1 nmdc:mga05p37_109864_c1_1279_2133 268
202 3300050507 nmdc:mga05p37_19582_c1 nmdc:mga05p37_19582_c1_452_1306 268
203 3300050508 nmdc:mga09592_152248_c1 nmdc:mga09592_152248_c1_791_1645 268
204 3300050510 nmdc:mga06r32_356892_c1 nmdc:mga06r32_356892_c1_314_1168 268
205 3300050510 nmdc:mga06r32_772_c1 nmdc:mga06r32_772_c1_23695_24549 268
206 3300050511 nmdc:mga08y16_22475_c1 nmdc:mga08y16_22475_c1_5180_6034 268
207 3300050511 nmdc:mga08y16_6910_c1 nmdc:mga08y16_6910_c1_8197_9051 268
208 3300054114 Ga0501084_0001975 Ga0501084_0001975_6741_7595 268
209 3300054114 Ga0501084_0058087 Ga0501084_0058087_2295_3149 268
210 3300054114 Ga0501084_0115254 Ga0501084_0115254_316_1170 268
211 3300001991 JGI24743J22301_10021092 JGI24743J22301_100210922 269
212 3300003322 rootL2_10033750 rootL2_100337501 269
213 3300003323 rootH1_10031980 rootH1_100319803 269
214 3300005293 Ga0065715_10112861 Ga0065715_101128612 269
215 3300005295 Ga0065707_10000678 Ga0065707_1000067813 269
216 3300005327 Ga0070658_10303263 Ga0070658_103032631 269
217 3300005328 Ga0070676_10022896 Ga0070676_100228962 269
218 3300005328 Ga0070676_10027408 Ga0070676_100274085 269
219 3300005329 Ga0070683_100011805 Ga0070683_1000118055 269
220 3300005329 Ga0070683_100023642 Ga0070683_1000236425 269
221 3300005330 Ga0070690_100042724 Ga0070690_1000427244 269
222 3300005334 Ga0068869_100030447 Ga0068869_1000304473 269
223 3300005334 Ga0068869_100304113 Ga0068869_1003041132 269
224 3300005335 Ga0070666_10056567 Ga0070666_100565673 269
225 3300005336 Ga0070680_100049594 Ga0070680_1000495942 269
226 3300005337 Ga0070682_100010640 Ga0070682_1000106404 269
227 3300005338 Ga0068868_100055431 Ga0068868_1000554315 269
228 3300005338 Ga0068868_100061139 Ga0068868_1000611393 269
229 3300005338 Ga0068868_100080560 Ga0068868_1000805602 269
230 3300005339 Ga0070660_100008847 Ga0070660_1000088477 269
231 3300005339 Ga0070660_100030704 Ga0070660_1000307046 269
232 3300005340 Ga0070689_100035604 Ga0070689_1000356042 269
233 3300005341 Ga0070691_10060911 Ga0070691_100609112 269
234 3300005344 Ga0070661_100017817 Ga0070661_1000178172 269
235 3300005344 Ga0070661_100020336 Ga0070661_1000203363 269
236 3300005347 Ga0070668_100003846 Ga0070668_1000038462 269
237 3300005353 Ga0070669_100016855 Ga0070669_1000168554 269
238 3300005354 Ga0070675_100007041 Ga0070675_1000070415 269
239 3300005354 Ga0070675_100601620 Ga0070675_1006016201 269
240 3300005356 Ga0070674_100077800 Ga0070674_1000778004 269
241 3300005366 Ga0070659_100026695 Ga0070659_1000266953 269
242 3300005366 Ga0070659_100057244 Ga0070659_1000572443 269
243 3300005367 Ga0070667_100018774 Ga0070667_1000187743 269
244 3300005367 Ga0070667_100633567 Ga0070667_1006335671 269
245 3300005434 Ga0070709_10066606 Ga0070709_100666062 269
246 3300005434 Ga0070709_10076676 Ga0070709_100766762 269
247 3300005434 Ga0070709_10125818 Ga0070709_101258182 269
248 3300005435 Ga0070714_100023222 Ga0070714_1000232223 269
249 3300005435 Ga0070714_100148138 Ga0070714_1001481382 269
250 3300005435 Ga0070714_100182155 Ga0070714_1001821552 269
251 3300005436 Ga0070713_100059810 Ga0070713_1000598102 269
252 3300005436 Ga0070713_100084718 Ga0070713_1000847182 269
253 3300005439 Ga0070711_100005305 Ga0070711_1000053055 269
254 3300005439 Ga0070711_100052163 Ga0070711_1000521632 269
255 3300005440 Ga0070705_100000663 Ga0070705_1000006632 269
256 3300005444 Ga0070694_100001150 Ga0070694_1000011504 269
257 3300005444 Ga0070694_100052387 Ga0070694_1000523872 269
258 3300005455 Ga0070663_100008376 Ga0070663_1000083766 269
259 3300005455 Ga0070663_100041450 Ga0070663_1000414502 269
260 3300005457 Ga0070662_100092230 Ga0070662_1000922302 269
261 3300005458 Ga0070681_10003152 Ga0070681_100031529 269
262 3300005459 Ga0068867_100009422 Ga0068867_1000094227 269
263 3300005459 Ga0068867_100016970 Ga0068867_1000169702 269
264 3300005468 Ga0070707_100004315 Ga0070707_10000431512 269
265 3300005468 Ga0070707_100416540 Ga0070707_1004165401 269
266 3300005471 Ga0070698_100140325 Ga0070698_1001403252 269
267 3300005518 Ga0070699_100051162 Ga0070699_1000511624 269
268 3300005518 Ga0070699_100325699 Ga0070699_1003256991 269
269 3300005530 Ga0070679_100003174 Ga0070679_1000031745 269
270 3300005530 Ga0070679_100140815 Ga0070679_1001408152 269
271 3300005535 Ga0070684_100036988 Ga0070684_1000369883 269
272 3300005535 Ga0070684_100135468 Ga0070684_1001354682 269
273 3300005536 Ga0070697_100008830 Ga0070697_1000088307 269
274 3300005539 Ga0068853_100052882 Ga0068853_1000528825 269
275 3300005539 Ga0068853_100124880 Ga0068853_1001248801 269
276 3300005543 Ga0070672_100213398 Ga0070672_1002133982 269
277 3300005544 Ga0070686_100027428 Ga0070686_1000274283 269
278 3300005545 Ga0070695_100000212 Ga0070695_10000021221 269
279 3300005545 Ga0070695_100009596 Ga0070695_1000095962 269
280 3300005545 Ga0070695_100021230 Ga0070695_1000212301 269
281 3300005546 Ga0070696_100000342 Ga0070696_10000034222 269
282 3300005547 Ga0070693_100128465 Ga0070693_1001284652 269
283 3300005548 Ga0070665_100001100 Ga0070665_1000011003 269
284 3300005548 Ga0070665_100127018 Ga0070665_1001270184 269
285 3300005549 Ga0070704_100099598 Ga0070704_1000995981 269
286 3300005577 Ga0068857_100001653 Ga0068857_10000165311 269
287 3300005578 Ga0068854_100058554 Ga0068854_1000585543 269
288 3300005615 Ga0070702_100018028 Ga0070702_1000180282 269
289 3300005615 Ga0070702_100094015 Ga0070702_1000940152 269
290 3300005616 Ga0068852_100026368 Ga0068852_1000263685 269
291 3300005616 Ga0068852_100115362 Ga0068852_1001153623 269
292 3300005617 Ga0068859_100093113 Ga0068859_1000931134 269
293 3300005618 Ga0068864_100050254 Ga0068864_1000502543 269
294 3300005618 Ga0068864_100452521 Ga0068864_1004525212 269
295 3300005718 Ga0068866_10007929 Ga0068866_100079294 269
296 3300005718 Ga0068866_10023697 Ga0068866_100236972 269
297 3300005719 Ga0068861_100163197 Ga0068861_1001631972 269
298 3300005834 Ga0068851_10186170 Ga0068851_101861701 269
299 3300005841 Ga0068863_100014480 Ga0068863_1000144808 269
300 3300005841 Ga0068863_100077099 Ga0068863_1000770993 269
301 3300005842 Ga0068858_100129461 Ga0068858_1001294612 269
302 3300005843 Ga0068860_100003784 Ga0068860_10000378412 269
303 3300005843 Ga0068860_100014306 Ga0068860_1000143067 269
304 3300005843 Ga0068860_100014493 Ga0068860_1000144935 269
305 3300005843 Ga0068860_100124105 Ga0068860_1001241052 269
306 3300005844 Ga0068862_100017030 Ga0068862_1000170305 269
307 3300005844 Ga0068862_100052116 Ga0068862_1000521163 269
308 3300005844 Ga0068862_100052753 Ga0068862_1000527533 269
309 3300005844 Ga0068862_100053056 Ga0068862_1000530563 269
310 3300005844 Ga0068862_100331722 Ga0068862_1003317222 269
311 3300006028 Ga0070717_10117584 Ga0070717_101175842 269
312 3300006028 Ga0070717_10201162 Ga0070717_102011622 269
313 3300006173 Ga0070716_100007249 Ga0070716_1000072495 269
314 3300006173 Ga0070716_100024242 Ga0070716_1000242422 269
315 3300006173 Ga0070716_100083268 Ga0070716_1000832682 269
316 3300006173 Ga0070716_100214092 Ga0070716_1002140921 269
317 3300006175 Ga0070712_100010248 Ga0070712_1000102481 269
318 3300006175 Ga0070712_100062998 Ga0070712_1000629982 269
319 3300006195 Ga0075366_10145880 Ga0075366_101458802 269
320 3300006237 Ga0097621_100004225 Ga0097621_1000042259 269
321 3300006237 Ga0097621_100038748 Ga0097621_1000387483 269
322 3300006237 Ga0097621_100061936 Ga0097621_1000619362 269
323 3300006358 Ga0068871_100004186 Ga0068871_1000041864 269
324 3300006358 Ga0068871_100017036 Ga0068871_1000170363 269
325 3300006358 Ga0068871_100033688 Ga0068871_1000336883 269
326 3300006852 Ga0075433_10122648 Ga0075433_101226482 269
327 3300006852 Ga0075433_10220768 Ga0075433_102207682 269
328 3300006871 Ga0075434_100001290 Ga0075434_10000129010 269
329 3300006871 Ga0075434_100032547 Ga0075434_1000325478 269
330 3300006871 Ga0075434_100270384 Ga0075434_1002703842 269
331 3300006871 Ga0075434_100323337 Ga0075434_1003233372 269
332 3300006871 Ga0075434_100492122 Ga0075434_1004921222 269
333 3300006881 Ga0068865_100058967 Ga0068865_1000589674 269
334 3300006881 Ga0068865_100162061 Ga0068865_1001620612 269
335 3300006881 Ga0068865_100163236 Ga0068865_1001632362 269
336 3300006881 Ga0068865_100281853 Ga0068865_1002818531 269
337 3300006914 Ga0075436_100001976 Ga0075436_10000197613 269
338 3300006914 Ga0075436_100009496 Ga0075436_1000094966 269
339 3300006931 Ga0097620_100093116 Ga0097620_1000931164 269
340 3300007076 Ga0075435_100010778 Ga0075435_1000107785 269
341 3300007076 Ga0075435_100013603 Ga0075435_1000136033 269
342 3300007076 Ga0075435_100019396 Ga0075435_1000193963 269
343 3300007076 Ga0075435_100104965 Ga0075435_1001049652 269
344 3300007076 Ga0075435_100207217 Ga0075435_1002072172 269
345 3300007265 Ga0099794_10006654 Ga0099794_100066542 269
346 3300007265 Ga0099794_10176703 Ga0099794_101767031 269
347 3300009011 Ga0105251_10060846 Ga0105251_100608462 269
348 3300009093 Ga0105240_10023460 Ga0105240_100234605 269
349 3300009093 Ga0105240_10156870 Ga0105240_101568702 269
350 3300009093 Ga0105240_10276320 Ga0105240_102763201 269
351 3300009094 Ga0111539_10052204 Ga0111539_100522043 269
352 3300009094 Ga0111539_10058321 Ga0111539_100583212 269
353 3300009094 Ga0111539_10317730 Ga0111539_103177302 269
354 3300009098 Ga0105245_10102507 Ga0105245_101025073 269
355 3300009098 Ga0105245_10566046 Ga0105245_105660461 269
356 3300009098 Ga0105245_10581692 Ga0105245_105816921 269
357 3300009101 Ga0105247_10050787 Ga0105247_100507872 269
358 3300009101 Ga0105247_10159760 Ga0105247_101597602 269
359 3300009147 Ga0114129_10516999 Ga0114129_105169992 269
360 3300009148 Ga0105243_10031438 Ga0105243_100314383 269
361 3300009174 Ga0105241_10011928 Ga0105241_100119288 269
362 3300009174 Ga0105241_10014749 Ga0105241_100147495 269
363 3300009174 Ga0105241_10178609 Ga0105241_101786091 269
364 3300009174 Ga0105241_10191681 Ga0105241_101916812 269
365 3300009176 Ga0105242_10020850 Ga0105242_100208503 269
366 3300009176 Ga0105242_10030613 Ga0105242_100306134 269
367 3300009176 Ga0105242_10033189 Ga0105242_100331892 269
368 3300009176 Ga0105242_10423534 Ga0105242_104235342 269
369 3300009177 Ga0105248_10030534 Ga0105248_100305344 269
370 3300009545 Ga0105237_10070511 Ga0105237_100705113 269
371 3300009545 Ga0105237_10097734 Ga0105237_100977342 269
372 3300009545 Ga0105237_10102605 Ga0105237_101026052 269
373 3300009551 Ga0105238_10023968 Ga0105238_100239685 269
374 3300009551 Ga0105238_10068429 Ga0105238_100684292 269
375 3300009551 Ga0105238_10206403 Ga0105238_102064031 269
376 3300009551 Ga0105238_10391190 Ga0105238_103911901 269
377 3300009553 Ga0105249_10137474 Ga0105249_101374742 269
378 3300009553 Ga0105249_10148504 Ga0105249_101485043 269
379 3300009553 Ga0105249_10300536 Ga0105249_103005362 269
380 3300009553 Ga0105249_10599049 Ga0105249_105990491 269
381 3300009553 Ga0105249_10616199 Ga0105249_106161991 269
382 3300010375 Ga0105239_10051087 Ga0105239_100510873 269
383 3300010375 Ga0105239_10122505 Ga0105239_101225054 269
384 3300010375 Ga0105239_10186624 Ga0105239_101866243 269
385 3300010375 Ga0105239_10342510 Ga0105239_103425101 269
386 3300010375 Ga0105239_10992156 Ga0105239_109921561 269
387 3300010375 Ga0105239_11041045 Ga0105239_110410451 269
388 3300011119 Ga0105246_10008240 Ga0105246_100082404 269
389 3300011119 Ga0105246_10011169 Ga0105246_100111693 269
390 3300013102 Ga0157371_10002531 Ga0157371_1000253118 269
391 3300013102 Ga0157371_10009000 Ga0157371_100090007 269
392 3300013105 Ga0157369_10054471 Ga0157369_100544715 269
393 3300013105 Ga0157369_10144141 Ga0157369_101441412 269
394 3300013296 Ga0157374_10051608 Ga0157374_100516082 269
395 3300013296 Ga0157374_10151114 Ga0157374_101511142 269
396 3300013296 Ga0157374_10362468 Ga0157374_103624682 269
397 3300013297 Ga0157378_10013851 Ga0157378_100138513 269
398 3300013297 Ga0157378_10017861 Ga0157378_100178613 269
399 3300013297 Ga0157378_10021184 Ga0157378_100211846 269
400 3300013297 Ga0157378_10060610 Ga0157378_100606102 269
401 3300013297 Ga0157378_10449380 Ga0157378_104493801 269
402 3300013306 Ga0163162_10001837 Ga0163162_1000183710 269
403 3300013306 Ga0163162_10015898 Ga0163162_100158986 269
404 3300013306 Ga0163162_10131861 Ga0163162_101318612 269
405 3300013307 Ga0157372_10171854 Ga0157372_101718544 269
406 3300013307 Ga0157372_10496834 Ga0157372_104968341 269
407 3300013308 Ga0157375_10096870 Ga0157375_100968702 269
408 3300013308 Ga0157375_10356278 Ga0157375_103562782 269
409 3300014325 Ga0163163_10001045 Ga0163163_1000104527 269
410 3300014325 Ga0163163_10246228 Ga0163163_102462282 269
411 3300014325 Ga0163163_10369904 Ga0163163_103699042 269
412 3300014325 Ga0163163_10691456 Ga0163163_106914562 269
413 3300014326 Ga0157380_10025668 Ga0157380_100256682 269
414 3300014326 Ga0157380_10086965 Ga0157380_100869654 269
415 3300014745 Ga0157377_10006871 Ga0157377_100068716 269
416 3300014968 Ga0157379_10120942 Ga0157379_101209422 269
417 3300014968 Ga0157379_10493434 Ga0157379_104934341 269
418 3300014969 Ga0157376_10000008 Ga0157376_10000008275 269
419 3300014969 Ga0157376_10014148 Ga0157376_100141484 269
420 3300014969 Ga0157376_10209596 Ga0157376_102095963 269
421 3300017792 Ga0163161_10062830 Ga0163161_100628305 269
422 3300025231 Ga0207427_101369 Ga0207427_1013696 269
423 3300025315 Ga0207697_10017770 Ga0207697_100177703 269
424 3300025899 Ga0207642_10006910 Ga0207642_100069103 269
425 3300025901 Ga0207688_10044406 Ga0207688_100444062 269
426 3300025904 Ga0207647_10000693 Ga0207647_100006933 269
427 3300025904 Ga0207647_10004401 Ga0207647_1000440112 269
428 3300025904 Ga0207647_10059356 Ga0207647_100593563 269
429 3300025906 Ga0207699_10052954 Ga0207699_100529542 269
430 3300025907 Ga0207645_10006290 Ga0207645_100062906 269
431 3300025907 Ga0207645_10045903 Ga0207645_100459032 269
432 3300025907 Ga0207645_10048393 Ga0207645_100483932 269
433 3300025908 Ga0207643_10008423 Ga0207643_100084234 269
434 3300025909 Ga0207705_10236740 Ga0207705_102367402 269
435 3300025910 Ga0207684_10049788 Ga0207684_100497885 269
436 3300025911 Ga0207654_10016071 Ga0207654_100160712 269
437 3300025912 Ga0207707_10001132 Ga0207707_1000113220 269
438 3300025912 Ga0207707_10291980 Ga0207707_102919802 269
439 3300025913 Ga0207695_10011852 Ga0207695_1001185216 269
440 3300025913 Ga0207695_10030416 Ga0207695_100304165 269
441 3300025913 Ga0207695_10050110 Ga0207695_100501105 269
442 3300025913 Ga0207695_10091436 Ga0207695_100914363 269
443 3300025914 Ga0207671_10041626 Ga0207671_100416263 269
444 3300025914 Ga0207671_10224004 Ga0207671_102240041 269
445 3300025914 Ga0207671_10356844 Ga0207671_103568442 269
446 3300025915 Ga0207693_10006247 Ga0207693_100062473 269
447 3300025915 Ga0207693_10013435 Ga0207693_100134352 269
448 3300025915 Ga0207693_10104950 Ga0207693_101049502 269
449 3300025915 Ga0207693_10213259 Ga0207693_102132592 269
450 3300025916 Ga0207663_10024240 Ga0207663_100242404 269
451 3300025916 Ga0207663_10043599 Ga0207663_100435992 269
452 3300025916 Ga0207663_10048161 Ga0207663_100481612 269
453 3300025916 Ga0207663_10101790 Ga0207663_101017902 269
454 3300025916 Ga0207663_10119086 Ga0207663_101190862 269
455 3300025916 Ga0207663_10361902 Ga0207663_103619021 269
456 3300025917 Ga0207660_10021689 Ga0207660_100216892 269
457 3300025917 Ga0207660_10218589 Ga0207660_102185892 269
458 3300025918 Ga0207662_10005190 Ga0207662_100051902 269
459 3300025919 Ga0207657_10002904 Ga0207657_100029045 269
460 3300025919 Ga0207657_10010709 Ga0207657_100107097 269
461 3300025920 Ga0207649_10000805 Ga0207649_1000080515 269
462 3300025920 Ga0207649_10049606 Ga0207649_100496062 269
463 3300025921 Ga0207652_10032433 Ga0207652_100324333 269
464 3300025922 Ga0207646_10001082 Ga0207646_1000108231 269
465 3300025922 Ga0207646_10348499 Ga0207646_103484992 269
466 3300025924 Ga0207694_10014336 Ga0207694_100143365 269
467 3300025925 Ga0207650_10000541 Ga0207650_1000054111 269
468 3300025925 Ga0207650_10051627 Ga0207650_100516272 269
469 3300025926 Ga0207659_10530889 Ga0207659_105308891 269
470 3300025927 Ga0207687_10044605 Ga0207687_100446053 269
471 3300025928 Ga0207700_10025389 Ga0207700_100253894 269
472 3300025928 Ga0207700_10052049 Ga0207700_100520492 269
473 3300025929 Ga0207664_10034005 Ga0207664_100340053 269
474 3300025929 Ga0207664_10158186 Ga0207664_101581862 269
475 3300025929 Ga0207664_10623601 Ga0207664_106236011 269
476 3300025932 Ga0207690_10007013 Ga0207690_100070134 269
477 3300025933 Ga0207706_10000422 Ga0207706_1000042219 269
478 3300025933 Ga0207706_10011326 Ga0207706_100113266 269
479 3300025934 Ga0207686_10061030 Ga0207686_100610302 269
480 3300025934 Ga0207686_10257465 Ga0207686_102574652 269
481 3300025935 Ga0207709_10155063 Ga0207709_101550632 269
482 3300025936 Ga0207670_10014075 Ga0207670_100140755 269
483 3300025937 Ga0207669_10053980 Ga0207669_100539802 269
484 3300025938 Ga0207704_10037565 Ga0207704_100375653 269
485 3300025938 Ga0207704_10240806 Ga0207704_102408061 269
486 3300025939 Ga0207665_10003604 Ga0207665_100036044 269
487 3300025939 Ga0207665_10006549 Ga0207665_100065497 269
488 3300025939 Ga0207665_10021583 Ga0207665_100215833 269
489 3300025939 Ga0207665_10054345 Ga0207665_100543453 269
490 3300025939 Ga0207665_10293879 Ga0207665_102938791 269
491 3300025940 Ga0207691_10013015 Ga0207691_100130156 269
492 3300025941 Ga0207711_10003693 Ga0207711_100036932 269
493 3300025941 Ga0207711_10049334 Ga0207711_100493342 269
494 3300025941 Ga0207711_10066058 Ga0207711_100660582 269
495 3300025942 Ga0207689_10006458 Ga0207689_100064584 269
496 3300025942 Ga0207689_10021789 Ga0207689_100217894 269
497 3300025942 Ga0207689_10108082 Ga0207689_101080822 269
498 3300025944 Ga0207661_10000122 Ga0207661_1000012210 269
499 3300025944 Ga0207661_10113114 Ga0207661_101131142 269
500 3300025945 Ga0207679_10000870 Ga0207679_1000087014 269
501 3300025949 Ga0207667_10059034 Ga0207667_100590344 269
502 3300025960 Ga0207651_10055104 Ga0207651_100551042 269
503 3300025961 Ga0207712_10006304 Ga0207712_100063045 269
504 3300025961 Ga0207712_10101111 Ga0207712_101011111 269
505 3300025986 Ga0207658_10029528 Ga0207658_100295282 269
506 3300025986 Ga0207658_10356105 Ga0207658_103561052 269
507 3300026023 Ga0207677_10077465 Ga0207677_100774653 269
508 3300026041 Ga0207639_10045561 Ga0207639_100455612 269
509 3300026041 Ga0207639_10065775 Ga0207639_100657753 269
510 3300026067 Ga0207678_10006987 Ga0207678_100069877 269
511 3300026067 Ga0207678_10010978 Ga0207678_100109783 269
512 3300026075 Ga0207708_10029102 Ga0207708_100291022 269
513 3300026078 Ga0207702_10053189 Ga0207702_100531893 269
514 3300026088 Ga0207641_10000006 Ga0207641_10000006401 269
515 3300026088 Ga0207641_10008817 Ga0207641_100088174 269
516 3300026088 Ga0207641_10035064 Ga0207641_100350642 269
517 3300026089 Ga0207648_10004897 Ga0207648_100048977 269
518 3300026089 Ga0207648_10014821 Ga0207648_100148216 269
519 3300026089 Ga0207648_10058037 Ga0207648_100580373 269
520 3300026095 Ga0207676_10002394 Ga0207676_1000239414 269
521 3300026095 Ga0207676_10049793 Ga0207676_100497932 269
522 3300026116 Ga0207674_10000537 Ga0207674_1000053754 269
523 3300026116 Ga0207674_10111201 Ga0207674_101112011 269
524 3300026118 Ga0207675_100090911 Ga0207675_1000909114 269
525 3300026121 Ga0207683_10008965 Ga0207683_100089656 269
526 3300027671 Ga0209588_1003190 Ga0209588_10031904 269
527 3300027907 Ga0207428_10057949 Ga0207428_100579492 269
528 3300027907 Ga0207428_10109057 Ga0207428_101090572 269
529 3300028379 Ga0268266_10000153 Ga0268266_1000015373 269
530 3300028379 Ga0268266_10018739 Ga0268266_100187392 269
531 3300028380 Ga0268265_10008649 Ga0268265_100086496 269
532 3300028380 Ga0268265_10269091 Ga0268265_102690911 269
533 3300028381 Ga0268264_10010247 Ga0268264_100102475 269
534 3300028381 Ga0268264_10115491 Ga0268264_101154912 269
535 3300028381 Ga0268264_10191092 Ga0268264_101910921 269
536 3300028381 Ga0268264_10255651 Ga0268264_102556512 269
537 3300031901 Ga0307406_10048452 Ga0307406_100484522 269
538 3300034820 Ga0373959_0007585 Ga0373959_0007585_927_1784 269
539 3300035083 Ga0373926_0019759 Ga0373926_0019759_826_1683 269
540 3300035113 Ga0373936_0029722 Ga0373936_0029722_109_966 269
541 3300035116 Ga0373945_0019458 Ga0373945_0019458_1447_2307 269
542 3300035121 Ga0373960_0030037 Ga0373960_0030037_531_1388 269
543 3300035170 Ga0373943_0085918 Ga0373943_0085918_266_1123 269
544 3300035410 Ga0373924_0006511 Ga0373924_0006511_3078_3935 269
545 3300035692 Ga0373935_0027419 Ga0373935_0027419_209_1066 269
546 3300035692 Ga0373935_0044677 Ga0373935_0044677_66_923 269
547 3300035692 Ga0373935_0049405 Ga0373935_0049405_1601_2455 269
548 3300035692 Ga0373935_0140849 Ga0373935_0140849_677_1555 269
549 3300035725 Ga0373947_0002984 Ga0373947_0002984_8589_9446 269
550 3300035725 Ga0373947_0013631 Ga0373947_0013631_2758_3615 269
551 3300037068 Ga0373925_0004780 Ga0373925_0004780_1719_2576 269
552 3300037418 Ga0395900_0353860 Ga0395900_0353860_161_1018 269
553 3300037471 Ga0395905_0287269 Ga0395905_0287269_96_953 269
554 3300038996 Ga0242420_010991 Ga0242420_010991_551_1408 269
555 3300039438 Ga0436360_0977840 Ga0436360_0977840_7226_8083 269
556 3300046459 Ga0495629_0005723 Ga0495629_0005723_316_1176 269
557 3300046472 Ga0495580_0000108 Ga0495580_0000108_5612_6472 269
558 3300046472 Ga0495580_0005408 Ga0495580_0005408_1702_2559 269
559 3300046472 Ga0495580_0096968 Ga0495580_0096968_1151_2008 269
560 3300046473 Ga0495582_0012719 Ga0495582_0012719_312_1169 269
561 3300046473 Ga0495582_0097146 Ga0495582_0097146_426_1283 269
562 3300046475 Ga0495639_0019273 Ga0495639_0019273_341_1198 269
563 3300046476 Ga0495662_0042533 Ga0495662_0042533_141_998 269
564 3300046499 Ga0495594_0058332 Ga0495594_0058332_856_1713 269
565 3300046517 Ga0495630_0171617 Ga0495630_0171617_514_1371 269
566 3300046526 Ga0495666_0034022 Ga0495666_0034022_1386_2243 269
567 3300046526 Ga0495666_0076974 Ga0495666_0076974_672_1529 269
568 3300046528 Ga0495642_0026558 Ga0495642_0026558_178_1035 269
569 3300046531 Ga0495665_0003170 Ga0495665_0003170_3313_4170 269
570 3300046533 Ga0495640_0010832 Ga0495640_0010832_5813_6670 269
571 3300046536 Ga0495587_0062696 Ga0495587_0062696_1175_2032 269
572 3300046616 Ga0495668_0048806 Ga0495668_0048806_1190_2047 269
573 3300046663 Ga0495635_0036911 Ga0495635_0036911_276_1133 269
574 3300046664 Ga0495659_0031677 Ga0495659_0031677_582_1439 269
575 3300046683 Ga0495658_0234208 Ga0495658_0234208_172_1029 269
576 3300046684 Ga0495669_0057623 Ga0495669_0057623_119_976 269
577 3300047315 Ga0495581_0019569 Ga0495581_0019569_1014_1871 269
578 3300047315 Ga0495581_0121185 Ga0495581_0121185_115_972 269
579 3300047319 Ga0495674_0150196 Ga0495674_0150196_385_1242 269
580 3300047321 Ga0495676_0005055 Ga0495676_0005055_557_1414 269
581 3300047322 Ga0495680_0031898 Ga0495680_0031898_571_1428 269
582 3300047444 Ga0495675_0315359 Ga0495675_0315359_34_891 269
583 3300047445 Ga0495677_0082476 Ga0495677_0082476_45_902 269
584 3300047445 Ga0495677_0084334 Ga0495677_0084334_283_1140 269
585 3300047471 Ga0495684_0015514 Ga0495684_0015514_4457_5314 269
586 3300047673 Ga0495593_0064183 Ga0495593_0064183_430_1287 269
587 3300048089 Ga0495614_0054323 Ga0495614_0054323_802_1659 269
588 3300048904 Ga0496101_0280035 Ga0496101_0280035_251_1129 269
589 3300048905 Ga0496102_0026378 Ga0496102_0026378_3323_4198 269
590 3300048905 Ga0496102_0149961 Ga0496102_0149961_1205_2062 269
591 3300048905 Ga0496102_0180314 Ga0496102_0180314_820_1674 269
592 3300048911 Ga0496108_0000258 Ga0496108_0000258_2276_3130 269
593 3300048911 Ga0496108_0088054 Ga0496108_0088054_959_1816 269
594 3300048912 Ga0496109_0000781 Ga0496109_0000781_13277_14131 269
595 3300048912 Ga0496109_0095978 Ga0496109_0095978_788_1645 269
596 3300048913 Ga0496110_0009726 Ga0496110_0009726_2347_3201 269
597 3300048914 Ga0496111_0248741 Ga0496111_0248741_388_1245 269
598 3300048915 Ga0496112_0000081 Ga0496112_0000081_13390_14244 269
599 3300048915 Ga0496112_0052552 Ga0496112_0052552_842_1720 269
600 3300048918 Ga0496115_0100316 Ga0496115_0100316_1483_2340 269
601 3300050507 nmdc:mga05p37_203520_c1 nmdc:mga05p37_203520_c1_1164_2021 269
602 3300050507 nmdc:mga05p37_372366_c1 nmdc:mga05p37_372366_c1_775_1632 269
603 3300050507 nmdc:mga05p37_487639_c1 nmdc:mga05p37_487639_c1_146_1003 269
604 3300050511 nmdc:mga08y16_167076_c1 nmdc:mga08y16_167076_c1_1235_2092 269
605 3300050511 nmdc:mga08y16_85833_c1 nmdc:mga08y16_85833_c1_93_950 269
606 3300050512 nmdc:mga0n895_140048_c1 nmdc:mga0n895_140048_c1_140_997 269
607 3300050512 nmdc:mga0n895_30980_c1 nmdc:mga0n895_30980_c1_1462_2319 269
608 3300050512 nmdc:mga0n895_33308_c1 nmdc:mga0n895_33308_c1_1067_1924 269
609 3300050512 nmdc:mga0n895_3497_c1 nmdc:mga0n895_3497_c1_2359_3216 269
610 3300050512 nmdc:mga0n895_545380_c1 nmdc:mga0n895_545380_c1_249_1106 269
611 3300050513 nmdc:mga0rr50_193491_c1 nmdc:mga0rr50_193491_c1_436_1293 269
612 3300050513 nmdc:mga0rr50_31228_c1 nmdc:mga0rr50_31228_c1_1524_2381 269
613 3300050513 nmdc:mga0rr50_3238_c1 nmdc:mga0rr50_3238_c1_934_1791 269
614 3300050514 nmdc:mga08x19_202301_c1 nmdc:mga08x19_202301_c1_212_1069 269
615 3300050514 nmdc:mga08x19_24077_c1 nmdc:mga08x19_24077_c1_802_1659 269
616 3300050514 nmdc:mga08x19_307507_c1 nmdc:mga08x19_307507_c1_162_1019 269
617 3300050515 nmdc:mga0a205_20565_c1 nmdc:mga0a205_20565_c1_993_1850 269
618 3300050515 nmdc:mga0a205_265451_c1 nmdc:mga0a205_265451_c1_262_1119 269
619 3300050515 nmdc:mga0a205_498_c1 nmdc:mga0a205_498_c1_16162_17019 269
620 3300053077 Ga0495601_0044209 Ga0495601_0044209_147_1004 269
621 3300053085 Ga0495619_0013452 Ga0495619_0013452_1573_2451 269

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00487

FA_desaturase

Fatty acid desaturase

79

294

0.62

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zyo-assembly1.cif.gz_A crystal structure of human integral membrane stearoyl-coa desaturase with substrate 0.6476 7 251
4zyo-assembly1.cif.gz_A crystal structure of human integral membrane stearoyl-coa desaturase with substrate 0.577 7 251
3m15-assembly1.cif.gz_C a zn-mediated asymmetric trimer of a cytochrome cb562 variant (d74a-ridc1) 0.2927 91 173
3qvy-assembly1.cif.gz_C crystal structure of the zn-ridc1 complex stabilized by bmoe crosslinks 0.2924 82 169
3tom-assembly1.cif.gz_D crystal structure of an engineered cytochrome cb562 that forms 2d, zn-mediated sheets 0.2745 91 178
ID Description Score Start End Superfamily
af_A0A1D8PRP1_310_424_1.20.1310.10 Mainly Alpha;Up-down Bundle;5 helical Cullin repeat like;Cullin Repeats 0.2778 50 169 1.20.1310.10
af_Q4D9T1_7_123_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.273 53 169 1.20.140.150
af_Q9XXM8_153_384_1.10.565.10 Mainly Alpha;Orthogonal Bundle;Retinoid X Receptor;Retinoid X Receptor 0.2546 14 171 1.10.565.10
af_A0A1D8PRP1_310_424_1.20.1310.10 Mainly Alpha;Up-down Bundle;5 helical Cullin repeat like;Cullin Repeats 0.2523 50 169 1.20.1310.10
af_Q4D9T1_7_123_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.2468 53 169 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A2V9QNR1-F1-model_v4 Fatty acid desaturase domain-containing protein 0.8714 1 269 GO:0006633
GO:0016020
GO:0016717
AF-A0A2V9QNR1-F1-model_v4 Fatty acid desaturase domain-containing protein 0.8684 1 269 GO:0006633
GO:0016020
GO:0016717
AF-A0A2V6Z1P2-F1-model_v4 Fatty acid desaturase domain-containing protein 0.8526 80 269 GO:0006629
GO:0016020
GO:0016717
AF-A0A2V6Z1P2-F1-model_v4 Fatty acid desaturase domain-containing protein 0.8447 80 269 GO:0006629
GO:0016020
GO:0016717
AF-A0A3M2DHX1-F1-model_v4 Acyl-CoA desaturase 0.7843 40 263 GO:0006633
GO:0016020
GO:0016717

Feature Viewer

pLDDT pTM Quality
73.77 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map