F469994
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 621 | 281 | 621 | 283 |
Family's Representative Sequence
| Representative Sequence | 3300013297|Ga0157378_10021184|Ga0157378_100211846 |
| Length | 335 |
| Sequence | MSHTESRKERFVESPCRTSHWQKAKRSSNLFEVSFETRSDFCLNEPTGSYVKIYNITGYLIILAYLLACMYSAPPHWGPWRGMLIGGAYFILCWFLGGLYLADVLHLGIAHRSLDYKEWFIKTVTMVTNTFAIYVDPIAWVNRHRLHHKHSDHPGDPNKLSDDGFWRTLYLCMMPYQCKENLAGDKILKSRTFRIAASPFFAIPVQIFSFWLLWKLAGSLLFTLVMWVGMRIFALWVNMIQNYWTHTRRFGYRRYHDEDDNAMNIGEWLPVTATFSACLQNNHHHYEGLLRLSHDKSEYDFGFLTVKVMRSLGLVTATRSGAEIPKDIPLDALGF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 74 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 75 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 80 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 86 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 87 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 118 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 183 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 187 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 188 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 189 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 190 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 191 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 192 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 193 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 194 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 195 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 196 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 197 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 198 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 199 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 200 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 201 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 202 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 203 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 204 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 205 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 206 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 207 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 208 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 211 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 212 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 213 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 214 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 215 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 216 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 253 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 254 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 255 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 258 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 259 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 260 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 261 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 262 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 263 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 271 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.13 |
| Nodule | 0 |
| Rhizoplane | 3.06 |
| Rhizosphere | 94.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10021092 | 3300001991 | Bacteria | 1243 |
| 2 | rootL2_10033750 | 3300003322 | Bacteria | 1874 |
| 3 | rootH1_10031980 | 3300003323 | Bacteria | 6285 |
| 4 | Ga0065712_10069049 | 3300005290 | Bacteria | 8163 |
| 5 | Ga0065715_10024814 | 3300005293 | Bacteria | 1916 |
| 6 | Ga0065715_10036964 | 3300005293 | Bacteria | 1240 |
| 7 | Ga0065715_10112861 | 3300005293 | Bacteria | 2513 |
| 8 | Ga0065715_10113544 | 3300005293 | Unclassified | 2485 |
| 9 | Ga0065715_10143614 | 3300005293 | Bacteria | 1818 |
| 10 | Ga0065715_10194679 | 3300005293 | Unclassified | 1395 |
| 11 | Ga0065707_10000678 | 3300005295 | Bacteria | 18643 |
| 12 | Ga0070658_10303263 | 3300005327 | Unclassified | 1362 |
| 13 | Ga0070676_10022896 | 3300005328 | Bacteria | 3506 |
| 14 | Ga0070676_10027408 | 3300005328 | Bacteria | 3231 |
| 15 | Ga0070676_10324080 | 3300005328 | Bacteria | 1052 |
| 16 | Ga0070683_100011805 | 3300005329 | Bacteria | 7566 |
| 17 | Ga0070683_100023642 | 3300005329 | Bacteria | 5498 |
| 18 | Ga0070690_100042724 | 3300005330 | Bacteria | 2871 |
| 19 | Ga0070690_100072890 | 3300005330 | Bacteria | 2234 |
| 20 | Ga0070690_100107793 | 3300005330 | Unclassified | 1855 |
| 21 | Ga0070670_100481102 | 3300005331 | Bacteria | 1103 |
| 22 | Ga0068869_100009992 | 3300005334 | Bacteria | 6170 |
| 23 | Ga0068869_100030447 | 3300005334 | Bacteria | 3788 |
| 24 | Ga0068869_100304113 | 3300005334 | Unclassified | 1289 |
| 25 | Ga0070666_10056567 | 3300005335 | Bacteria | 2649 |
| 26 | Ga0070666_10187165 | 3300005335 | Bacteria | 1454 |
| 27 | Ga0070680_100049594 | 3300005336 | Bacteria | 3423 |
| 28 | Ga0070680_100059949 | 3300005336 | Bacteria | 3114 |
| 29 | Ga0070682_100010640 | 3300005337 | Bacteria | 5227 |
| 30 | Ga0070682_100089918 | 3300005337 | Unclassified | 2006 |
| 31 | Ga0068868_100001613 | 3300005338 | Bacteria | 15382 |
| 32 | Ga0068868_100055431 | 3300005338 | Bacteria | 3127 |
| 33 | Ga0068868_100061139 | 3300005338 | Bacteria | 2984 |
| 34 | Ga0068868_100080560 | 3300005338 | Bacteria | 2610 |
| 35 | Ga0070660_100008847 | 3300005339 | Bacteria | 7058 |
| 36 | Ga0070660_100030704 | 3300005339 | Bacteria | 4032 |
| 37 | Ga0070689_100035604 | 3300005340 | Bacteria | 3804 |
| 38 | Ga0070691_10060911 | 3300005341 | Bacteria | 1815 |
| 39 | Ga0070661_100017817 | 3300005344 | Bacteria | 5041 |
| 40 | Ga0070661_100020336 | 3300005344 | Bacteria | 4733 |
| 41 | Ga0070661_100058534 | 3300005344 | Unclassified | 2824 |
| 42 | Ga0070668_100003846 | 3300005347 | Bacteria | 11082 |
| 43 | Ga0070669_100003738 | 3300005353 | Bacteria | 10994 |
| 44 | Ga0070669_100016855 | 3300005353 | Bacteria | 5215 |
| 45 | Ga0070669_100091373 | 3300005353 | Unclassified | 2283 |
| 46 | Ga0070675_100007041 | 3300005354 | Bacteria | 8647 |
| 47 | Ga0070675_100081418 | 3300005354 | Bacteria | 2700 |
| 48 | Ga0070675_100384695 | 3300005354 | Bacteria | 1249 |
| 49 | Ga0070675_100601620 | 3300005354 | Unclassified | 997 |
| 50 | Ga0070674_100048435 | 3300005356 | Bacteria | 2917 |
| 51 | Ga0070674_100077800 | 3300005356 | Bacteria | 2362 |
| 52 | Ga0070674_100181528 | 3300005356 | Unclassified | 1612 |
| 53 | Ga0070673_100390299 | 3300005364 | Bacteria | 1243 |
| 54 | Ga0070673_100416796 | 3300005364 | Unclassified | 1203 |
| 55 | Ga0070688_100067514 | 3300005365 | Unclassified | 2278 |
| 56 | Ga0070659_100026695 | 3300005366 | Bacteria | 4445 |
| 57 | Ga0070659_100057244 | 3300005366 | Bacteria | 3073 |
| 58 | Ga0070659_100422016 | 3300005366 | Bacteria | 1128 |
| 59 | Ga0070667_100018774 | 3300005367 | Bacteria | 5734 |
| 60 | Ga0070667_100419494 | 3300005367 | Unclassified | 1220 |
| 61 | Ga0070667_100633567 | 3300005367 | Unclassified | 986 |
| 62 | Ga0070709_10066606 | 3300005434 | Bacteria | 2311 |
| 63 | Ga0070709_10076676 | 3300005434 | Unclassified | 2172 |
| 64 | Ga0070709_10125818 | 3300005434 | Unclassified | 1743 |
| 65 | Ga0070714_100000123 | 3300005435 | Bacteria | 61492 |
| 66 | Ga0070714_100023222 | 3300005435 | Bacteria | 5091 |
| 67 | Ga0070714_100148138 | 3300005435 | Unclassified | 2113 |
| 68 | Ga0070714_100182155 | 3300005435 | Unclassified | 1912 |
| 69 | Ga0070713_100059810 | 3300005436 | Bacteria | 3184 |
| 70 | Ga0070713_100084718 | 3300005436 | Unclassified | 2713 |
| 71 | Ga0070711_100005305 | 3300005439 | Bacteria | 7696 |
| 72 | Ga0070711_100032874 | 3300005439 | Bacteria | 3452 |
| 73 | Ga0070711_100052163 | 3300005439 | Bacteria | 2813 |
| 74 | Ga0070705_100000663 | 3300005440 | Bacteria | 19708 |
| 75 | Ga0070694_100001150 | 3300005444 | Bacteria | 15195 |
| 76 | Ga0070694_100052387 | 3300005444 | Bacteria | 2758 |
| 77 | Ga0070663_100008376 | 3300005455 | Bacteria | 6355 |
| 78 | Ga0070663_100041450 | 3300005455 | Bacteria | 3229 |
| 79 | Ga0070662_100022071 | 3300005457 | Unclassified | 4353 |
| 80 | Ga0070662_100092230 | 3300005457 | Bacteria | 2276 |
| 81 | Ga0070681_10003152 | 3300005458 | Bacteria | 15334 |
| 82 | Ga0068867_100009422 | 3300005459 | Bacteria | 6888 |
| 83 | Ga0068867_100016970 | 3300005459 | Bacteria | 5174 |
| 84 | Ga0068867_100434737 | 3300005459 | Bacteria | 1115 |
| 85 | Ga0070707_100004315 | 3300005468 | Bacteria | 13324 |
| 86 | Ga0070707_100416540 | 3300005468 | Bacteria | 1304 |
| 87 | Ga0070698_100140325 | 3300005471 | Bacteria | 2368 |
| 88 | Ga0070699_100051162 | 3300005518 | Bacteria | 3576 |
| 89 | Ga0070699_100325699 | 3300005518 | Unclassified | 1381 |
| 90 | Ga0070679_100003174 | 3300005530 | Bacteria | 15016 |
| 91 | Ga0070679_100140815 | 3300005530 | Bacteria | 2392 |
| 92 | Ga0070684_100003724 | 3300005535 | Bacteria | 11503 |
| 93 | Ga0070684_100036988 | 3300005535 | Bacteria | 4185 |
| 94 | Ga0070684_100135468 | 3300005535 | Bacteria | 2224 |
| 95 | Ga0070697_100008830 | 3300005536 | Bacteria | 7863 |
| 96 | Ga0070697_100094699 | 3300005536 | Bacteria | 2475 |
| 97 | Ga0068853_100052882 | 3300005539 | Bacteria | 3497 |
| 98 | Ga0068853_100090113 | 3300005539 | Unclassified | 2695 |
| 99 | Ga0068853_100124880 | 3300005539 | Bacteria | 2298 |
| 100 | Ga0070672_100213398 | 3300005543 | Bacteria | 1617 |
| 101 | Ga0070686_100027428 | 3300005544 | Bacteria | 3447 |
| 102 | Ga0070686_100197980 | 3300005544 | Unclassified | 1438 |
| 103 | Ga0070695_100000212 | 3300005545 | Bacteria | 28184 |
| 104 | Ga0070695_100009596 | 3300005545 | Bacteria | 5764 |
| 105 | Ga0070695_100021230 | 3300005545 | Unclassified | 3970 |
| 106 | Ga0070696_100000342 | 3300005546 | Bacteria | 28263 |
| 107 | Ga0070693_100043247 | 3300005547 | Unclassified | 2543 |
| 108 | Ga0070693_100128465 | 3300005547 | Unclassified | 1581 |
| 109 | Ga0070665_100001100 | 3300005548 | Bacteria | 33366 |
| 110 | Ga0070665_100127018 | 3300005548 | Bacteria | 2552 |
| 111 | Ga0070704_100099598 | 3300005549 | Archaea | 2186 |
| 112 | Ga0068855_100022005 | 3300005563 | Bacteria | 7645 |
| 113 | Ga0070664_100000932 | 3300005564 | Bacteria | 22876 |
| 114 | Ga0068857_100000442 | 3300005577 | Bacteria | 29452 |
| 115 | Ga0068857_100001653 | 3300005577 | Bacteria | 17904 |
| 116 | Ga0068857_100352266 | 3300005577 | Bacteria | 1363 |
| 117 | Ga0068854_100001434 | 3300005578 | Bacteria | 14427 |
| 118 | Ga0068854_100058554 | 3300005578 | Bacteria | 2781 |
| 119 | Ga0068856_100000917 | 3300005614 | Bacteria | 31559 |
| 120 | Ga0068856_100003158 | 3300005614 | Bacteria | 16799 |
| 121 | Ga0070702_100018028 | 3300005615 | Bacteria | 3654 |
| 122 | Ga0070702_100056937 | 3300005615 | Unclassified | 2260 |
| 123 | Ga0070702_100094015 | 3300005615 | Bacteria | 1824 |
| 124 | Ga0068852_100026368 | 3300005616 | Bacteria | 4722 |
| 125 | Ga0068852_100115362 | 3300005616 | Bacteria | 2449 |
| 126 | Ga0068859_100000714 | 3300005617 | Bacteria | 33489 |
| 127 | Ga0068859_100093113 | 3300005617 | Bacteria | 3065 |
| 128 | Ga0068864_100033719 | 3300005618 | Bacteria | 4353 |
| 129 | Ga0068864_100050254 | 3300005618 | Bacteria | 3588 |
| 130 | Ga0068864_100452521 | 3300005618 | Bacteria | 1228 |
| 131 | Ga0068866_10007929 | 3300005718 | Bacteria | 4458 |
| 132 | Ga0068866_10019181 | 3300005718 | Bacteria | 3107 |
| 133 | Ga0068866_10023697 | 3300005718 | Bacteria | 2858 |
| 134 | Ga0068861_100163197 | 3300005719 | Bacteria | 1840 |
| 135 | Ga0068851_10186170 | 3300005834 | Bacteria | 1152 |
| 136 | Ga0068863_100014480 | 3300005841 | Bacteria | 7595 |
| 137 | Ga0068863_100052371 | 3300005841 | Bacteria | 3869 |
| 138 | Ga0068863_100077099 | 3300005841 | Bacteria | 3154 |
| 139 | Ga0068858_100002139 | 3300005842 | Bacteria | 20024 |
| 140 | Ga0068858_100059202 | 3300005842 | Bacteria | 3540 |
| 141 | Ga0068858_100129461 | 3300005842 | Bacteria | 2365 |
| 142 | Ga0068858_100189223 | 3300005842 | Bacteria | 1945 |
| 143 | Ga0068860_100003784 | 3300005843 | Bacteria | 15568 |
| 144 | Ga0068860_100014306 | 3300005843 | Bacteria | 7780 |
| 145 | Ga0068860_100014493 | 3300005843 | Bacteria | 7717 |
| 146 | Ga0068860_100124105 | 3300005843 | Bacteria | 2475 |
| 147 | Ga0068862_100017030 | 3300005844 | Bacteria | 6046 |
| 148 | Ga0068862_100052116 | 3300005844 | Bacteria | 3500 |
| 149 | Ga0068862_100052753 | 3300005844 | Bacteria | 3480 |
| 150 | Ga0068862_100053056 | 3300005844 | Bacteria | 3470 |
| 151 | Ga0068862_100307964 | 3300005844 | Archaea | 1459 |
| 152 | Ga0068862_100331722 | 3300005844 | Unclassified | 1407 |
| 153 | Ga0070717_10117584 | 3300006028 | Bacteria | 2274 |
| 154 | Ga0070717_10201162 | 3300006028 | Unclassified | 1745 |
| 155 | Ga0070715_10053962 | 3300006163 | Bacteria | 1739 |
| 156 | Ga0070716_100007249 | 3300006173 | Bacteria | 5453 |
| 157 | Ga0070716_100024242 | 3300006173 | Bacteria | 3228 |
| 158 | Ga0070716_100044487 | 3300006173 | Bacteria | 2488 |
| 159 | Ga0070716_100083268 | 3300006173 | Unclassified | 1915 |
| 160 | Ga0070716_100214092 | 3300006173 | Unclassified | 1290 |
| 161 | Ga0070712_100002091 | 3300006175 | Bacteria | 12260 |
| 162 | Ga0070712_100010248 | 3300006175 | Bacteria | 5909 |
| 163 | Ga0070712_100062998 | 3300006175 | Bacteria | 2624 |
| 164 | Ga0075362_10000228 | 3300006177 | Bacteria | 15674 |
| 165 | Ga0075362_10102924 | 3300006177 | Unclassified | 1337 |
| 166 | Ga0075367_10005874 | 3300006178 | Bacteria | 6152 |
| 167 | Ga0075366_10003831 | 3300006195 | Bacteria | 8010 |
| 168 | Ga0075366_10145880 | 3300006195 | Bacteria | 1432 |
| 169 | Ga0097621_100004225 | 3300006237 | Bacteria | 9974 |
| 170 | Ga0097621_100038748 | 3300006237 | Bacteria | 3825 |
| 171 | Ga0097621_100061936 | 3300006237 | Unclassified | 3070 |
| 172 | Ga0097621_100203119 | 3300006237 | Unclassified | 1721 |
| 173 | Ga0097621_100297113 | 3300006237 | Bacteria | 1426 |
| 174 | Ga0068871_100004186 | 3300006358 | Bacteria | 9991 |
| 175 | Ga0068871_100017036 | 3300006358 | Bacteria | 5488 |
| 176 | Ga0068871_100033688 | 3300006358 | Bacteria | 4058 |
| 177 | Ga0068871_100036145 | 3300006358 | Bacteria | 3931 |
| 178 | Ga0068871_100090402 | 3300006358 | Bacteria | 2550 |
| 179 | Ga0068871_100151462 | 3300006358 | Unclassified | 1978 |
| 180 | Ga0068871_100170941 | 3300006358 | Unclassified | 1863 |
| 181 | Ga0075428_100008493 | 3300006844 | Bacteria | 11393 |
| 182 | Ga0075428_100138746 | 3300006844 | Bacteria | 2643 |
| 183 | Ga0075428_100243538 | 3300006844 | Bacteria | 1940 |
| 184 | Ga0075430_100018752 | 3300006846 | Bacteria | 5888 |
| 185 | Ga0075433_10122648 | 3300006852 | Bacteria | 2308 |
| 186 | Ga0075433_10220768 | 3300006852 | Bacteria | 1684 |
| 187 | Ga0075434_100001290 | 3300006871 | Bacteria | 20908 |
| 188 | Ga0075434_100032547 | 3300006871 | Bacteria | 5141 |
| 189 | Ga0075434_100270384 | 3300006871 | Bacteria | 1719 |
| 190 | Ga0075434_100323337 | 3300006871 | Unclassified | 1563 |
| 191 | Ga0075434_100492122 | 3300006871 | Unclassified | 1247 |
| 192 | Ga0068865_100011639 | 3300006881 | Bacteria | 5513 |
| 193 | Ga0068865_100058967 | 3300006881 | Bacteria | 2683 |
| 194 | Ga0068865_100162061 | 3300006881 | Bacteria | 1707 |
| 195 | Ga0068865_100163236 | 3300006881 | Unclassified | 1701 |
| 196 | Ga0068865_100281853 | 3300006881 | Unclassified | 1323 |
| 197 | Ga0075436_100001976 | 3300006914 | Bacteria | 14140 |
| 198 | Ga0075436_100009496 | 3300006914 | Bacteria | 6653 |
| 199 | Ga0097620_100000714 | 3300006931 | Bacteria | 33489 |
| 200 | Ga0097620_100093116 | 3300006931 | Bacteria | 3065 |
| 201 | Ga0075435_100010778 | 3300007076 | Bacteria | 6694 |
| 202 | Ga0075435_100013603 | 3300007076 | Bacteria | 6060 |
| 203 | Ga0075435_100019396 | 3300007076 | Bacteria | 5194 |
| 204 | Ga0075435_100023710 | 3300007076 | Bacteria | 4751 |
| 205 | Ga0075435_100097373 | 3300007076 | Bacteria | 2434 |
| 206 | Ga0075435_100104965 | 3300007076 | Unclassified | 2345 |
| 207 | Ga0075435_100207217 | 3300007076 | Bacteria | 1662 |
| 208 | Ga0099794_10006654 | 3300007265 | Unclassified | 4694 |
| 209 | Ga0099794_10032704 | 3300007265 | Bacteria | 2443 |
| 210 | Ga0099794_10079018 | 3300007265 | Unclassified | 1620 |
| 211 | Ga0099794_10176703 | 3300007265 | Unclassified | 1089 |
| 212 | Ga0105251_10060846 | 3300009011 | Unclassified | 1777 |
| 213 | Ga0105240_10023460 | 3300009093 | Bacteria | 8157 |
| 214 | Ga0105240_10156870 | 3300009093 | Bacteria | 2706 |
| 215 | Ga0105240_10276320 | 3300009093 | Bacteria | 1932 |
| 216 | Ga0111539_10052204 | 3300009094 | Bacteria | 4867 |
| 217 | Ga0111539_10058321 | 3300009094 | Bacteria | 4580 |
| 218 | Ga0111539_10294913 | 3300009094 | Unclassified | 1887 |
| 219 | Ga0111539_10317730 | 3300009094 | Bacteria | 1812 |
| 220 | Ga0105245_10102507 | 3300009098 | Bacteria | 2650 |
| 221 | Ga0105245_10566046 | 3300009098 | Unclassified | 1160 |
| 222 | Ga0105245_10581692 | 3300009098 | Bacteria | 1144 |
| 223 | Ga0105247_10050787 | 3300009101 | Bacteria | 2552 |
| 224 | Ga0105247_10159760 | 3300009101 | Bacteria | 1491 |
| 225 | Ga0114129_10125277 | 3300009147 | Unclassified | 3533 |
| 226 | Ga0114129_10516999 | 3300009147 | Unclassified | 1557 |
| 227 | Ga0105243_10031438 | 3300009148 | Bacteria | 4093 |
| 228 | Ga0105241_10011928 | 3300009174 | Bacteria | 6383 |
| 229 | Ga0105241_10014749 | 3300009174 | Bacteria | 5720 |
| 230 | Ga0105241_10178609 | 3300009174 | Bacteria | 1759 |
| 231 | Ga0105241_10191681 | 3300009174 | Bacteria | 1702 |
| 232 | Ga0105242_10020850 | 3300009176 | Bacteria | 5141 |
| 233 | Ga0105242_10030613 | 3300009176 | Bacteria | 4297 |
| 234 | Ga0105242_10033189 | 3300009176 | Bacteria | 4132 |
| 235 | Ga0105242_10423534 | 3300009176 | Archaea | 1248 |
| 236 | Ga0105248_10030534 | 3300009177 | Bacteria | 6018 |
| 237 | Ga0105237_10060274 | 3300009545 | Unclassified | 3797 |
| 238 | Ga0105237_10070511 | 3300009545 | Bacteria | 3491 |
| 239 | Ga0105237_10097734 | 3300009545 | Bacteria | 2927 |
| 240 | Ga0105237_10102605 | 3300009545 | Bacteria | 2852 |
| 241 | Ga0105237_10201063 | 3300009545 | Bacteria | 1992 |
| 242 | Ga0105238_10023968 | 3300009551 | Bacteria | 6222 |
| 243 | Ga0105238_10068429 | 3300009551 | Unclassified | 3552 |
| 244 | Ga0105238_10206403 | 3300009551 | Bacteria | 1941 |
| 245 | Ga0105238_10391190 | 3300009551 | Unclassified | 1382 |
| 246 | Ga0105249_10137474 | 3300009553 | Bacteria | 2340 |
| 247 | Ga0105249_10148504 | 3300009553 | Bacteria | 2254 |
| 248 | Ga0105249_10300536 | 3300009553 | Bacteria | 1610 |
| 249 | Ga0105249_10599049 | 3300009553 | Unclassified | 1156 |
| 250 | Ga0105249_10616199 | 3300009553 | Bacteria | 1141 |
| 251 | Ga0105239_10051087 | 3300010375 | Bacteria | 4533 |
| 252 | Ga0105239_10122505 | 3300010375 | Bacteria | 2889 |
| 253 | Ga0105239_10186624 | 3300010375 | Bacteria | 2321 |
| 254 | Ga0105239_10342510 | 3300010375 | Bacteria | 1687 |
| 255 | Ga0105239_10992156 | 3300010375 | Bacteria | 965 |
| 256 | Ga0105239_11041045 | 3300010375 | Bacteria | 941 |
| 257 | Ga0105246_10008240 | 3300011119 | Bacteria | 6402 |
| 258 | Ga0105246_10011169 | 3300011119 | Bacteria | 5566 |
| 259 | Ga0157371_10002531 | 3300013102 | Bacteria | 17360 |
| 260 | Ga0157371_10009000 | 3300013102 | Bacteria | 7896 |
| 261 | Ga0157370_10378268 | 3300013104 | Bacteria | 1304 |
| 262 | Ga0157369_10026983 | 3300013105 | Bacteria | 6370 |
| 263 | Ga0157369_10054471 | 3300013105 | Bacteria | 4319 |
| 264 | Ga0157369_10144141 | 3300013105 | Unclassified | 2519 |
| 265 | Ga0157374_10051608 | 3300013296 | Bacteria | 3827 |
| 266 | Ga0157374_10151114 | 3300013296 | Bacteria | 2258 |
| 267 | Ga0157374_10362468 | 3300013296 | Bacteria | 1441 |
| 268 | Ga0157378_10013851 | 3300013297 | Bacteria | 7054 |
| 269 | Ga0157378_10017861 | 3300013297 | Bacteria | 6226 |
| 270 | Ga0157378_10021184 | 3300013297 | Bacteria | 5718 |
| 271 | Ga0157378_10060610 | 3300013297 | Bacteria | 3376 |
| 272 | Ga0157378_10449380 | 3300013297 | Bacteria | 1279 |
| 273 | Ga0163162_10001837 | 3300013306 | Bacteria | 19975 |
| 274 | Ga0163162_10015898 | 3300013306 | Bacteria | 7354 |
| 275 | Ga0163162_10131861 | 3300013306 | Bacteria | 2608 |
| 276 | Ga0163162_10288319 | 3300013306 | Archaea | 1773 |
| 277 | Ga0157372_10022162 | 3300013307 | Bacteria | 6871 |
| 278 | Ga0157372_10171854 | 3300013307 | Bacteria | 2507 |
| 279 | Ga0157372_10285307 | 3300013307 | Bacteria | 1920 |
| 280 | Ga0157372_10496834 | 3300013307 | Unclassified | 1423 |
| 281 | Ga0157375_10000926 | 3300013308 | Bacteria | 25450 |
| 282 | Ga0157375_10096870 | 3300013308 | Bacteria | 3024 |
| 283 | Ga0157375_10356278 | 3300013308 | Bacteria | 1629 |
| 284 | Ga0163163_10001045 | 3300014325 | Bacteria | 23465 |
| 285 | Ga0163163_10087036 | 3300014325 | Bacteria | 3134 |
| 286 | Ga0163163_10246228 | 3300014325 | Unclassified | 1838 |
| 287 | Ga0163163_10369904 | 3300014325 | Bacteria | 1490 |
| 288 | Ga0163163_10691456 | 3300014325 | Unclassified | 1083 |
| 289 | Ga0157380_10025668 | 3300014326 | Bacteria | 4470 |
| 290 | Ga0157380_10086965 | 3300014326 | Bacteria | 2570 |
| 291 | Ga0182008_10006186 | 3300014497 | Bacteria | 6727 |
| 292 | Ga0157377_10006871 | 3300014745 | Bacteria | 5457 |
| 293 | Ga0157379_10120942 | 3300014968 | Bacteria | 2355 |
| 294 | Ga0157379_10493434 | 3300014968 | Bacteria | 1134 |
| 295 | Ga0157376_10000008 | 3300014969 | Bacteria | 351192 |
| 296 | Ga0157376_10014148 | 3300014969 | Bacteria | 5976 |
| 297 | Ga0157376_10209596 | 3300014969 | Bacteria | 1798 |
| 298 | Ga0157376_10283956 | 3300014969 | Unclassified | 1560 |
| 299 | Ga0163161_10062830 | 3300017792 | Bacteria | 2705 |
| 300 | Ga0224572_1004415 | 3300024225 | Bacteria | 2445 |
| 301 | Ga0207427_101369 | 3300025231 | Bacteria | 8969 |
| 302 | Ga0207666_1001439 | 3300025271 | Bacteria | 2803 |
| 303 | Ga0207697_10017770 | 3300025315 | Bacteria | 2922 |
| 304 | Ga0207642_10006910 | 3300025899 | Bacteria | 3801 |
| 305 | Ga0207642_10025406 | 3300025899 | Unclassified | 2396 |
| 306 | Ga0207642_10289064 | 3300025899 | Bacteria | 946 |
| 307 | Ga0207688_10044406 | 3300025901 | Bacteria | 2477 |
| 308 | Ga0207680_10044025 | 3300025903 | Bacteria | 2622 |
| 309 | Ga0207647_10000693 | 3300025904 | Bacteria | 26376 |
| 310 | Ga0207647_10004401 | 3300025904 | Bacteria | 10445 |
| 311 | Ga0207647_10005796 | 3300025904 | Bacteria | 9009 |
| 312 | Ga0207647_10059356 | 3300025904 | Bacteria | 2341 |
| 313 | Ga0207647_10175108 | 3300025904 | Bacteria | 1248 |
| 314 | Ga0207685_10171391 | 3300025905 | Unclassified | 999 |
| 315 | Ga0207699_10052954 | 3300025906 | Bacteria | 2405 |
| 316 | Ga0207645_10006290 | 3300025907 | Bacteria | 8535 |
| 317 | Ga0207645_10045903 | 3300025907 | Unclassified | 2791 |
| 318 | Ga0207645_10048393 | 3300025907 | Bacteria | 2715 |
| 319 | Ga0207643_10008423 | 3300025908 | Bacteria | 5534 |
| 320 | Ga0207705_10236740 | 3300025909 | Bacteria | 1390 |
| 321 | Ga0207684_10049788 | 3300025910 | Bacteria | 3554 |
| 322 | Ga0207654_10016071 | 3300025911 | Bacteria | 3892 |
| 323 | Ga0207654_10042046 | 3300025911 | Unclassified | 2584 |
| 324 | Ga0207707_10001132 | 3300025912 | Bacteria | 25271 |
| 325 | Ga0207707_10291980 | 3300025912 | Unclassified | 1411 |
| 326 | Ga0207695_10011852 | 3300025913 | Bacteria | 10515 |
| 327 | Ga0207695_10030416 | 3300025913 | Bacteria | 5943 |
| 328 | Ga0207695_10050110 | 3300025913 | Bacteria | 4395 |
| 329 | Ga0207695_10091436 | 3300025913 | Bacteria | 3057 |
| 330 | Ga0207671_10041626 | 3300025914 | Bacteria | 3400 |
| 331 | Ga0207671_10134742 | 3300025914 | Bacteria | 1898 |
| 332 | Ga0207671_10224004 | 3300025914 | Unclassified | 1474 |
| 333 | Ga0207671_10356844 | 3300025914 | Unclassified | 1160 |
| 334 | Ga0207693_10002042 | 3300025915 | Bacteria | 17708 |
| 335 | Ga0207693_10006247 | 3300025915 | Bacteria | 9879 |
| 336 | Ga0207693_10013435 | 3300025915 | Bacteria | 6603 |
| 337 | Ga0207693_10104950 | 3300025915 | Unclassified | 2216 |
| 338 | Ga0207693_10213259 | 3300025915 | Bacteria | 1517 |
| 339 | Ga0207663_10024240 | 3300025916 | Bacteria | 3493 |
| 340 | Ga0207663_10028594 | 3300025916 | Bacteria | 3264 |
| 341 | Ga0207663_10043599 | 3300025916 | Bacteria | 2748 |
| 342 | Ga0207663_10048161 | 3300025916 | Bacteria | 2636 |
| 343 | Ga0207663_10101790 | 3300025916 | Unclassified | 1931 |
| 344 | Ga0207663_10107532 | 3300025916 | Unclassified | 1887 |
| 345 | Ga0207663_10119086 | 3300025916 | Bacteria | 1804 |
| 346 | Ga0207663_10361902 | 3300025916 | Unclassified | 1101 |
| 347 | Ga0207660_10021689 | 3300025917 | Bacteria | 4322 |
| 348 | Ga0207660_10116322 | 3300025917 | Bacteria | 2019 |
| 349 | Ga0207660_10218589 | 3300025917 | Bacteria | 1494 |
| 350 | Ga0207662_10005190 | 3300025918 | Bacteria | 6913 |
| 351 | Ga0207662_10012438 | 3300025918 | Bacteria | 4740 |
| 352 | Ga0207657_10002904 | 3300025919 | Bacteria | 18395 |
| 353 | Ga0207657_10010709 | 3300025919 | Bacteria | 9132 |
| 354 | Ga0207649_10000805 | 3300025920 | Bacteria | 20142 |
| 355 | Ga0207649_10028410 | 3300025920 | Unclassified | 3293 |
| 356 | Ga0207649_10049606 | 3300025920 | Bacteria | 2593 |
| 357 | Ga0207652_10032433 | 3300025921 | Bacteria | 4392 |
| 358 | Ga0207646_10001082 | 3300025922 | Bacteria | 34670 |
| 359 | Ga0207646_10348499 | 3300025922 | Bacteria | 1338 |
| 360 | Ga0207681_10065019 | 3300025923 | Unclassified | 2520 |
| 361 | Ga0207694_10014336 | 3300025924 | Bacteria | 5976 |
| 362 | Ga0207650_10000541 | 3300025925 | Bacteria | 30916 |
| 363 | Ga0207650_10003584 | 3300025925 | Bacteria | 10652 |
| 364 | Ga0207650_10033277 | 3300025925 | Bacteria | 3732 |
| 365 | Ga0207650_10051627 | 3300025925 | Bacteria | 3043 |
| 366 | Ga0207659_10069120 | 3300025926 | Bacteria | 2571 |
| 367 | Ga0207659_10530889 | 3300025926 | Unclassified | 999 |
| 368 | Ga0207687_10044605 | 3300025927 | Bacteria | 3061 |
| 369 | Ga0207700_10025389 | 3300025928 | Bacteria | 4113 |
| 370 | Ga0207700_10026093 | 3300025928 | Bacteria | 4069 |
| 371 | Ga0207700_10052049 | 3300025928 | Unclassified | 3059 |
| 372 | Ga0207664_10000151 | 3300025929 | Bacteria | 55974 |
| 373 | Ga0207664_10034005 | 3300025929 | Bacteria | 3922 |
| 374 | Ga0207664_10158186 | 3300025929 | Unclassified | 1930 |
| 375 | Ga0207664_10336802 | 3300025929 | Bacteria | 1333 |
| 376 | Ga0207664_10623601 | 3300025929 | Unclassified | 969 |
| 377 | Ga0207690_10007013 | 3300025932 | Bacteria | 6680 |
| 378 | Ga0207706_10000422 | 3300025933 | Bacteria | 45508 |
| 379 | Ga0207706_10011326 | 3300025933 | Bacteria | 8125 |
| 380 | Ga0207706_10059770 | 3300025933 | Bacteria | 3357 |
| 381 | Ga0207706_10165994 | 3300025933 | Unclassified | 1940 |
| 382 | Ga0207686_10061030 | 3300025934 | Unclassified | 2389 |
| 383 | Ga0207686_10257465 | 3300025934 | Bacteria | 1278 |
| 384 | Ga0207709_10155063 | 3300025935 | Bacteria | 1591 |
| 385 | Ga0207670_10014075 | 3300025936 | Bacteria | 4736 |
| 386 | Ga0207669_10053980 | 3300025937 | Bacteria | 2425 |
| 387 | Ga0207669_10059107 | 3300025937 | Bacteria | 2343 |
| 388 | Ga0207704_10018029 | 3300025938 | Unclassified | 3676 |
| 389 | Ga0207704_10037565 | 3300025938 | Unclassified | 2798 |
| 390 | Ga0207704_10240806 | 3300025938 | Unclassified | 1352 |
| 391 | Ga0207665_10003604 | 3300025939 | Bacteria | 10343 |
| 392 | Ga0207665_10006549 | 3300025939 | Bacteria | 7722 |
| 393 | Ga0207665_10021583 | 3300025939 | Bacteria | 4236 |
| 394 | Ga0207665_10054345 | 3300025939 | Bacteria | 2700 |
| 395 | Ga0207665_10061121 | 3300025939 | Bacteria | 2553 |
| 396 | Ga0207665_10293879 | 3300025939 | Unclassified | 1212 |
| 397 | Ga0207691_10013015 | 3300025940 | Bacteria | 7967 |
| 398 | Ga0207711_10003693 | 3300025941 | Bacteria | 13202 |
| 399 | Ga0207711_10049334 | 3300025941 | Unclassified | 3604 |
| 400 | Ga0207711_10066058 | 3300025941 | Unclassified | 3128 |
| 401 | Ga0207689_10006458 | 3300025942 | Bacteria | 10366 |
| 402 | Ga0207689_10021789 | 3300025942 | Bacteria | 5388 |
| 403 | Ga0207689_10022628 | 3300025942 | Bacteria | 5281 |
| 404 | Ga0207689_10024913 | 3300025942 | Bacteria | 5015 |
| 405 | Ga0207689_10108082 | 3300025942 | Bacteria | 2286 |
| 406 | Ga0207661_10000122 | 3300025944 | Bacteria | 49562 |
| 407 | Ga0207661_10113114 | 3300025944 | Bacteria | 2300 |
| 408 | Ga0207679_10000870 | 3300025945 | Bacteria | 19277 |
| 409 | Ga0207667_10019087 | 3300025949 | Bacteria | 7665 |
| 410 | Ga0207667_10059034 | 3300025949 | Bacteria | 4020 |
| 411 | Ga0207667_10623184 | 3300025949 | Bacteria | 1086 |
| 412 | Ga0207651_10055104 | 3300025960 | Unclassified | 2728 |
| 413 | Ga0207712_10006304 | 3300025961 | Bacteria | 7481 |
| 414 | Ga0207712_10101111 | 3300025961 | Bacteria | 2143 |
| 415 | Ga0207640_10006013 | 3300025981 | Bacteria | 6632 |
| 416 | Ga0207658_10029528 | 3300025986 | Bacteria | 3873 |
| 417 | Ga0207658_10124752 | 3300025986 | Unclassified | 2059 |
| 418 | Ga0207658_10356105 | 3300025986 | Unclassified | 1276 |
| 419 | Ga0207677_10004810 | 3300026023 | Bacteria | 7291 |
| 420 | Ga0207677_10077465 | 3300026023 | Bacteria | 2371 |
| 421 | Ga0207703_10001646 | 3300026035 | Bacteria | 20097 |
| 422 | Ga0207703_10071609 | 3300026035 | Bacteria | 2864 |
| 423 | Ga0207639_10045561 | 3300026041 | Bacteria | 3304 |
| 424 | Ga0207639_10065775 | 3300026041 | Bacteria | 2815 |
| 425 | Ga0207639_10119809 | 3300026041 | Unclassified | 2160 |
| 426 | Ga0207678_10006987 | 3300026067 | Bacteria | 10021 |
| 427 | Ga0207678_10010978 | 3300026067 | Bacteria | 7956 |
| 428 | Ga0207708_10029102 | 3300026075 | Bacteria | 4185 |
| 429 | Ga0207708_10209444 | 3300026075 | Bacteria | 1558 |
| 430 | Ga0207702_10023459 | 3300026078 | Bacteria | 5117 |
| 431 | Ga0207702_10053189 | 3300026078 | Bacteria | 3427 |
| 432 | Ga0207702_10195372 | 3300026078 | Unclassified | 1872 |
| 433 | Ga0207641_10000006 | 3300026088 | Bacteria | 442569 |
| 434 | Ga0207641_10008817 | 3300026088 | Bacteria | 8330 |
| 435 | Ga0207641_10035064 | 3300026088 | Bacteria | 4178 |
| 436 | Ga0207641_10066104 | 3300026088 | Bacteria | 3095 |
| 437 | Ga0207648_10004897 | 3300026089 | Bacteria | 13649 |
| 438 | Ga0207648_10014821 | 3300026089 | Bacteria | 7191 |
| 439 | Ga0207648_10058037 | 3300026089 | Bacteria | 3376 |
| 440 | Ga0207648_10077629 | 3300026089 | Unclassified | 2895 |
| 441 | Ga0207648_10123753 | 3300026089 | Unclassified | 2275 |
| 442 | Ga0207648_10454049 | 3300026089 | Archaea | 1167 |
| 443 | Ga0207676_10002394 | 3300026095 | Bacteria | 13374 |
| 444 | Ga0207676_10049232 | 3300026095 | Unclassified | 3276 |
| 445 | Ga0207676_10049793 | 3300026095 | Bacteria | 3262 |
| 446 | Ga0207674_10000537 | 3300026116 | Bacteria | 49684 |
| 447 | Ga0207674_10001759 | 3300026116 | Bacteria | 27722 |
| 448 | Ga0207674_10111201 | 3300026116 | Bacteria | 2714 |
| 449 | Ga0207675_100019494 | 3300026118 | Bacteria | 6329 |
| 450 | Ga0207675_100090911 | 3300026118 | Bacteria | 2870 |
| 451 | Ga0207683_10008965 | 3300026121 | Bacteria | 8520 |
| 452 | Ga0207698_10063348 | 3300026142 | Unclassified | 2893 |
| 453 | Ga0209588_1003190 | 3300027671 | Bacteria | 4525 |
| 454 | Ga0207428_10057949 | 3300027907 | Bacteria | 3075 |
| 455 | Ga0207428_10078500 | 3300027907 | Bacteria | 2583 |
| 456 | Ga0207428_10109057 | 3300027907 | Bacteria | 2132 |
| 457 | Ga0268266_10000153 | 3300028379 | Bacteria | 131887 |
| 458 | Ga0268266_10018739 | 3300028379 | Bacteria | 5896 |
| 459 | Ga0268265_10008649 | 3300028380 | Bacteria | 6880 |
| 460 | Ga0268265_10269091 | 3300028380 | Bacteria | 1519 |
| 461 | Ga0268264_10010247 | 3300028381 | Bacteria | 7759 |
| 462 | Ga0268264_10115491 | 3300028381 | Bacteria | 2358 |
| 463 | Ga0268264_10191092 | 3300028381 | Bacteria | 1866 |
| 464 | Ga0268264_10255651 | 3300028381 | Bacteria | 1629 |
| 465 | Ga0307509_10010784 | 3300031507 | Bacteria | 11143 |
| 466 | Ga0307406_10048452 | 3300031901 | Unclassified | 2684 |
| 467 | Ga0307406_10115841 | 3300031901 | Bacteria | 1853 |
| 468 | Ga0307407_10011264 | 3300031903 | Unclassified | 4250 |
| 469 | Ga0307409_100263058 | 3300031995 | Bacteria | 1584 |
| 470 | Ga0307416_100086286 | 3300032002 | Bacteria | 2675 |
| 471 | Ga0307416_100096860 | 3300032002 | Unclassified | 2553 |
| 472 | Ga0307416_100126073 | 3300032002 | Bacteria | 2293 |
| 473 | Ga0316214_1009453 | 3300033545 | Bacteria | 1316 |
| 474 | Ga0316212_1016526 | 3300033547 | Unclassified | 1041 |
| 475 | Ga0373959_0007585 | 3300034820 | Bacteria | 1826 |
| 476 | Ga0373926_0019759 | 3300035083 | Unclassified | 2324 |
| 477 | Ga0373934_0005963 | 3300035086 | Bacteria | 4511 |
| 478 | Ga0373923_0010349 | 3300035111 | Bacteria | 3390 |
| 479 | Ga0373936_0008394 | 3300035113 | Bacteria | 3888 |
| 480 | Ga0373936_0029722 | 3300035113 | Bacteria | 2152 |
| 481 | Ga0373945_0019458 | 3300035116 | Unclassified | 2319 |
| 482 | Ga0373945_0046750 | 3300035116 | Bacteria | 1580 |
| 483 | Ga0373953_0026335 | 3300035117 | Unclassified | 2227 |
| 484 | Ga0373954_0072186 | 3300035118 | Bacteria | 1641 |
| 485 | Ga0373960_0030037 | 3300035121 | Bacteria | 1511 |
| 486 | Ga0373943_0000734 | 3300035170 | Bacteria | 14279 |
| 487 | Ga0373943_0085918 | 3300035170 | Bacteria | 1621 |
| 488 | Ga0373924_0005824 | 3300035410 | Bacteria | 4387 |
| 489 | Ga0373924_0006511 | 3300035410 | Bacteria | 4187 |
| 490 | Ga0373935_0018267 | 3300035692 | Bacteria | 4263 |
| 491 | Ga0373935_0027419 | 3300035692 | Bacteria | 3520 |
| 492 | Ga0373935_0033847 | 3300035692 | Bacteria | 3182 |
| 493 | Ga0373935_0044677 | 3300035692 | Unclassified | 2793 |
| 494 | Ga0373935_0049405 | 3300035692 | Bacteria | 2666 |
| 495 | Ga0373935_0140849 | 3300035692 | Bacteria | 1629 |
| 496 | Ga0373927_0000754 | 3300035695 | Bacteria | 24720 |
| 497 | Ga0373933_0040694 | 3300035724 | Bacteria | 2739 |
| 498 | Ga0373947_0000528 | 3300035725 | Bacteria | 22310 |
| 499 | Ga0373947_0002984 | 3300035725 | Bacteria | 10095 |
| 500 | Ga0373947_0013631 | 3300035725 | Bacteria | 4656 |
| 501 | Ga0373937_0020692 | 3300036401 | Bacteria | 5901 |
| 502 | Ga0373937_0412330 | 3300036401 | Unclassified | 1282 |
| 503 | Ga0373925_0001845 | 3300037068 | Bacteria | 17631 |
| 504 | Ga0373925_0004780 | 3300037068 | Bacteria | 10204 |
| 505 | Ga0373925_0084658 | 3300037068 | Bacteria | 2416 |
| 506 | Ga0395900_0353860 | 3300037418 | Bacteria | 1442 |
| 507 | Ga0395905_0287269 | 3300037471 | Bacteria | 1532 |
| 508 | Ga0242420_010991 | 3300038996 | Unclassified | 1512 |
| 509 | Ga0436360_0977840 | 3300039438 | Bacteria | 12962 |
| 510 | Ga0451853_0601748 | 3300041512 | Bacteria | 1076 |
| 511 | Ga0466967_0017338 | 3300045976 | Bacteria | 5713 |
| 512 | Ga0466967_0046679 | 3300045976 | Bacteria | 3773 |
| 513 | Ga0495590_0000175 | 3300046457 | Bacteria | 37474 |
| 514 | Ga0495629_0005723 | 3300046459 | Bacteria | 9275 |
| 515 | Ga0495638_0185456 | 3300046460 | Bacteria | 1184 |
| 516 | Ga0495651_0098629 | 3300046462 | Bacteria | 2180 |
| 517 | Ga0495580_0000108 | 3300046472 | Bacteria | 55508 |
| 518 | Ga0495580_0005408 | 3300046472 | Bacteria | 10555 |
| 519 | Ga0495580_0096968 | 3300046472 | Bacteria | 2051 |
| 520 | Ga0495580_0187053 | 3300046472 | Bacteria | 1429 |
| 521 | Ga0495582_0010157 | 3300046473 | Bacteria | 5185 |
| 522 | Ga0495582_0012719 | 3300046473 | Unclassified | 4638 |
| 523 | Ga0495582_0097146 | 3300046473 | Unclassified | 1647 |
| 524 | Ga0495639_0019273 | 3300046475 | Unclassified | 2977 |
| 525 | Ga0495662_0042533 | 3300046476 | Bacteria | 2193 |
| 526 | Ga0495594_0058332 | 3300046499 | Bacteria | 2132 |
| 527 | Ga0495618_0253010 | 3300046514 | Bacteria | 1105 |
| 528 | Ga0495630_0024605 | 3300046517 | Bacteria | 4450 |
| 529 | Ga0495630_0171617 | 3300046517 | Bacteria | 1652 |
| 530 | Ga0495666_0034022 | 3300046526 | Bacteria | 2488 |
| 531 | Ga0495666_0076974 | 3300046526 | Bacteria | 1581 |
| 532 | Ga0495642_0026558 | 3300046528 | Unclassified | 2300 |
| 533 | Ga0495665_0003170 | 3300046531 | Bacteria | 8902 |
| 534 | Ga0495640_0010832 | 3300046533 | Bacteria | 7035 |
| 535 | Ga0495587_0062696 | 3300046536 | Bacteria | 2176 |
| 536 | Ga0495621_0102327 | 3300046539 | Unclassified | 1091 |
| 537 | Ga0495668_0048806 | 3300046616 | Bacteria | 2348 |
| 538 | Ga0495625_0097703 | 3300046660 | Bacteria | 2021 |
| 539 | Ga0495635_0036911 | 3300046663 | Bacteria | 3384 |
| 540 | Ga0495659_0031677 | 3300046664 | Unclassified | 1846 |
| 541 | Ga0495623_0071204 | 3300046679 | Bacteria | 2164 |
| 542 | Ga0495623_0125175 | 3300046679 | Bacteria | 1544 |
| 543 | Ga0495646_0348609 | 3300046680 | Unclassified | 776 |
| 544 | Ga0495658_0234208 | 3300046683 | Unclassified | 1152 |
| 545 | Ga0495669_0057623 | 3300046684 | Bacteria | 1753 |
| 546 | Ga0495649_0046062 | 3300046694 | Bacteria | 2376 |
| 547 | Ga0495581_0019569 | 3300047315 | Unclassified | 3929 |
| 548 | Ga0495581_0121185 | 3300047315 | Unclassified | 1522 |
| 549 | Ga0495674_0150196 | 3300047319 | Unclassified | 1954 |
| 550 | Ga0495676_0005055 | 3300047321 | Bacteria | 12100 |
| 551 | Ga0495680_0031898 | 3300047322 | Bacteria | 4283 |
| 552 | Ga0495675_0315359 | 3300047444 | Unclassified | 926 |
| 553 | Ga0495677_0082476 | 3300047445 | Unclassified | 1206 |
| 554 | Ga0495677_0084334 | 3300047445 | Bacteria | 1193 |
| 555 | Ga0495684_0015514 | 3300047471 | Bacteria | 5864 |
| 556 | Ga0495593_0064183 | 3300047673 | Unclassified | 1917 |
| 557 | Ga0495614_0054323 | 3300048089 | Bacteria | 1718 |
| 558 | Ga0496101_0280035 | 3300048904 | Bacteria | 1303 |
| 559 | Ga0496101_0365651 | 3300048904 | Bacteria | 1134 |
| 560 | Ga0496102_0026378 | 3300048905 | Bacteria | 5182 |
| 561 | Ga0496102_0149961 | 3300048905 | Bacteria | 2190 |
| 562 | Ga0496102_0180314 | 3300048905 | Bacteria | 1990 |
| 563 | Ga0496104_0250793 | 3300048907 | Bacteria | 1683 |
| 564 | Ga0496106_0145653 | 3300048909 | Bacteria | 1866 |
| 565 | Ga0496108_0000258 | 3300048911 | Bacteria | 45782 |
| 566 | Ga0496108_0088054 | 3300048911 | Unclassified | 2638 |
| 567 | Ga0496109_0000781 | 3300048912 | Bacteria | 26465 |
| 568 | Ga0496109_0095978 | 3300048912 | Bacteria | 2746 |
| 569 | Ga0496110_0009726 | 3300048913 | Bacteria | 7787 |
| 570 | Ga0496111_0248741 | 3300048914 | Bacteria | 1320 |
| 571 | Ga0496112_0000081 | 3300048915 | Bacteria | 62594 |
| 572 | Ga0496112_0052552 | 3300048915 | Bacteria | 3999 |
| 573 | Ga0496112_0171605 | 3300048915 | Bacteria | 2134 |
| 574 | Ga0496113_0180653 | 3300048916 | Unclassified | 1673 |
| 575 | Ga0496114_0090229 | 3300048917 | Unclassified | 2601 |
| 576 | Ga0496115_0100316 | 3300048918 | Unclassified | 2373 |
| 577 | Ga0501071_0042927 | 3300049587 | Bacteria | 3241 |
| 578 | Ga0501074_0024476 | 3300049590 | Bacteria | 4389 |
| 579 | Ga0501079_0087610 | 3300049741 | Bacteria | 2410 |
| 580 | Ga0501080_0080621 | 3300049742 | Bacteria | 3025 |
| 581 | Ga0501080_0336770 | 3300049742 | Bacteria | 1364 |
| 582 | Ga0501081_0013952 | 3300049743 | Bacteria | 5291 |
| 583 | Ga0501083_0001125 | 3300049744 | Bacteria | 17899 |
| 584 | Ga0501083_0024856 | 3300049744 | Bacteria | 4149 |
| 585 | Ga0501045_0214020 | 3300049824 | Unclassified | 1435 |
| 586 | nmdc:mga03683_81819_c1 | 3300050489 | Unclassified | 1395 |
| 587 | nmdc:mga05p37_109864_c1 | 3300050507 | Unclassified | 3392 |
| 588 | nmdc:mga05p37_19582_c1 | 3300050507 | Bacteria | 8186 |
| 589 | nmdc:mga05p37_203520_c1 | 3300050507 | Bacteria | 2396 |
| 590 | nmdc:mga05p37_263768_c1 | 3300050507 | Bacteria | 2060 |
| 591 | nmdc:mga05p37_372366_c1 | 3300050507 | Bacteria | 1676 |
| 592 | nmdc:mga05p37_487639_c1 | 3300050507 | Unclassified | 1418 |
| 593 | nmdc:mga09592_152248_c1 | 3300050508 | Bacteria | 1996 |
| 594 | nmdc:mga06r32_356892_c1 | 3300050510 | Unclassified | 1446 |
| 595 | nmdc:mga06r32_772_c1 | 3300050510 | Bacteria | 28263 |
| 596 | nmdc:mga08y16_167076_c1 | 3300050511 | Bacteria | 2286 |
| 597 | nmdc:mga08y16_22475_c1 | 3300050511 | Bacteria | 6658 |
| 598 | nmdc:mga08y16_6910_c1 | 3300050511 | Bacteria | 11899 |
| 599 | nmdc:mga08y16_85833_c1 | 3300050511 | Bacteria | 3281 |
| 600 | nmdc:mga0n895_140048_c1 | 3300050512 | Unclassified | 2447 |
| 601 | nmdc:mga0n895_2498_c1 | 3300050512 | Bacteria | 14388 |
| 602 | nmdc:mga0n895_30980_c1 | 3300050512 | Bacteria | 5116 |
| 603 | nmdc:mga0n895_33308_c1 | 3300050512 | Bacteria | 4951 |
| 604 | nmdc:mga0n895_3497_c1 | 3300050512 | Bacteria | 12688 |
| 605 | nmdc:mga0n895_545380_c1 | 3300050512 | Unclassified | 1166 |
| 606 | nmdc:mga0rr50_17711_c1 | 3300050513 | Bacteria | 4764 |
| 607 | nmdc:mga0rr50_193491_c1 | 3300050513 | Bacteria | 1668 |
| 608 | nmdc:mga0rr50_31228_c1 | 3300050513 | Bacteria | 3781 |
| 609 | nmdc:mga0rr50_3238_c1 | 3300050513 | Bacteria | 9326 |
| 610 | nmdc:mga08x19_202301_c1 | 3300050514 | Bacteria | 1362 |
| 611 | nmdc:mga08x19_24077_c1 | 3300050514 | Bacteria | 3781 |
| 612 | nmdc:mga08x19_307507_c1 | 3300050514 | Unclassified | 1102 |
| 613 | nmdc:mga0a205_20565_c1 | 3300050515 | Bacteria | 6229 |
| 614 | nmdc:mga0a205_265451_c1 | 3300050515 | Bacteria | 1594 |
| 615 | nmdc:mga0a205_498_c1 | 3300050515 | Bacteria | 30776 |
| 616 | Ga0495601_0044209 | 3300053077 | Bacteria | 2800 |
| 617 | Ga0495601_0088827 | 3300053077 | Bacteria | 1987 |
| 618 | Ga0495619_0013452 | 3300053085 | Bacteria | 5156 |
| 619 | Ga0501084_0001975 | 3300054114 | Bacteria | 16382 |
| 620 | Ga0501084_0058087 | 3300054114 | Bacteria | 3237 |
| 621 | Ga0501084_0115254 | 3300054114 | Bacteria | 2259 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046680 | Ga0495646_0348609 | Ga0495646_0348609_35_745 | 229 |
| 2 | 3300046473 | Ga0495582_0010157 | Ga0495582_0010157_66_830 | 239 |
| 3 | 3300036401 | Ga0373937_0412330 | Ga0373937_0412330_352_1173 | 251 |
| 4 | 3300006358 | Ga0068871_100170941 | Ga0068871_1001709412 | 254 |
| 5 | 3300006844 | Ga0075428_100243538 | Ga0075428_1002435382 | 256 |
| 6 | 3300046539 | Ga0495621_0102327 | Ga0495621_0102327_41_859 | 256 |
| 7 | 3300050507 | nmdc:mga05p37_263768_c1 | nmdc:mga05p37_263768_c1_1208_2026 | 256 |
| 8 | 3300005435 | Ga0070714_100000123 | Ga0070714_1000001232 | 257 |
| 9 | 3300005439 | Ga0070711_100032874 | Ga0070711_1000328742 | 257 |
| 10 | 3300025916 | Ga0207663_10107532 | Ga0207663_101075322 | 257 |
| 11 | 3300025929 | Ga0207664_10000151 | Ga0207664_1000015111 | 257 |
| 12 | 3300005293 | Ga0065715_10194679 | Ga0065715_101946792 | 258 |
| 13 | 3300006358 | Ga0068871_100151462 | Ga0068871_1001514622 | 259 |
| 14 | 3300006177 | Ga0075362_10000228 | Ga0075362_100002287 | 261 |
| 15 | 3300006178 | Ga0075367_10005874 | Ga0075367_100058747 | 261 |
| 16 | 3300006195 | Ga0075366_10003831 | Ga0075366_100038314 | 261 |
| 17 | 3300007265 | Ga0099794_10032704 | Ga0099794_100327042 | 262 |
| 18 | 3300050512 | nmdc:mga0n895_2498_c1 | nmdc:mga0n895_2498_c1_6760_7596 | 262 |
| 19 | 3300050513 | nmdc:mga0rr50_17711_c1 | nmdc:mga0rr50_17711_c1_3543_4379 | 262 |
| 20 | 3300005336 | Ga0070680_100059949 | Ga0070680_1000599491 | 263 |
| 21 | 3300007265 | Ga0099794_10079018 | Ga0099794_100790182 | 263 |
| 22 | 3300014325 | Ga0163163_10087036 | Ga0163163_100870363 | 263 |
| 23 | 3300025917 | Ga0207660_10116322 | Ga0207660_101163222 | 263 |
| 24 | 3300032002 | Ga0307416_100096860 | Ga0307416_1000968602 | 263 |
| 25 | 3300033545 | Ga0316214_1009453 | Ga0316214_10094532 | 263 |
| 26 | 3300033547 | Ga0316212_1016526 | Ga0316212_10165261 | 263 |
| 27 | 3300005842 | Ga0068858_100189223 | Ga0068858_1001892232 | 264 |
| 28 | 3300006237 | Ga0097621_100297113 | Ga0097621_1002971132 | 264 |
| 29 | 3300014497 | Ga0182008_10006186 | Ga0182008_100061863 | 264 |
| 30 | 3300024225 | Ga0224572_1004415 | Ga0224572_10044152 | 264 |
| 31 | 3300035113 | Ga0373936_0008394 | Ga0373936_0008394_327_1187 | 264 |
| 32 | 3300035692 | Ga0373935_0018267 | Ga0373935_0018267_481_1341 | 264 |
| 33 | 3300037068 | Ga0373925_0084658 | Ga0373925_0084658_1109_1969 | 264 |
| 34 | 3300041512 | Ga0451853_0601748 | Ga0451853_0601748_92_949 | 264 |
| 35 | 3300053077 | Ga0495601_0088827 | Ga0495601_0088827_500_1360 | 264 |
| 36 | 3300014969 | Ga0157376_10283956 | Ga0157376_102839562 | 265 |
| 37 | 3300048904 | Ga0496101_0365651 | Ga0496101_0365651_24_881 | 265 |
| 38 | 3300048917 | Ga0496114_0090229 | Ga0496114_0090229_1345_2292 | 265 |
| 39 | 3300009545 | Ga0105237_10201063 | Ga0105237_102010632 | 266 |
| 40 | 3300005293 | Ga0065715_10113544 | Ga0065715_101135442 | 267 |
| 41 | 3300005330 | Ga0070690_100107793 | Ga0070690_1001077932 | 267 |
| 42 | 3300005353 | Ga0070669_100091373 | Ga0070669_1000913732 | 267 |
| 43 | 3300005367 | Ga0070667_100419494 | Ga0070667_1004194942 | 267 |
| 44 | 3300005615 | Ga0070702_100056937 | Ga0070702_1000569372 | 267 |
| 45 | 3300005842 | Ga0068858_100059202 | Ga0068858_1000592022 | 267 |
| 46 | 3300025918 | Ga0207662_10012438 | Ga0207662_100124386 | 267 |
| 47 | 3300025923 | Ga0207681_10065019 | Ga0207681_100650192 | 267 |
| 48 | 3300025942 | Ga0207689_10024913 | Ga0207689_100249135 | 267 |
| 49 | 3300025986 | Ga0207658_10124752 | Ga0207658_101247522 | 267 |
| 50 | 3300026035 | Ga0207703_10071609 | Ga0207703_100716092 | 267 |
| 51 | 3300026142 | Ga0207698_10063348 | Ga0207698_100633482 | 267 |
| 52 | 3300046472 | Ga0495580_0187053 | Ga0495580_0187053_274_1131 | 267 |
| 53 | 3300005290 | Ga0065712_10069049 | Ga0065712_100690494 | 268 |
| 54 | 3300005293 | Ga0065715_10024814 | Ga0065715_100248141 | 268 |
| 55 | 3300005293 | Ga0065715_10036964 | Ga0065715_100369642 | 268 |
| 56 | 3300005293 | Ga0065715_10143614 | Ga0065715_101436142 | 268 |
| 57 | 3300005328 | Ga0070676_10324080 | Ga0070676_103240801 | 268 |
| 58 | 3300005330 | Ga0070690_100072890 | Ga0070690_1000728902 | 268 |
| 59 | 3300005331 | Ga0070670_100481102 | Ga0070670_1004811021 | 268 |
| 60 | 3300005334 | Ga0068869_100009992 | Ga0068869_1000099926 | 268 |
| 61 | 3300005335 | Ga0070666_10187165 | Ga0070666_101871651 | 268 |
| 62 | 3300005337 | Ga0070682_100089918 | Ga0070682_1000899182 | 268 |
| 63 | 3300005338 | Ga0068868_100001613 | Ga0068868_1000016137 | 268 |
| 64 | 3300005344 | Ga0070661_100058534 | Ga0070661_1000585342 | 268 |
| 65 | 3300005353 | Ga0070669_100003738 | Ga0070669_1000037382 | 268 |
| 66 | 3300005354 | Ga0070675_100081418 | Ga0070675_1000814182 | 268 |
| 67 | 3300005354 | Ga0070675_100384695 | Ga0070675_1003846952 | 268 |
| 68 | 3300005356 | Ga0070674_100048435 | Ga0070674_1000484353 | 268 |
| 69 | 3300005356 | Ga0070674_100181528 | Ga0070674_1001815282 | 268 |
| 70 | 3300005364 | Ga0070673_100390299 | Ga0070673_1003902991 | 268 |
| 71 | 3300005364 | Ga0070673_100416796 | Ga0070673_1004167962 | 268 |
| 72 | 3300005365 | Ga0070688_100067514 | Ga0070688_1000675142 | 268 |
| 73 | 3300005366 | Ga0070659_100422016 | Ga0070659_1004220162 | 268 |
| 74 | 3300005457 | Ga0070662_100022071 | Ga0070662_1000220712 | 268 |
| 75 | 3300005459 | Ga0068867_100434737 | Ga0068867_1004347372 | 268 |
| 76 | 3300005535 | Ga0070684_100003724 | Ga0070684_1000037248 | 268 |
| 77 | 3300005536 | Ga0070697_100094699 | Ga0070697_1000946993 | 268 |
| 78 | 3300005539 | Ga0068853_100090113 | Ga0068853_1000901132 | 268 |
| 79 | 3300005544 | Ga0070686_100197980 | Ga0070686_1001979801 | 268 |
| 80 | 3300005547 | Ga0070693_100043247 | Ga0070693_1000432472 | 268 |
| 81 | 3300005563 | Ga0068855_100022005 | Ga0068855_1000220052 | 268 |
| 82 | 3300005564 | Ga0070664_100000932 | Ga0070664_1000009327 | 268 |
| 83 | 3300005577 | Ga0068857_100000442 | Ga0068857_10000044219 | 268 |
| 84 | 3300005577 | Ga0068857_100352266 | Ga0068857_1003522661 | 268 |
| 85 | 3300005578 | Ga0068854_100001434 | Ga0068854_10000143413 | 268 |
| 86 | 3300005614 | Ga0068856_100000917 | Ga0068856_10000091716 | 268 |
| 87 | 3300005614 | Ga0068856_100003158 | Ga0068856_10000315812 | 268 |
| 88 | 3300005617 | Ga0068859_100000714 | Ga0068859_10000071423 | 268 |
| 89 | 3300005618 | Ga0068864_100033719 | Ga0068864_1000337192 | 268 |
| 90 | 3300005718 | Ga0068866_10019181 | Ga0068866_100191812 | 268 |
| 91 | 3300005841 | Ga0068863_100052371 | Ga0068863_1000523712 | 268 |
| 92 | 3300005842 | Ga0068858_100002139 | Ga0068858_10000213914 | 268 |
| 93 | 3300005844 | Ga0068862_100307964 | Ga0068862_1003079642 | 268 |
| 94 | 3300006163 | Ga0070715_10053962 | Ga0070715_100539622 | 268 |
| 95 | 3300006173 | Ga0070716_100044487 | Ga0070716_1000444872 | 268 |
| 96 | 3300006175 | Ga0070712_100002091 | Ga0070712_10000209115 | 268 |
| 97 | 3300006177 | Ga0075362_10102924 | Ga0075362_101029242 | 268 |
| 98 | 3300006237 | Ga0097621_100203119 | Ga0097621_1002031192 | 268 |
| 99 | 3300006358 | Ga0068871_100036145 | Ga0068871_1000361453 | 268 |
| 100 | 3300006358 | Ga0068871_100090402 | Ga0068871_1000904022 | 268 |
| 101 | 3300006844 | Ga0075428_100008493 | Ga0075428_1000084932 | 268 |
| 102 | 3300006844 | Ga0075428_100138746 | Ga0075428_1001387462 | 268 |
| 103 | 3300006846 | Ga0075430_100018752 | Ga0075430_1000187524 | 268 |
| 104 | 3300006881 | Ga0068865_100011639 | Ga0068865_1000116393 | 268 |
| 105 | 3300006931 | Ga0097620_100000714 | Ga0097620_10000071423 | 268 |
| 106 | 3300007076 | Ga0075435_100023710 | Ga0075435_1000237102 | 268 |
| 107 | 3300007076 | Ga0075435_100097373 | Ga0075435_1000973732 | 268 |
| 108 | 3300009094 | Ga0111539_10294913 | Ga0111539_102949132 | 268 |
| 109 | 3300009147 | Ga0114129_10125277 | Ga0114129_101252772 | 268 |
| 110 | 3300009545 | Ga0105237_10060274 | Ga0105237_100602744 | 268 |
| 111 | 3300013104 | Ga0157370_10378268 | Ga0157370_103782681 | 268 |
| 112 | 3300013105 | Ga0157369_10026983 | Ga0157369_100269832 | 268 |
| 113 | 3300013306 | Ga0163162_10288319 | Ga0163162_102883192 | 268 |
| 114 | 3300013307 | Ga0157372_10022162 | Ga0157372_100221622 | 268 |
| 115 | 3300013307 | Ga0157372_10285307 | Ga0157372_102853072 | 268 |
| 116 | 3300013308 | Ga0157375_10000926 | Ga0157375_100009263 | 268 |
| 117 | 3300025271 | Ga0207666_1001439 | Ga0207666_10014392 | 268 |
| 118 | 3300025899 | Ga0207642_10025406 | Ga0207642_100254062 | 268 |
| 119 | 3300025899 | Ga0207642_10289064 | Ga0207642_102890641 | 268 |
| 120 | 3300025903 | Ga0207680_10044025 | Ga0207680_100440252 | 268 |
| 121 | 3300025904 | Ga0207647_10005796 | Ga0207647_100057965 | 268 |
| 122 | 3300025904 | Ga0207647_10175108 | Ga0207647_101751081 | 268 |
| 123 | 3300025905 | Ga0207685_10171391 | Ga0207685_101713911 | 268 |
| 124 | 3300025911 | Ga0207654_10042046 | Ga0207654_100420462 | 268 |
| 125 | 3300025914 | Ga0207671_10134742 | Ga0207671_101347422 | 268 |
| 126 | 3300025915 | Ga0207693_10002042 | Ga0207693_1000204216 | 268 |
| 127 | 3300025916 | Ga0207663_10028594 | Ga0207663_100285942 | 268 |
| 128 | 3300025920 | Ga0207649_10028410 | Ga0207649_100284102 | 268 |
| 129 | 3300025925 | Ga0207650_10003584 | Ga0207650_1000358410 | 268 |
| 130 | 3300025925 | Ga0207650_10033277 | Ga0207650_100332772 | 268 |
| 131 | 3300025926 | Ga0207659_10069120 | Ga0207659_100691201 | 268 |
| 132 | 3300025928 | Ga0207700_10026093 | Ga0207700_100260932 | 268 |
| 133 | 3300025929 | Ga0207664_10336802 | Ga0207664_103368022 | 268 |
| 134 | 3300025933 | Ga0207706_10059770 | Ga0207706_100597704 | 268 |
| 135 | 3300025933 | Ga0207706_10165994 | Ga0207706_101659942 | 268 |
| 136 | 3300025937 | Ga0207669_10059107 | Ga0207669_100591072 | 268 |
| 137 | 3300025938 | Ga0207704_10018029 | Ga0207704_100180292 | 268 |
| 138 | 3300025939 | Ga0207665_10061121 | Ga0207665_100611212 | 268 |
| 139 | 3300025942 | Ga0207689_10022628 | Ga0207689_100226285 | 268 |
| 140 | 3300025949 | Ga0207667_10019087 | Ga0207667_100190872 | 268 |
| 141 | 3300025949 | Ga0207667_10623184 | Ga0207667_106231841 | 268 |
| 142 | 3300025981 | Ga0207640_10006013 | Ga0207640_100060135 | 268 |
| 143 | 3300026023 | Ga0207677_10004810 | Ga0207677_100048103 | 268 |
| 144 | 3300026035 | Ga0207703_10001646 | Ga0207703_100016468 | 268 |
| 145 | 3300026041 | Ga0207639_10119809 | Ga0207639_101198092 | 268 |
| 146 | 3300026075 | Ga0207708_10209444 | Ga0207708_102094443 | 268 |
| 147 | 3300026078 | Ga0207702_10023459 | Ga0207702_100234593 | 268 |
| 148 | 3300026078 | Ga0207702_10195372 | Ga0207702_101953722 | 268 |
| 149 | 3300026088 | Ga0207641_10066104 | Ga0207641_100661041 | 268 |
| 150 | 3300026089 | Ga0207648_10077629 | Ga0207648_100776292 | 268 |
| 151 | 3300026089 | Ga0207648_10123753 | Ga0207648_101237532 | 268 |
| 152 | 3300026089 | Ga0207648_10454049 | Ga0207648_104540491 | 268 |
| 153 | 3300026095 | Ga0207676_10049232 | Ga0207676_100492322 | 268 |
| 154 | 3300026116 | Ga0207674_10001759 | Ga0207674_1000175918 | 268 |
| 155 | 3300026118 | Ga0207675_100019494 | Ga0207675_1000194945 | 268 |
| 156 | 3300027907 | Ga0207428_10078500 | Ga0207428_100785002 | 268 |
| 157 | 3300031507 | Ga0307509_10010784 | Ga0307509_100107847 | 268 |
| 158 | 3300031901 | Ga0307406_10115841 | Ga0307406_101158412 | 268 |
| 159 | 3300031903 | Ga0307407_10011264 | Ga0307407_100112642 | 268 |
| 160 | 3300031995 | Ga0307409_100263058 | Ga0307409_1002630581 | 268 |
| 161 | 3300032002 | Ga0307416_100086286 | Ga0307416_1000862863 | 268 |
| 162 | 3300032002 | Ga0307416_100126073 | Ga0307416_1001260731 | 268 |
| 163 | 3300035086 | Ga0373934_0005963 | Ga0373934_0005963_1633_2487 | 268 |
| 164 | 3300035111 | Ga0373923_0010349 | Ga0373923_0010349_329_1183 | 268 |
| 165 | 3300035116 | Ga0373945_0046750 | Ga0373945_0046750_21_875 | 268 |
| 166 | 3300035117 | Ga0373953_0026335 | Ga0373953_0026335_902_1756 | 268 |
| 167 | 3300035118 | Ga0373954_0072186 | Ga0373954_0072186_49_903 | 268 |
| 168 | 3300035170 | Ga0373943_0000734 | Ga0373943_0000734_8665_9519 | 268 |
| 169 | 3300035410 | Ga0373924_0005824 | Ga0373924_0005824_166_1020 | 268 |
| 170 | 3300035692 | Ga0373935_0033847 | Ga0373935_0033847_1069_1923 | 268 |
| 171 | 3300035695 | Ga0373927_0000754 | Ga0373927_0000754_16300_17154 | 268 |
| 172 | 3300035724 | Ga0373933_0040694 | Ga0373933_0040694_193_1047 | 268 |
| 173 | 3300035725 | Ga0373947_0000528 | Ga0373947_0000528_13102_13956 | 268 |
| 174 | 3300036401 | Ga0373937_0020692 | Ga0373937_0020692_271_1125 | 268 |
| 175 | 3300037068 | Ga0373925_0001845 | Ga0373925_0001845_16292_17146 | 268 |
| 176 | 3300045976 | Ga0466967_0017338 | Ga0466967_0017338_1307_2161 | 268 |
| 177 | 3300045976 | Ga0466967_0046679 | Ga0466967_0046679_2466_3326 | 268 |
| 178 | 3300046457 | Ga0495590_0000175 | Ga0495590_0000175_8538_9392 | 268 |
| 179 | 3300046460 | Ga0495638_0185456 | Ga0495638_0185456_31_885 | 268 |
| 180 | 3300046462 | Ga0495651_0098629 | Ga0495651_0098629_1141_1995 | 268 |
| 181 | 3300046514 | Ga0495618_0253010 | Ga0495618_0253010_219_1073 | 268 |
| 182 | 3300046517 | Ga0495630_0024605 | Ga0495630_0024605_3288_4142 | 268 |
| 183 | 3300046660 | Ga0495625_0097703 | Ga0495625_0097703_20_874 | 268 |
| 184 | 3300046679 | Ga0495623_0071204 | Ga0495623_0071204_893_1747 | 268 |
| 185 | 3300046679 | Ga0495623_0125175 | Ga0495623_0125175_586_1440 | 268 |
| 186 | 3300046694 | Ga0495649_0046062 | Ga0495649_0046062_541_1395 | 268 |
| 187 | 3300048907 | Ga0496104_0250793 | Ga0496104_0250793_794_1648 | 268 |
| 188 | 3300048909 | Ga0496106_0145653 | Ga0496106_0145653_340_1194 | 268 |
| 189 | 3300048915 | Ga0496112_0171605 | Ga0496112_0171605_391_1245 | 268 |
| 190 | 3300048916 | Ga0496113_0180653 | Ga0496113_0180653_203_1057 | 268 |
| 191 | 3300049587 | Ga0501071_0042927 | Ga0501071_0042927_627_1481 | 268 |
| 192 | 3300049590 | Ga0501074_0024476 | Ga0501074_0024476_3448_4302 | 268 |
| 193 | 3300049741 | Ga0501079_0087610 | Ga0501079_0087610_520_1374 | 268 |
| 194 | 3300049742 | Ga0501080_0080621 | Ga0501080_0080621_542_1396 | 268 |
| 195 | 3300049742 | Ga0501080_0336770 | Ga0501080_0336770_411_1265 | 268 |
| 196 | 3300049743 | Ga0501081_0013952 | Ga0501081_0013952_1801_2655 | 268 |
| 197 | 3300049744 | Ga0501083_0001125 | Ga0501083_0001125_15617_16471 | 268 |
| 198 | 3300049744 | Ga0501083_0024856 | Ga0501083_0024856_2375_3229 | 268 |
| 199 | 3300049824 | Ga0501045_0214020 | Ga0501045_0214020_493_1347 | 268 |
| 200 | 3300050489 | nmdc:mga03683_81819_c1 | nmdc:mga03683_81819_c1_281_1135 | 268 |
| 201 | 3300050507 | nmdc:mga05p37_109864_c1 | nmdc:mga05p37_109864_c1_1279_2133 | 268 |
| 202 | 3300050507 | nmdc:mga05p37_19582_c1 | nmdc:mga05p37_19582_c1_452_1306 | 268 |
| 203 | 3300050508 | nmdc:mga09592_152248_c1 | nmdc:mga09592_152248_c1_791_1645 | 268 |
| 204 | 3300050510 | nmdc:mga06r32_356892_c1 | nmdc:mga06r32_356892_c1_314_1168 | 268 |
| 205 | 3300050510 | nmdc:mga06r32_772_c1 | nmdc:mga06r32_772_c1_23695_24549 | 268 |
| 206 | 3300050511 | nmdc:mga08y16_22475_c1 | nmdc:mga08y16_22475_c1_5180_6034 | 268 |
| 207 | 3300050511 | nmdc:mga08y16_6910_c1 | nmdc:mga08y16_6910_c1_8197_9051 | 268 |
| 208 | 3300054114 | Ga0501084_0001975 | Ga0501084_0001975_6741_7595 | 268 |
| 209 | 3300054114 | Ga0501084_0058087 | Ga0501084_0058087_2295_3149 | 268 |
| 210 | 3300054114 | Ga0501084_0115254 | Ga0501084_0115254_316_1170 | 268 |
| 211 | 3300001991 | JGI24743J22301_10021092 | JGI24743J22301_100210922 | 269 |
| 212 | 3300003322 | rootL2_10033750 | rootL2_100337501 | 269 |
| 213 | 3300003323 | rootH1_10031980 | rootH1_100319803 | 269 |
| 214 | 3300005293 | Ga0065715_10112861 | Ga0065715_101128612 | 269 |
| 215 | 3300005295 | Ga0065707_10000678 | Ga0065707_1000067813 | 269 |
| 216 | 3300005327 | Ga0070658_10303263 | Ga0070658_103032631 | 269 |
| 217 | 3300005328 | Ga0070676_10022896 | Ga0070676_100228962 | 269 |
| 218 | 3300005328 | Ga0070676_10027408 | Ga0070676_100274085 | 269 |
| 219 | 3300005329 | Ga0070683_100011805 | Ga0070683_1000118055 | 269 |
| 220 | 3300005329 | Ga0070683_100023642 | Ga0070683_1000236425 | 269 |
| 221 | 3300005330 | Ga0070690_100042724 | Ga0070690_1000427244 | 269 |
| 222 | 3300005334 | Ga0068869_100030447 | Ga0068869_1000304473 | 269 |
| 223 | 3300005334 | Ga0068869_100304113 | Ga0068869_1003041132 | 269 |
| 224 | 3300005335 | Ga0070666_10056567 | Ga0070666_100565673 | 269 |
| 225 | 3300005336 | Ga0070680_100049594 | Ga0070680_1000495942 | 269 |
| 226 | 3300005337 | Ga0070682_100010640 | Ga0070682_1000106404 | 269 |
| 227 | 3300005338 | Ga0068868_100055431 | Ga0068868_1000554315 | 269 |
| 228 | 3300005338 | Ga0068868_100061139 | Ga0068868_1000611393 | 269 |
| 229 | 3300005338 | Ga0068868_100080560 | Ga0068868_1000805602 | 269 |
| 230 | 3300005339 | Ga0070660_100008847 | Ga0070660_1000088477 | 269 |
| 231 | 3300005339 | Ga0070660_100030704 | Ga0070660_1000307046 | 269 |
| 232 | 3300005340 | Ga0070689_100035604 | Ga0070689_1000356042 | 269 |
| 233 | 3300005341 | Ga0070691_10060911 | Ga0070691_100609112 | 269 |
| 234 | 3300005344 | Ga0070661_100017817 | Ga0070661_1000178172 | 269 |
| 235 | 3300005344 | Ga0070661_100020336 | Ga0070661_1000203363 | 269 |
| 236 | 3300005347 | Ga0070668_100003846 | Ga0070668_1000038462 | 269 |
| 237 | 3300005353 | Ga0070669_100016855 | Ga0070669_1000168554 | 269 |
| 238 | 3300005354 | Ga0070675_100007041 | Ga0070675_1000070415 | 269 |
| 239 | 3300005354 | Ga0070675_100601620 | Ga0070675_1006016201 | 269 |
| 240 | 3300005356 | Ga0070674_100077800 | Ga0070674_1000778004 | 269 |
| 241 | 3300005366 | Ga0070659_100026695 | Ga0070659_1000266953 | 269 |
| 242 | 3300005366 | Ga0070659_100057244 | Ga0070659_1000572443 | 269 |
| 243 | 3300005367 | Ga0070667_100018774 | Ga0070667_1000187743 | 269 |
| 244 | 3300005367 | Ga0070667_100633567 | Ga0070667_1006335671 | 269 |
| 245 | 3300005434 | Ga0070709_10066606 | Ga0070709_100666062 | 269 |
| 246 | 3300005434 | Ga0070709_10076676 | Ga0070709_100766762 | 269 |
| 247 | 3300005434 | Ga0070709_10125818 | Ga0070709_101258182 | 269 |
| 248 | 3300005435 | Ga0070714_100023222 | Ga0070714_1000232223 | 269 |
| 249 | 3300005435 | Ga0070714_100148138 | Ga0070714_1001481382 | 269 |
| 250 | 3300005435 | Ga0070714_100182155 | Ga0070714_1001821552 | 269 |
| 251 | 3300005436 | Ga0070713_100059810 | Ga0070713_1000598102 | 269 |
| 252 | 3300005436 | Ga0070713_100084718 | Ga0070713_1000847182 | 269 |
| 253 | 3300005439 | Ga0070711_100005305 | Ga0070711_1000053055 | 269 |
| 254 | 3300005439 | Ga0070711_100052163 | Ga0070711_1000521632 | 269 |
| 255 | 3300005440 | Ga0070705_100000663 | Ga0070705_1000006632 | 269 |
| 256 | 3300005444 | Ga0070694_100001150 | Ga0070694_1000011504 | 269 |
| 257 | 3300005444 | Ga0070694_100052387 | Ga0070694_1000523872 | 269 |
| 258 | 3300005455 | Ga0070663_100008376 | Ga0070663_1000083766 | 269 |
| 259 | 3300005455 | Ga0070663_100041450 | Ga0070663_1000414502 | 269 |
| 260 | 3300005457 | Ga0070662_100092230 | Ga0070662_1000922302 | 269 |
| 261 | 3300005458 | Ga0070681_10003152 | Ga0070681_100031529 | 269 |
| 262 | 3300005459 | Ga0068867_100009422 | Ga0068867_1000094227 | 269 |
| 263 | 3300005459 | Ga0068867_100016970 | Ga0068867_1000169702 | 269 |
| 264 | 3300005468 | Ga0070707_100004315 | Ga0070707_10000431512 | 269 |
| 265 | 3300005468 | Ga0070707_100416540 | Ga0070707_1004165401 | 269 |
| 266 | 3300005471 | Ga0070698_100140325 | Ga0070698_1001403252 | 269 |
| 267 | 3300005518 | Ga0070699_100051162 | Ga0070699_1000511624 | 269 |
| 268 | 3300005518 | Ga0070699_100325699 | Ga0070699_1003256991 | 269 |
| 269 | 3300005530 | Ga0070679_100003174 | Ga0070679_1000031745 | 269 |
| 270 | 3300005530 | Ga0070679_100140815 | Ga0070679_1001408152 | 269 |
| 271 | 3300005535 | Ga0070684_100036988 | Ga0070684_1000369883 | 269 |
| 272 | 3300005535 | Ga0070684_100135468 | Ga0070684_1001354682 | 269 |
| 273 | 3300005536 | Ga0070697_100008830 | Ga0070697_1000088307 | 269 |
| 274 | 3300005539 | Ga0068853_100052882 | Ga0068853_1000528825 | 269 |
| 275 | 3300005539 | Ga0068853_100124880 | Ga0068853_1001248801 | 269 |
| 276 | 3300005543 | Ga0070672_100213398 | Ga0070672_1002133982 | 269 |
| 277 | 3300005544 | Ga0070686_100027428 | Ga0070686_1000274283 | 269 |
| 278 | 3300005545 | Ga0070695_100000212 | Ga0070695_10000021221 | 269 |
| 279 | 3300005545 | Ga0070695_100009596 | Ga0070695_1000095962 | 269 |
| 280 | 3300005545 | Ga0070695_100021230 | Ga0070695_1000212301 | 269 |
| 281 | 3300005546 | Ga0070696_100000342 | Ga0070696_10000034222 | 269 |
| 282 | 3300005547 | Ga0070693_100128465 | Ga0070693_1001284652 | 269 |
| 283 | 3300005548 | Ga0070665_100001100 | Ga0070665_1000011003 | 269 |
| 284 | 3300005548 | Ga0070665_100127018 | Ga0070665_1001270184 | 269 |
| 285 | 3300005549 | Ga0070704_100099598 | Ga0070704_1000995981 | 269 |
| 286 | 3300005577 | Ga0068857_100001653 | Ga0068857_10000165311 | 269 |
| 287 | 3300005578 | Ga0068854_100058554 | Ga0068854_1000585543 | 269 |
| 288 | 3300005615 | Ga0070702_100018028 | Ga0070702_1000180282 | 269 |
| 289 | 3300005615 | Ga0070702_100094015 | Ga0070702_1000940152 | 269 |
| 290 | 3300005616 | Ga0068852_100026368 | Ga0068852_1000263685 | 269 |
| 291 | 3300005616 | Ga0068852_100115362 | Ga0068852_1001153623 | 269 |
| 292 | 3300005617 | Ga0068859_100093113 | Ga0068859_1000931134 | 269 |
| 293 | 3300005618 | Ga0068864_100050254 | Ga0068864_1000502543 | 269 |
| 294 | 3300005618 | Ga0068864_100452521 | Ga0068864_1004525212 | 269 |
| 295 | 3300005718 | Ga0068866_10007929 | Ga0068866_100079294 | 269 |
| 296 | 3300005718 | Ga0068866_10023697 | Ga0068866_100236972 | 269 |
| 297 | 3300005719 | Ga0068861_100163197 | Ga0068861_1001631972 | 269 |
| 298 | 3300005834 | Ga0068851_10186170 | Ga0068851_101861701 | 269 |
| 299 | 3300005841 | Ga0068863_100014480 | Ga0068863_1000144808 | 269 |
| 300 | 3300005841 | Ga0068863_100077099 | Ga0068863_1000770993 | 269 |
| 301 | 3300005842 | Ga0068858_100129461 | Ga0068858_1001294612 | 269 |
| 302 | 3300005843 | Ga0068860_100003784 | Ga0068860_10000378412 | 269 |
| 303 | 3300005843 | Ga0068860_100014306 | Ga0068860_1000143067 | 269 |
| 304 | 3300005843 | Ga0068860_100014493 | Ga0068860_1000144935 | 269 |
| 305 | 3300005843 | Ga0068860_100124105 | Ga0068860_1001241052 | 269 |
| 306 | 3300005844 | Ga0068862_100017030 | Ga0068862_1000170305 | 269 |
| 307 | 3300005844 | Ga0068862_100052116 | Ga0068862_1000521163 | 269 |
| 308 | 3300005844 | Ga0068862_100052753 | Ga0068862_1000527533 | 269 |
| 309 | 3300005844 | Ga0068862_100053056 | Ga0068862_1000530563 | 269 |
| 310 | 3300005844 | Ga0068862_100331722 | Ga0068862_1003317222 | 269 |
| 311 | 3300006028 | Ga0070717_10117584 | Ga0070717_101175842 | 269 |
| 312 | 3300006028 | Ga0070717_10201162 | Ga0070717_102011622 | 269 |
| 313 | 3300006173 | Ga0070716_100007249 | Ga0070716_1000072495 | 269 |
| 314 | 3300006173 | Ga0070716_100024242 | Ga0070716_1000242422 | 269 |
| 315 | 3300006173 | Ga0070716_100083268 | Ga0070716_1000832682 | 269 |
| 316 | 3300006173 | Ga0070716_100214092 | Ga0070716_1002140921 | 269 |
| 317 | 3300006175 | Ga0070712_100010248 | Ga0070712_1000102481 | 269 |
| 318 | 3300006175 | Ga0070712_100062998 | Ga0070712_1000629982 | 269 |
| 319 | 3300006195 | Ga0075366_10145880 | Ga0075366_101458802 | 269 |
| 320 | 3300006237 | Ga0097621_100004225 | Ga0097621_1000042259 | 269 |
| 321 | 3300006237 | Ga0097621_100038748 | Ga0097621_1000387483 | 269 |
| 322 | 3300006237 | Ga0097621_100061936 | Ga0097621_1000619362 | 269 |
| 323 | 3300006358 | Ga0068871_100004186 | Ga0068871_1000041864 | 269 |
| 324 | 3300006358 | Ga0068871_100017036 | Ga0068871_1000170363 | 269 |
| 325 | 3300006358 | Ga0068871_100033688 | Ga0068871_1000336883 | 269 |
| 326 | 3300006852 | Ga0075433_10122648 | Ga0075433_101226482 | 269 |
| 327 | 3300006852 | Ga0075433_10220768 | Ga0075433_102207682 | 269 |
| 328 | 3300006871 | Ga0075434_100001290 | Ga0075434_10000129010 | 269 |
| 329 | 3300006871 | Ga0075434_100032547 | Ga0075434_1000325478 | 269 |
| 330 | 3300006871 | Ga0075434_100270384 | Ga0075434_1002703842 | 269 |
| 331 | 3300006871 | Ga0075434_100323337 | Ga0075434_1003233372 | 269 |
| 332 | 3300006871 | Ga0075434_100492122 | Ga0075434_1004921222 | 269 |
| 333 | 3300006881 | Ga0068865_100058967 | Ga0068865_1000589674 | 269 |
| 334 | 3300006881 | Ga0068865_100162061 | Ga0068865_1001620612 | 269 |
| 335 | 3300006881 | Ga0068865_100163236 | Ga0068865_1001632362 | 269 |
| 336 | 3300006881 | Ga0068865_100281853 | Ga0068865_1002818531 | 269 |
| 337 | 3300006914 | Ga0075436_100001976 | Ga0075436_10000197613 | 269 |
| 338 | 3300006914 | Ga0075436_100009496 | Ga0075436_1000094966 | 269 |
| 339 | 3300006931 | Ga0097620_100093116 | Ga0097620_1000931164 | 269 |
| 340 | 3300007076 | Ga0075435_100010778 | Ga0075435_1000107785 | 269 |
| 341 | 3300007076 | Ga0075435_100013603 | Ga0075435_1000136033 | 269 |
| 342 | 3300007076 | Ga0075435_100019396 | Ga0075435_1000193963 | 269 |
| 343 | 3300007076 | Ga0075435_100104965 | Ga0075435_1001049652 | 269 |
| 344 | 3300007076 | Ga0075435_100207217 | Ga0075435_1002072172 | 269 |
| 345 | 3300007265 | Ga0099794_10006654 | Ga0099794_100066542 | 269 |
| 346 | 3300007265 | Ga0099794_10176703 | Ga0099794_101767031 | 269 |
| 347 | 3300009011 | Ga0105251_10060846 | Ga0105251_100608462 | 269 |
| 348 | 3300009093 | Ga0105240_10023460 | Ga0105240_100234605 | 269 |
| 349 | 3300009093 | Ga0105240_10156870 | Ga0105240_101568702 | 269 |
| 350 | 3300009093 | Ga0105240_10276320 | Ga0105240_102763201 | 269 |
| 351 | 3300009094 | Ga0111539_10052204 | Ga0111539_100522043 | 269 |
| 352 | 3300009094 | Ga0111539_10058321 | Ga0111539_100583212 | 269 |
| 353 | 3300009094 | Ga0111539_10317730 | Ga0111539_103177302 | 269 |
| 354 | 3300009098 | Ga0105245_10102507 | Ga0105245_101025073 | 269 |
| 355 | 3300009098 | Ga0105245_10566046 | Ga0105245_105660461 | 269 |
| 356 | 3300009098 | Ga0105245_10581692 | Ga0105245_105816921 | 269 |
| 357 | 3300009101 | Ga0105247_10050787 | Ga0105247_100507872 | 269 |
| 358 | 3300009101 | Ga0105247_10159760 | Ga0105247_101597602 | 269 |
| 359 | 3300009147 | Ga0114129_10516999 | Ga0114129_105169992 | 269 |
| 360 | 3300009148 | Ga0105243_10031438 | Ga0105243_100314383 | 269 |
| 361 | 3300009174 | Ga0105241_10011928 | Ga0105241_100119288 | 269 |
| 362 | 3300009174 | Ga0105241_10014749 | Ga0105241_100147495 | 269 |
| 363 | 3300009174 | Ga0105241_10178609 | Ga0105241_101786091 | 269 |
| 364 | 3300009174 | Ga0105241_10191681 | Ga0105241_101916812 | 269 |
| 365 | 3300009176 | Ga0105242_10020850 | Ga0105242_100208503 | 269 |
| 366 | 3300009176 | Ga0105242_10030613 | Ga0105242_100306134 | 269 |
| 367 | 3300009176 | Ga0105242_10033189 | Ga0105242_100331892 | 269 |
| 368 | 3300009176 | Ga0105242_10423534 | Ga0105242_104235342 | 269 |
| 369 | 3300009177 | Ga0105248_10030534 | Ga0105248_100305344 | 269 |
| 370 | 3300009545 | Ga0105237_10070511 | Ga0105237_100705113 | 269 |
| 371 | 3300009545 | Ga0105237_10097734 | Ga0105237_100977342 | 269 |
| 372 | 3300009545 | Ga0105237_10102605 | Ga0105237_101026052 | 269 |
| 373 | 3300009551 | Ga0105238_10023968 | Ga0105238_100239685 | 269 |
| 374 | 3300009551 | Ga0105238_10068429 | Ga0105238_100684292 | 269 |
| 375 | 3300009551 | Ga0105238_10206403 | Ga0105238_102064031 | 269 |
| 376 | 3300009551 | Ga0105238_10391190 | Ga0105238_103911901 | 269 |
| 377 | 3300009553 | Ga0105249_10137474 | Ga0105249_101374742 | 269 |
| 378 | 3300009553 | Ga0105249_10148504 | Ga0105249_101485043 | 269 |
| 379 | 3300009553 | Ga0105249_10300536 | Ga0105249_103005362 | 269 |
| 380 | 3300009553 | Ga0105249_10599049 | Ga0105249_105990491 | 269 |
| 381 | 3300009553 | Ga0105249_10616199 | Ga0105249_106161991 | 269 |
| 382 | 3300010375 | Ga0105239_10051087 | Ga0105239_100510873 | 269 |
| 383 | 3300010375 | Ga0105239_10122505 | Ga0105239_101225054 | 269 |
| 384 | 3300010375 | Ga0105239_10186624 | Ga0105239_101866243 | 269 |
| 385 | 3300010375 | Ga0105239_10342510 | Ga0105239_103425101 | 269 |
| 386 | 3300010375 | Ga0105239_10992156 | Ga0105239_109921561 | 269 |
| 387 | 3300010375 | Ga0105239_11041045 | Ga0105239_110410451 | 269 |
| 388 | 3300011119 | Ga0105246_10008240 | Ga0105246_100082404 | 269 |
| 389 | 3300011119 | Ga0105246_10011169 | Ga0105246_100111693 | 269 |
| 390 | 3300013102 | Ga0157371_10002531 | Ga0157371_1000253118 | 269 |
| 391 | 3300013102 | Ga0157371_10009000 | Ga0157371_100090007 | 269 |
| 392 | 3300013105 | Ga0157369_10054471 | Ga0157369_100544715 | 269 |
| 393 | 3300013105 | Ga0157369_10144141 | Ga0157369_101441412 | 269 |
| 394 | 3300013296 | Ga0157374_10051608 | Ga0157374_100516082 | 269 |
| 395 | 3300013296 | Ga0157374_10151114 | Ga0157374_101511142 | 269 |
| 396 | 3300013296 | Ga0157374_10362468 | Ga0157374_103624682 | 269 |
| 397 | 3300013297 | Ga0157378_10013851 | Ga0157378_100138513 | 269 |
| 398 | 3300013297 | Ga0157378_10017861 | Ga0157378_100178613 | 269 |
| 399 | 3300013297 | Ga0157378_10021184 | Ga0157378_100211846 | 269 |
| 400 | 3300013297 | Ga0157378_10060610 | Ga0157378_100606102 | 269 |
| 401 | 3300013297 | Ga0157378_10449380 | Ga0157378_104493801 | 269 |
| 402 | 3300013306 | Ga0163162_10001837 | Ga0163162_1000183710 | 269 |
| 403 | 3300013306 | Ga0163162_10015898 | Ga0163162_100158986 | 269 |
| 404 | 3300013306 | Ga0163162_10131861 | Ga0163162_101318612 | 269 |
| 405 | 3300013307 | Ga0157372_10171854 | Ga0157372_101718544 | 269 |
| 406 | 3300013307 | Ga0157372_10496834 | Ga0157372_104968341 | 269 |
| 407 | 3300013308 | Ga0157375_10096870 | Ga0157375_100968702 | 269 |
| 408 | 3300013308 | Ga0157375_10356278 | Ga0157375_103562782 | 269 |
| 409 | 3300014325 | Ga0163163_10001045 | Ga0163163_1000104527 | 269 |
| 410 | 3300014325 | Ga0163163_10246228 | Ga0163163_102462282 | 269 |
| 411 | 3300014325 | Ga0163163_10369904 | Ga0163163_103699042 | 269 |
| 412 | 3300014325 | Ga0163163_10691456 | Ga0163163_106914562 | 269 |
| 413 | 3300014326 | Ga0157380_10025668 | Ga0157380_100256682 | 269 |
| 414 | 3300014326 | Ga0157380_10086965 | Ga0157380_100869654 | 269 |
| 415 | 3300014745 | Ga0157377_10006871 | Ga0157377_100068716 | 269 |
| 416 | 3300014968 | Ga0157379_10120942 | Ga0157379_101209422 | 269 |
| 417 | 3300014968 | Ga0157379_10493434 | Ga0157379_104934341 | 269 |
| 418 | 3300014969 | Ga0157376_10000008 | Ga0157376_10000008275 | 269 |
| 419 | 3300014969 | Ga0157376_10014148 | Ga0157376_100141484 | 269 |
| 420 | 3300014969 | Ga0157376_10209596 | Ga0157376_102095963 | 269 |
| 421 | 3300017792 | Ga0163161_10062830 | Ga0163161_100628305 | 269 |
| 422 | 3300025231 | Ga0207427_101369 | Ga0207427_1013696 | 269 |
| 423 | 3300025315 | Ga0207697_10017770 | Ga0207697_100177703 | 269 |
| 424 | 3300025899 | Ga0207642_10006910 | Ga0207642_100069103 | 269 |
| 425 | 3300025901 | Ga0207688_10044406 | Ga0207688_100444062 | 269 |
| 426 | 3300025904 | Ga0207647_10000693 | Ga0207647_100006933 | 269 |
| 427 | 3300025904 | Ga0207647_10004401 | Ga0207647_1000440112 | 269 |
| 428 | 3300025904 | Ga0207647_10059356 | Ga0207647_100593563 | 269 |
| 429 | 3300025906 | Ga0207699_10052954 | Ga0207699_100529542 | 269 |
| 430 | 3300025907 | Ga0207645_10006290 | Ga0207645_100062906 | 269 |
| 431 | 3300025907 | Ga0207645_10045903 | Ga0207645_100459032 | 269 |
| 432 | 3300025907 | Ga0207645_10048393 | Ga0207645_100483932 | 269 |
| 433 | 3300025908 | Ga0207643_10008423 | Ga0207643_100084234 | 269 |
| 434 | 3300025909 | Ga0207705_10236740 | Ga0207705_102367402 | 269 |
| 435 | 3300025910 | Ga0207684_10049788 | Ga0207684_100497885 | 269 |
| 436 | 3300025911 | Ga0207654_10016071 | Ga0207654_100160712 | 269 |
| 437 | 3300025912 | Ga0207707_10001132 | Ga0207707_1000113220 | 269 |
| 438 | 3300025912 | Ga0207707_10291980 | Ga0207707_102919802 | 269 |
| 439 | 3300025913 | Ga0207695_10011852 | Ga0207695_1001185216 | 269 |
| 440 | 3300025913 | Ga0207695_10030416 | Ga0207695_100304165 | 269 |
| 441 | 3300025913 | Ga0207695_10050110 | Ga0207695_100501105 | 269 |
| 442 | 3300025913 | Ga0207695_10091436 | Ga0207695_100914363 | 269 |
| 443 | 3300025914 | Ga0207671_10041626 | Ga0207671_100416263 | 269 |
| 444 | 3300025914 | Ga0207671_10224004 | Ga0207671_102240041 | 269 |
| 445 | 3300025914 | Ga0207671_10356844 | Ga0207671_103568442 | 269 |
| 446 | 3300025915 | Ga0207693_10006247 | Ga0207693_100062473 | 269 |
| 447 | 3300025915 | Ga0207693_10013435 | Ga0207693_100134352 | 269 |
| 448 | 3300025915 | Ga0207693_10104950 | Ga0207693_101049502 | 269 |
| 449 | 3300025915 | Ga0207693_10213259 | Ga0207693_102132592 | 269 |
| 450 | 3300025916 | Ga0207663_10024240 | Ga0207663_100242404 | 269 |
| 451 | 3300025916 | Ga0207663_10043599 | Ga0207663_100435992 | 269 |
| 452 | 3300025916 | Ga0207663_10048161 | Ga0207663_100481612 | 269 |
| 453 | 3300025916 | Ga0207663_10101790 | Ga0207663_101017902 | 269 |
| 454 | 3300025916 | Ga0207663_10119086 | Ga0207663_101190862 | 269 |
| 455 | 3300025916 | Ga0207663_10361902 | Ga0207663_103619021 | 269 |
| 456 | 3300025917 | Ga0207660_10021689 | Ga0207660_100216892 | 269 |
| 457 | 3300025917 | Ga0207660_10218589 | Ga0207660_102185892 | 269 |
| 458 | 3300025918 | Ga0207662_10005190 | Ga0207662_100051902 | 269 |
| 459 | 3300025919 | Ga0207657_10002904 | Ga0207657_100029045 | 269 |
| 460 | 3300025919 | Ga0207657_10010709 | Ga0207657_100107097 | 269 |
| 461 | 3300025920 | Ga0207649_10000805 | Ga0207649_1000080515 | 269 |
| 462 | 3300025920 | Ga0207649_10049606 | Ga0207649_100496062 | 269 |
| 463 | 3300025921 | Ga0207652_10032433 | Ga0207652_100324333 | 269 |
| 464 | 3300025922 | Ga0207646_10001082 | Ga0207646_1000108231 | 269 |
| 465 | 3300025922 | Ga0207646_10348499 | Ga0207646_103484992 | 269 |
| 466 | 3300025924 | Ga0207694_10014336 | Ga0207694_100143365 | 269 |
| 467 | 3300025925 | Ga0207650_10000541 | Ga0207650_1000054111 | 269 |
| 468 | 3300025925 | Ga0207650_10051627 | Ga0207650_100516272 | 269 |
| 469 | 3300025926 | Ga0207659_10530889 | Ga0207659_105308891 | 269 |
| 470 | 3300025927 | Ga0207687_10044605 | Ga0207687_100446053 | 269 |
| 471 | 3300025928 | Ga0207700_10025389 | Ga0207700_100253894 | 269 |
| 472 | 3300025928 | Ga0207700_10052049 | Ga0207700_100520492 | 269 |
| 473 | 3300025929 | Ga0207664_10034005 | Ga0207664_100340053 | 269 |
| 474 | 3300025929 | Ga0207664_10158186 | Ga0207664_101581862 | 269 |
| 475 | 3300025929 | Ga0207664_10623601 | Ga0207664_106236011 | 269 |
| 476 | 3300025932 | Ga0207690_10007013 | Ga0207690_100070134 | 269 |
| 477 | 3300025933 | Ga0207706_10000422 | Ga0207706_1000042219 | 269 |
| 478 | 3300025933 | Ga0207706_10011326 | Ga0207706_100113266 | 269 |
| 479 | 3300025934 | Ga0207686_10061030 | Ga0207686_100610302 | 269 |
| 480 | 3300025934 | Ga0207686_10257465 | Ga0207686_102574652 | 269 |
| 481 | 3300025935 | Ga0207709_10155063 | Ga0207709_101550632 | 269 |
| 482 | 3300025936 | Ga0207670_10014075 | Ga0207670_100140755 | 269 |
| 483 | 3300025937 | Ga0207669_10053980 | Ga0207669_100539802 | 269 |
| 484 | 3300025938 | Ga0207704_10037565 | Ga0207704_100375653 | 269 |
| 485 | 3300025938 | Ga0207704_10240806 | Ga0207704_102408061 | 269 |
| 486 | 3300025939 | Ga0207665_10003604 | Ga0207665_100036044 | 269 |
| 487 | 3300025939 | Ga0207665_10006549 | Ga0207665_100065497 | 269 |
| 488 | 3300025939 | Ga0207665_10021583 | Ga0207665_100215833 | 269 |
| 489 | 3300025939 | Ga0207665_10054345 | Ga0207665_100543453 | 269 |
| 490 | 3300025939 | Ga0207665_10293879 | Ga0207665_102938791 | 269 |
| 491 | 3300025940 | Ga0207691_10013015 | Ga0207691_100130156 | 269 |
| 492 | 3300025941 | Ga0207711_10003693 | Ga0207711_100036932 | 269 |
| 493 | 3300025941 | Ga0207711_10049334 | Ga0207711_100493342 | 269 |
| 494 | 3300025941 | Ga0207711_10066058 | Ga0207711_100660582 | 269 |
| 495 | 3300025942 | Ga0207689_10006458 | Ga0207689_100064584 | 269 |
| 496 | 3300025942 | Ga0207689_10021789 | Ga0207689_100217894 | 269 |
| 497 | 3300025942 | Ga0207689_10108082 | Ga0207689_101080822 | 269 |
| 498 | 3300025944 | Ga0207661_10000122 | Ga0207661_1000012210 | 269 |
| 499 | 3300025944 | Ga0207661_10113114 | Ga0207661_101131142 | 269 |
| 500 | 3300025945 | Ga0207679_10000870 | Ga0207679_1000087014 | 269 |
| 501 | 3300025949 | Ga0207667_10059034 | Ga0207667_100590344 | 269 |
| 502 | 3300025960 | Ga0207651_10055104 | Ga0207651_100551042 | 269 |
| 503 | 3300025961 | Ga0207712_10006304 | Ga0207712_100063045 | 269 |
| 504 | 3300025961 | Ga0207712_10101111 | Ga0207712_101011111 | 269 |
| 505 | 3300025986 | Ga0207658_10029528 | Ga0207658_100295282 | 269 |
| 506 | 3300025986 | Ga0207658_10356105 | Ga0207658_103561052 | 269 |
| 507 | 3300026023 | Ga0207677_10077465 | Ga0207677_100774653 | 269 |
| 508 | 3300026041 | Ga0207639_10045561 | Ga0207639_100455612 | 269 |
| 509 | 3300026041 | Ga0207639_10065775 | Ga0207639_100657753 | 269 |
| 510 | 3300026067 | Ga0207678_10006987 | Ga0207678_100069877 | 269 |
| 511 | 3300026067 | Ga0207678_10010978 | Ga0207678_100109783 | 269 |
| 512 | 3300026075 | Ga0207708_10029102 | Ga0207708_100291022 | 269 |
| 513 | 3300026078 | Ga0207702_10053189 | Ga0207702_100531893 | 269 |
| 514 | 3300026088 | Ga0207641_10000006 | Ga0207641_10000006401 | 269 |
| 515 | 3300026088 | Ga0207641_10008817 | Ga0207641_100088174 | 269 |
| 516 | 3300026088 | Ga0207641_10035064 | Ga0207641_100350642 | 269 |
| 517 | 3300026089 | Ga0207648_10004897 | Ga0207648_100048977 | 269 |
| 518 | 3300026089 | Ga0207648_10014821 | Ga0207648_100148216 | 269 |
| 519 | 3300026089 | Ga0207648_10058037 | Ga0207648_100580373 | 269 |
| 520 | 3300026095 | Ga0207676_10002394 | Ga0207676_1000239414 | 269 |
| 521 | 3300026095 | Ga0207676_10049793 | Ga0207676_100497932 | 269 |
| 522 | 3300026116 | Ga0207674_10000537 | Ga0207674_1000053754 | 269 |
| 523 | 3300026116 | Ga0207674_10111201 | Ga0207674_101112011 | 269 |
| 524 | 3300026118 | Ga0207675_100090911 | Ga0207675_1000909114 | 269 |
| 525 | 3300026121 | Ga0207683_10008965 | Ga0207683_100089656 | 269 |
| 526 | 3300027671 | Ga0209588_1003190 | Ga0209588_10031904 | 269 |
| 527 | 3300027907 | Ga0207428_10057949 | Ga0207428_100579492 | 269 |
| 528 | 3300027907 | Ga0207428_10109057 | Ga0207428_101090572 | 269 |
| 529 | 3300028379 | Ga0268266_10000153 | Ga0268266_1000015373 | 269 |
| 530 | 3300028379 | Ga0268266_10018739 | Ga0268266_100187392 | 269 |
| 531 | 3300028380 | Ga0268265_10008649 | Ga0268265_100086496 | 269 |
| 532 | 3300028380 | Ga0268265_10269091 | Ga0268265_102690911 | 269 |
| 533 | 3300028381 | Ga0268264_10010247 | Ga0268264_100102475 | 269 |
| 534 | 3300028381 | Ga0268264_10115491 | Ga0268264_101154912 | 269 |
| 535 | 3300028381 | Ga0268264_10191092 | Ga0268264_101910921 | 269 |
| 536 | 3300028381 | Ga0268264_10255651 | Ga0268264_102556512 | 269 |
| 537 | 3300031901 | Ga0307406_10048452 | Ga0307406_100484522 | 269 |
| 538 | 3300034820 | Ga0373959_0007585 | Ga0373959_0007585_927_1784 | 269 |
| 539 | 3300035083 | Ga0373926_0019759 | Ga0373926_0019759_826_1683 | 269 |
| 540 | 3300035113 | Ga0373936_0029722 | Ga0373936_0029722_109_966 | 269 |
| 541 | 3300035116 | Ga0373945_0019458 | Ga0373945_0019458_1447_2307 | 269 |
| 542 | 3300035121 | Ga0373960_0030037 | Ga0373960_0030037_531_1388 | 269 |
| 543 | 3300035170 | Ga0373943_0085918 | Ga0373943_0085918_266_1123 | 269 |
| 544 | 3300035410 | Ga0373924_0006511 | Ga0373924_0006511_3078_3935 | 269 |
| 545 | 3300035692 | Ga0373935_0027419 | Ga0373935_0027419_209_1066 | 269 |
| 546 | 3300035692 | Ga0373935_0044677 | Ga0373935_0044677_66_923 | 269 |
| 547 | 3300035692 | Ga0373935_0049405 | Ga0373935_0049405_1601_2455 | 269 |
| 548 | 3300035692 | Ga0373935_0140849 | Ga0373935_0140849_677_1555 | 269 |
| 549 | 3300035725 | Ga0373947_0002984 | Ga0373947_0002984_8589_9446 | 269 |
| 550 | 3300035725 | Ga0373947_0013631 | Ga0373947_0013631_2758_3615 | 269 |
| 551 | 3300037068 | Ga0373925_0004780 | Ga0373925_0004780_1719_2576 | 269 |
| 552 | 3300037418 | Ga0395900_0353860 | Ga0395900_0353860_161_1018 | 269 |
| 553 | 3300037471 | Ga0395905_0287269 | Ga0395905_0287269_96_953 | 269 |
| 554 | 3300038996 | Ga0242420_010991 | Ga0242420_010991_551_1408 | 269 |
| 555 | 3300039438 | Ga0436360_0977840 | Ga0436360_0977840_7226_8083 | 269 |
| 556 | 3300046459 | Ga0495629_0005723 | Ga0495629_0005723_316_1176 | 269 |
| 557 | 3300046472 | Ga0495580_0000108 | Ga0495580_0000108_5612_6472 | 269 |
| 558 | 3300046472 | Ga0495580_0005408 | Ga0495580_0005408_1702_2559 | 269 |
| 559 | 3300046472 | Ga0495580_0096968 | Ga0495580_0096968_1151_2008 | 269 |
| 560 | 3300046473 | Ga0495582_0012719 | Ga0495582_0012719_312_1169 | 269 |
| 561 | 3300046473 | Ga0495582_0097146 | Ga0495582_0097146_426_1283 | 269 |
| 562 | 3300046475 | Ga0495639_0019273 | Ga0495639_0019273_341_1198 | 269 |
| 563 | 3300046476 | Ga0495662_0042533 | Ga0495662_0042533_141_998 | 269 |
| 564 | 3300046499 | Ga0495594_0058332 | Ga0495594_0058332_856_1713 | 269 |
| 565 | 3300046517 | Ga0495630_0171617 | Ga0495630_0171617_514_1371 | 269 |
| 566 | 3300046526 | Ga0495666_0034022 | Ga0495666_0034022_1386_2243 | 269 |
| 567 | 3300046526 | Ga0495666_0076974 | Ga0495666_0076974_672_1529 | 269 |
| 568 | 3300046528 | Ga0495642_0026558 | Ga0495642_0026558_178_1035 | 269 |
| 569 | 3300046531 | Ga0495665_0003170 | Ga0495665_0003170_3313_4170 | 269 |
| 570 | 3300046533 | Ga0495640_0010832 | Ga0495640_0010832_5813_6670 | 269 |
| 571 | 3300046536 | Ga0495587_0062696 | Ga0495587_0062696_1175_2032 | 269 |
| 572 | 3300046616 | Ga0495668_0048806 | Ga0495668_0048806_1190_2047 | 269 |
| 573 | 3300046663 | Ga0495635_0036911 | Ga0495635_0036911_276_1133 | 269 |
| 574 | 3300046664 | Ga0495659_0031677 | Ga0495659_0031677_582_1439 | 269 |
| 575 | 3300046683 | Ga0495658_0234208 | Ga0495658_0234208_172_1029 | 269 |
| 576 | 3300046684 | Ga0495669_0057623 | Ga0495669_0057623_119_976 | 269 |
| 577 | 3300047315 | Ga0495581_0019569 | Ga0495581_0019569_1014_1871 | 269 |
| 578 | 3300047315 | Ga0495581_0121185 | Ga0495581_0121185_115_972 | 269 |
| 579 | 3300047319 | Ga0495674_0150196 | Ga0495674_0150196_385_1242 | 269 |
| 580 | 3300047321 | Ga0495676_0005055 | Ga0495676_0005055_557_1414 | 269 |
| 581 | 3300047322 | Ga0495680_0031898 | Ga0495680_0031898_571_1428 | 269 |
| 582 | 3300047444 | Ga0495675_0315359 | Ga0495675_0315359_34_891 | 269 |
| 583 | 3300047445 | Ga0495677_0082476 | Ga0495677_0082476_45_902 | 269 |
| 584 | 3300047445 | Ga0495677_0084334 | Ga0495677_0084334_283_1140 | 269 |
| 585 | 3300047471 | Ga0495684_0015514 | Ga0495684_0015514_4457_5314 | 269 |
| 586 | 3300047673 | Ga0495593_0064183 | Ga0495593_0064183_430_1287 | 269 |
| 587 | 3300048089 | Ga0495614_0054323 | Ga0495614_0054323_802_1659 | 269 |
| 588 | 3300048904 | Ga0496101_0280035 | Ga0496101_0280035_251_1129 | 269 |
| 589 | 3300048905 | Ga0496102_0026378 | Ga0496102_0026378_3323_4198 | 269 |
| 590 | 3300048905 | Ga0496102_0149961 | Ga0496102_0149961_1205_2062 | 269 |
| 591 | 3300048905 | Ga0496102_0180314 | Ga0496102_0180314_820_1674 | 269 |
| 592 | 3300048911 | Ga0496108_0000258 | Ga0496108_0000258_2276_3130 | 269 |
| 593 | 3300048911 | Ga0496108_0088054 | Ga0496108_0088054_959_1816 | 269 |
| 594 | 3300048912 | Ga0496109_0000781 | Ga0496109_0000781_13277_14131 | 269 |
| 595 | 3300048912 | Ga0496109_0095978 | Ga0496109_0095978_788_1645 | 269 |
| 596 | 3300048913 | Ga0496110_0009726 | Ga0496110_0009726_2347_3201 | 269 |
| 597 | 3300048914 | Ga0496111_0248741 | Ga0496111_0248741_388_1245 | 269 |
| 598 | 3300048915 | Ga0496112_0000081 | Ga0496112_0000081_13390_14244 | 269 |
| 599 | 3300048915 | Ga0496112_0052552 | Ga0496112_0052552_842_1720 | 269 |
| 600 | 3300048918 | Ga0496115_0100316 | Ga0496115_0100316_1483_2340 | 269 |
| 601 | 3300050507 | nmdc:mga05p37_203520_c1 | nmdc:mga05p37_203520_c1_1164_2021 | 269 |
| 602 | 3300050507 | nmdc:mga05p37_372366_c1 | nmdc:mga05p37_372366_c1_775_1632 | 269 |
| 603 | 3300050507 | nmdc:mga05p37_487639_c1 | nmdc:mga05p37_487639_c1_146_1003 | 269 |
| 604 | 3300050511 | nmdc:mga08y16_167076_c1 | nmdc:mga08y16_167076_c1_1235_2092 | 269 |
| 605 | 3300050511 | nmdc:mga08y16_85833_c1 | nmdc:mga08y16_85833_c1_93_950 | 269 |
| 606 | 3300050512 | nmdc:mga0n895_140048_c1 | nmdc:mga0n895_140048_c1_140_997 | 269 |
| 607 | 3300050512 | nmdc:mga0n895_30980_c1 | nmdc:mga0n895_30980_c1_1462_2319 | 269 |
| 608 | 3300050512 | nmdc:mga0n895_33308_c1 | nmdc:mga0n895_33308_c1_1067_1924 | 269 |
| 609 | 3300050512 | nmdc:mga0n895_3497_c1 | nmdc:mga0n895_3497_c1_2359_3216 | 269 |
| 610 | 3300050512 | nmdc:mga0n895_545380_c1 | nmdc:mga0n895_545380_c1_249_1106 | 269 |
| 611 | 3300050513 | nmdc:mga0rr50_193491_c1 | nmdc:mga0rr50_193491_c1_436_1293 | 269 |
| 612 | 3300050513 | nmdc:mga0rr50_31228_c1 | nmdc:mga0rr50_31228_c1_1524_2381 | 269 |
| 613 | 3300050513 | nmdc:mga0rr50_3238_c1 | nmdc:mga0rr50_3238_c1_934_1791 | 269 |
| 614 | 3300050514 | nmdc:mga08x19_202301_c1 | nmdc:mga08x19_202301_c1_212_1069 | 269 |
| 615 | 3300050514 | nmdc:mga08x19_24077_c1 | nmdc:mga08x19_24077_c1_802_1659 | 269 |
| 616 | 3300050514 | nmdc:mga08x19_307507_c1 | nmdc:mga08x19_307507_c1_162_1019 | 269 |
| 617 | 3300050515 | nmdc:mga0a205_20565_c1 | nmdc:mga0a205_20565_c1_993_1850 | 269 |
| 618 | 3300050515 | nmdc:mga0a205_265451_c1 | nmdc:mga0a205_265451_c1_262_1119 | 269 |
| 619 | 3300050515 | nmdc:mga0a205_498_c1 | nmdc:mga0a205_498_c1_16162_17019 | 269 |
| 620 | 3300053077 | Ga0495601_0044209 | Ga0495601_0044209_147_1004 | 269 |
| 621 | 3300053085 | Ga0495619_0013452 | Ga0495619_0013452_1573_2451 | 269 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4zyo-assembly1.cif.gz_A | crystal structure of human integral membrane stearoyl-coa desaturase with substrate | 0.6476 | 7 | 251 |
| 4zyo-assembly1.cif.gz_A | crystal structure of human integral membrane stearoyl-coa desaturase with substrate | 0.577 | 7 | 251 |
| 3m15-assembly1.cif.gz_C | a zn-mediated asymmetric trimer of a cytochrome cb562 variant (d74a-ridc1) | 0.2927 | 91 | 173 |
| 3qvy-assembly1.cif.gz_C | crystal structure of the zn-ridc1 complex stabilized by bmoe crosslinks | 0.2924 | 82 | 169 |
| 3tom-assembly1.cif.gz_D | crystal structure of an engineered cytochrome cb562 that forms 2d, zn-mediated sheets | 0.2745 | 91 | 178 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D8PRP1_310_424_1.20.1310.10 | Mainly Alpha;Up-down Bundle;5 helical Cullin repeat like;Cullin Repeats | 0.2778 | 50 | 169 | 1.20.1310.10 |
| af_Q4D9T1_7_123_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.273 | 53 | 169 | 1.20.140.150 |
| af_Q9XXM8_153_384_1.10.565.10 | Mainly Alpha;Orthogonal Bundle;Retinoid X Receptor;Retinoid X Receptor | 0.2546 | 14 | 171 | 1.10.565.10 |
| af_A0A1D8PRP1_310_424_1.20.1310.10 | Mainly Alpha;Up-down Bundle;5 helical Cullin repeat like;Cullin Repeats | 0.2523 | 50 | 169 | 1.20.1310.10 |
| af_Q4D9T1_7_123_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.2468 | 53 | 169 | 1.20.140.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9QNR1-F1-model_v4 | Fatty acid desaturase domain-containing protein | 0.8714 | 1 | 269 |
GO:0006633
GO:0016020 GO:0016717 |
| AF-A0A2V9QNR1-F1-model_v4 | Fatty acid desaturase domain-containing protein | 0.8684 | 1 | 269 |
GO:0006633
GO:0016020 GO:0016717 |
| AF-A0A2V6Z1P2-F1-model_v4 | Fatty acid desaturase domain-containing protein | 0.8526 | 80 | 269 |
GO:0006629
GO:0016020 GO:0016717 |
| AF-A0A2V6Z1P2-F1-model_v4 | Fatty acid desaturase domain-containing protein | 0.8447 | 80 | 269 |
GO:0006629
GO:0016020 GO:0016717 |
| AF-A0A3M2DHX1-F1-model_v4 | Acyl-CoA desaturase | 0.7843 | 40 | 263 |
GO:0006633
GO:0016020 GO:0016717 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar