F469876

General Info

Members Datasets Scaffolds Average Seq Length
619 327 1238 215

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|3006425503|3006428948
Length 247
Sequence RGNEPMRHDGQHGRSGGGPRGLHHGAVDAGRYELVIFDNDGVLVDSEPLSNRALAAYLTELGHPTTYEDSLRDYMGSALHRVHDLVWERTGRRLPADFDETFHRRVFAEFRRELRPVHGVAEVLAQLTSEGVPYCVASSGHHERIRVTHRTTGLDAYIEEGRVFSAQDVGQGKPAPDLFLHAAATMGVAPERCAVVEDSPLGVRAAVAAGMDVYGFTAMTPAAQLTGATALFSAMAELPRHLGRPGS

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
29 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
30 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
41 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
42 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
43 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
44 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
45 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
57 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
58 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
59 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
60 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
61 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
62 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
63 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
64 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
65 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
66 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
67 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
68 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
69 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
70 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
71 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
72 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
73 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
74 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
75 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
76 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
77 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
78 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
79 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
80 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
81 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
82 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
83 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
84 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
85 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
86 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
87 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
88 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
89 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
90 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
91 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
92 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
93 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
94 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
95 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
96 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
102 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
103 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
104 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
105 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
106 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
107 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
108 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
109 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
110 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
111 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
112 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
113 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
114 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
115 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
116 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
117 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
118 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
119 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
120 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
121 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
122 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
123 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
124 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
125 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
126 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
127 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
128 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
129 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
130 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
131 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
132 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
133 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
134 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
135 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
136 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
137 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
138 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
139 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
140 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
141 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
142 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
143 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
144 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
145 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
146 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
147 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
148 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
149 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
150 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
151 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
152 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
153 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
154 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
155 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
156 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
157 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
158 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
159 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
160 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
161 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
162 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
163 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
164 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
165 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
166 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
167 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
168 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
169 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
170 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
171 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
172 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
173 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
174 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
175 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
181 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
197 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
198 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
199 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
200 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
201 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
202 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
203 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
204 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
205 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
209 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
213 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
214 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
215 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
216 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
217 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
218 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
219 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
220 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
221 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
222 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
223 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
224 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
225 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
226 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
227 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
228 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
229 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
230 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
231 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
232 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
233 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
234 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
235 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
236 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
237 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
238 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
239 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
240 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
241 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
242 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
243 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
244 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
245 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
246 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
247 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
248 2643221548 Streptomyces sp. Root55 Isolate Unclassified
249 2643221578 Streptomyces sp. Root63 Isolate Unclassified
250 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
251 2643221647 Streptomyces sp. Root369 Isolate Unclassified
252 2643221670 Streptomyces sp. Root431 Isolate Unclassified
253 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
254 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
255 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
256 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
257 2643221714 Streptomyces sp. Root264 Isolate Unclassified
258 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
259 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
260 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
261 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
262 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
263 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
264 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
265 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
266 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
267 2808606448 Streptomyces sp. 193411 Isolate Unclassified
268 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
269 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
270 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
271 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
272 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
273 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
274 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
275 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
276 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
277 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
278 2862574272 Streptomyces sp. AcE210 Isolate Nodule
279 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
280 2867369537 Streptomyces sp. Z26 Isolate Unclassified
281 2867428634 Streptomyces sp. RP5T Isolate Unclassified
282 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
283 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
284 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
285 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
286 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
287 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
288 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
289 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
290 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
291 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
292 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
293 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
294 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
295 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
296 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
297 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
298 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
299 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
300 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
301 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
302 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
303 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
304 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
305 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
306 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
307 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
308 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
309 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
310 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
311 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
312 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
313 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
314 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
315 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
316 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
317 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
318 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
319 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
320 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
321 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
322 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
323 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
324 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
325 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
326 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
327 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.3
Metatranscriptomes 0.16
Isolates 14.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.36
Nodule 0.32
Rhizoplane 1.29
Rhizosphere 84.65
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10021130 3300001989 Bacteria 2320
2 JGI24739J22299_10042739 3300001989 Bacteria 1502
3 JGI24737J22298_10013796 3300001990 Bacteria 2628
4 JGI24735J21928_10011257 3300002067 Bacteria 2839
5 JGI24738J21930_10031039 3300002075 Bacteria 1090
6 rootH1_10031499 3300003316 Bacteria 1744
7 rootH1_10083305 3300003323 Bacteria 1193
8 JGI25160J50197_1017437 3300003354 Bacteria 2274
9 JGI25160J50197_1025504 3300003354 Bacteria 1653
10 Ga0006562J51391_1118550 3300003578 Bacteria 5245
11 Ga0070682_100359922 3300005337 Bacteria 1088
12 Ga0070688_100046845 3300005365 Bacteria 2679
13 Ga0070705_100048089 3300005440 Bacteria 2469
14 Ga0070708_100003748 3300005445 Bacteria 11927
15 Ga0070707_100031071 3300005468 Bacteria 5085
16 Ga0070698_100149854 3300005471 Bacteria 2281
17 Ga0068853_100276497 3300005539 Bacteria 1547
18 Ga0068853_100462343 3300005539 Bacteria 1194
19 Ga0070665_100703669 3300005548 Bacteria 1023
20 Ga0070704_100070314 3300005549 Bacteria 2539
21 Ga0070702_100510529 3300005615 Bacteria 885
22 Ga0068861_100260956 3300005719 Bacteria 1483
23 Ga0081455_10117524 3300005937 Bacteria 2101
24 Ga0081455_10281653 3300005937 Bacteria 1201
25 Ga0075367_10001493 3300006178 Bacteria 10103
26 Ga0075428_100000918 3300006844 Bacteria 31110
27 Ga0075428_100016973 3300006844 Bacteria 8042
28 Ga0075430_100031735 3300006846 Bacteria 4483
29 Ga0075430_100178712 3300006846 Bacteria 1765
30 Ga0075431_100046338 3300006847 Bacteria 4483
31 Ga0075431_100133693 3300006847 Bacteria 2557
32 Ga0075433_10301024 3300006852 Bacteria 1420
33 Ga0075434_100083517 3300006871 Bacteria 3191
34 Ga0075429_100005183 3300006880 Bacteria 11207
35 Ga0075429_100099942 3300006880 Bacteria 2531
36 Ga0068865_100593632 3300006881 Bacteria 935
37 Ga0099794_10017634 3300007265 Bacteria 3185
38 Ga0105251_10042895 3300009011 Bacteria 2193
39 Ga0111539_10235221 3300009094 Bacteria 2133
40 Ga0114129_10000234 3300009147 Bacteria 61922
41 Ga0114129_10050715 3300009147 Bacteria 5828
42 Ga0114129_10074575 3300009147 Bacteria 4726
43 Ga0114129_11046557 3300009147 Bacteria 1025
44 Ga0105241_10523435 3300009174 Bacteria 1061
45 Ga0105242_10271335 3300009176 Bacteria 1537
46 Ga0105248_10444950 3300009177 Bacteria 1460
47 Ga0105249_10553972 3300009553 Bacteria 1201
48 Ga0105239_10279572 3300010375 Bacteria 1879
49 Ga0105246_10010674 3300011119 Bacteria 5689
50 Ga0105246_10220239 3300011119 Bacteria 1487
51 Ga0105246_10756569 3300011119 Bacteria 858
52 Ga0157375_11427198 3300013308 Bacteria 816
53 Ga0182008_10072265 3300014497 Bacteria 1697
54 Ga0157379_10274855 3300014968 Bacteria 1532
55 Ga0157379_10484811 3300014968 Bacteria 1144
56 Ga0182007_10008879 3300015262 Bacteria 4095
57 Ga0183367_1002 3300015688 Bacteria 1101531
58 Ga0207426_1004946 3300025302 Bacteria 6283
59 Ga0207426_1005010 3300025302 Bacteria 6228
60 Ga0207426_1009547 3300025302 Bacteria 3829
61 Ga0207426_1021679 3300025302 Bacteria 2217
62 Ga0207647_10090484 3300025904 Bacteria 1825
63 Ga0207647_10230119 3300025904 Bacteria 1067
64 Ga0207684_10130223 3300025910 Bacteria 2159
65 Ga0207646_10023858 3300025922 Bacteria 5613
66 Ga0207690_10337878 3300025932 Bacteria 1188
67 Ga0207706_10032658 3300025933 Bacteria 4634
68 Ga0207686_10171632 3300025934 Bacteria 1530
69 Ga0207709_10085637 3300025935 Bacteria 2044
70 Ga0207668_10085225 3300025972 Bacteria 2305
71 Ga0207668_10416291 3300025972 Bacteria 1140
72 Ga0207639_10153559 3300026041 Bacteria 1931
73 Ga0207674_10501451 3300026116 Bacteria 1173
74 Ga0207675_100594620 3300026118 Bacteria 1109
75 Ga0209813_10101513 3300027866 Bacteria 979
76 Ga0307517_10008672 3300028786 Bacteria 14556
77 Ga0268256_1054667 3300030500 Bacteria 825
78 Ga0307511_10000940 3300030521 Bacteria 30847
79 Ga0307511_10087226 3300030521 Bacteria 2143
80 Ga0307512_10004567 3300030522 Bacteria 15094
81 Ga0307512_10056820 3300030522 Bacteria 3068
82 Ga0307509_10057381 3300031507 Bacteria 4128
83 Ga0307508_10003855 3300031616 Bacteria 14933
84 Ga0307508_10005432 3300031616 Bacteria 12115
85 Ga0307508_10143259 3300031616 Bacteria 1994
86 Ga0307508_10189225 3300031616 Bacteria 1659
87 Ga0307508_10435880 3300031616 Bacteria 902
88 Ga0307516_10119815 3300031730 Bacteria 2424
89 Ga0307518_10230763 3300031838 Bacteria 1198
90 Ga0307410_10331157 3300031852 Bacteria 1211
91 Ga0307407_10671291 3300031903 Bacteria 778
92 Ga0307415_100198770 3300032126 Bacteria 1589
93 Ga0307507_10153221 3300033179 Bacteria 1727
94 Ga0307510_10058938 3300033180 Bacteria 3970
95 Ga0307510_10066437 3300033180 Bacteria 3641
96 Ga0307510_10160103 3300033180 Bacteria 1850
97 Ga0395898_0028094 3300037466 Bacteria 5641
98 Ga0395898_0484690 3300037466 Bacteria 1176
99 Ga0395898_0602636 3300037466 Bacteria 1041
100 Ga0395901_0498204 3300038443 Bacteria 1240
101 Ga0395901_0601256 3300038443 Bacteria 1109
102 Ga0439439_0022416 3300041406 Bacteria 1577
103 Ga0451797_0759924 3300041453 Bacteria 1042
104 Ga0451795_0759397 3300041456 Bacteria 867
105 Ga0451853_0542090 3300041512 Bacteria 7687
106 Ga0451853_0672206 3300041512 Bacteria 1897
107 Ga0439433_0036362 3300041999 Bacteria 1137
108 Ga0439448_0007943 3300042005 Bacteria 3091
109 Ga0439449_0012461 3300042007 Bacteria 3196
110 Ga0439449_0071614 3300042007 Bacteria 1277
111 Ga0439449_0121547 3300042007 Bacteria 969
112 Ga0439455_0013502 3300042012 Bacteria 1850
113 Ga0439457_002987 3300042014 Bacteria 4699
114 Ga0439457_010595 3300042014 Bacteria 2116
115 Ga0439462_0044530 3300042015 Bacteria 1187
116 Ga0450894_001448 3300042131 Bacteria 3408
117 Ga0450898_009397 3300042134 Bacteria 1563
118 Ga0450899_002009 3300042135 Bacteria 2237
119 Ga0450900_036300 3300042136 Bacteria 727
120 Ga0450903_000232 3300042138 Bacteria 12397
121 Ga0450903_013525 3300042138 Bacteria 1297
122 Ga0450906_019413 3300042145 Bacteria 1218
123 Ga0466969_0004334 3300044656 Bacteria 7550
124 Ga0466969_0006588 3300044656 Bacteria 6174
125 Ga0466969_0056881 3300044656 Bacteria 1908
126 Ga0466972_0008438 3300044658 Bacteria 5165
127 Ga0466972_0175402 3300044658 Bacteria 1005
128 Ga0466972_0226754 3300044658 Bacteria 874
129 Ga0466965_0007033 3300044683 Bacteria 5150
130 Ga0466965_0077934 3300044683 Bacteria 1674
131 Ga0466965_0146808 3300044683 Bacteria 1231
132 Ga0466966_0009969 3300044684 Bacteria 6295
133 Ga0466966_0028899 3300044684 Bacteria 3609
134 Ga0466966_0048430 3300044684 Bacteria 2707
135 Ga0466961_0001913 3300044693 Bacteria 12982
136 Ga0466961_0031248 3300044693 Bacteria 3423
137 Ga0466961_0031336 3300044693 Bacteria 3418
138 Ga0466961_0032924 3300044693 Bacteria 3330
139 Ga0466961_0296332 3300044693 Bacteria 988
140 Ga0466963_0017463 3300044694 Bacteria 4472
141 Ga0466964_0005429 3300044706 Bacteria 4731
142 Ga0466971_0056294 3300044719 Bacteria 1773
143 Ga0466971_0297716 3300044719 Bacteria 774
144 Ga0466970_0004687 3300044765 Bacteria 6753
145 Ga0466970_0091411 3300044765 Bacteria 1652
146 Ga0466970_0134700 3300044765 Bacteria 1358
147 Ga0466970_0461238 3300044765 Bacteria 729
148 Ga0466957_0001776 3300044842 Bacteria 11359
149 Ga0466957_0028244 3300044842 Bacteria 3339
150 Ga0466957_0257030 3300044842 Bacteria 1163
151 Ga0466959_0013462 3300045049 Bacteria 5929
152 Ga0466959_0024614 3300045049 Bacteria 4460
153 Ga0466959_0034361 3300045049 Bacteria 3750
154 Ga0466958_0018722 3300045836 Bacteria 4023
155 Ga0466958_0158796 3300045836 Bacteria 1428
156 Ga0466967_0018680 3300045976 Bacteria 5550
157 Ga0466967_0432891 3300045976 Bacteria 1283
158 Ga0466967_0549729 3300045976 Bacteria 1136
159 Ga0466967_1052216 3300045976 Bacteria 811
160 Ga0495617_020064 3300046452 Bacteria 2258
161 Ga0495592_0073897 3300046454 Bacteria 2477
162 Ga0495592_0090000 3300046454 Bacteria 2203
163 Ga0495592_0095679 3300046454 Bacteria 2123
164 Ga0495603_0017291 3300046455 Bacteria 4366
165 Ga0495603_0056249 3300046455 Bacteria 2329
166 Ga0495603_0064382 3300046455 Bacteria 2162
167 Ga0495603_0069739 3300046455 Bacteria 2067
168 Ga0495603_0075283 3300046455 Bacteria 1981
169 Ga0495603_0382020 3300046455 Bacteria 807
170 Ga0495603_0423877 3300046455 Bacteria 762
171 Ga0495590_0066927 3300046457 Bacteria 1258
172 Ga0495629_0018134 3300046459 Bacteria 5042
173 Ga0495629_0021330 3300046459 Bacteria 4622
174 Ga0495629_0111774 3300046459 Bacteria 1904
175 Ga0495629_0155595 3300046459 Bacteria 1588
176 Ga0495629_0209261 3300046459 Bacteria 1347
177 Ga0495629_0280858 3300046459 Bacteria 1142
178 Ga0495629_0449491 3300046459 Bacteria 872
179 Ga0495638_0101850 3300046460 Bacteria 1716
180 Ga0495638_0121371 3300046460 Bacteria 1544
181 Ga0495638_0378731 3300046460 Bacteria 740
182 Ga0495651_0001792 3300046462 Bacteria 16553
183 Ga0495651_0029295 3300046462 Bacteria 4292
184 Ga0495651_0130095 3300046462 Bacteria 1838
185 Ga0495653_0016437 3300046463 Bacteria 6025
186 Ga0495580_0026811 3300046472 Bacteria 4197
187 Ga0495582_0069225 3300046473 Bacteria 1951
188 Ga0495582_0451099 3300046473 Bacteria 743
189 Ga0495605_0019117 3300046474 Bacteria 3665
190 Ga0495639_0021796 3300046475 Bacteria 2806
191 Ga0495662_0003416 3300046476 Bacteria 8046
192 Ga0495662_0007996 3300046476 Bacteria 5207
193 Ga0495662_0045721 3300046476 Bacteria 2113
194 Ga0495662_0071930 3300046476 Bacteria 1676
195 Ga0495662_0097036 3300046476 Bacteria 1441
196 Ga0495662_0232615 3300046476 Bacteria 908
197 Ga0495662_0258922 3300046476 Bacteria 856
198 Ga0495662_0269816 3300046476 Bacteria 837
199 Ga0495664_0003498 3300046477 Bacteria 8554
200 Ga0495584_0080114 3300046491 Bacteria 1643
201 Ga0495585_0089283 3300046492 Bacteria 1661
202 Ga0495585_0317469 3300046492 Bacteria 762
203 Ga0495594_0011111 3300046499 Bacteria 4676
204 Ga0495594_0100530 3300046499 Bacteria 1627
205 Ga0495594_0145735 3300046499 Bacteria 1343
206 Ga0495594_0376918 3300046499 Bacteria 807
207 Ga0495594_0412336 3300046499 Bacteria 768
208 Ga0495596_0061589 3300046500 Bacteria 1461
209 Ga0495607_0113400 3300046501 Bacteria 1434
210 Ga0495583_0025703 3300046506 Bacteria 2936
211 Ga0495583_0099678 3300046506 Bacteria 1241
212 Ga0495608_0002748 3300046511 Bacteria 12637
213 Ga0495608_0317874 3300046511 Bacteria 962
214 Ga0495616_0002969 3300046513 Bacteria 11011
215 Ga0495618_0026221 3300046514 Bacteria 3622
216 Ga0495618_0069245 3300046514 Bacteria 2243
217 Ga0495620_0013671 3300046515 Bacteria 4149
218 Ga0495620_0026910 3300046515 Bacteria 2698
219 Ga0495628_0000894 3300046516 Bacteria 27438
220 Ga0495628_0142800 3300046516 Bacteria 1826
221 Ga0495628_0430432 3300046516 Bacteria 960
222 Ga0495630_0007593 3300046517 Bacteria 7752
223 Ga0495630_0121446 3300046517 Bacteria 1982
224 Ga0495631_0042284 3300046518 Bacteria 2014
225 Ga0495643_0049380 3300046522 Bacteria 2269
226 Ga0495648_0084682 3300046524 Bacteria 1793
227 Ga0495666_0000866 3300046526 Bacteria 14116
228 Ga0495666_0061845 3300046526 Bacteria 1789
229 Ga0495666_0068321 3300046526 Bacteria 1692
230 Ga0495666_0069074 3300046526 Bacteria 1681
231 Ga0495652_0220759 3300046529 Bacteria 1424
232 Ga0495652_0324387 3300046529 Bacteria 1111
233 Ga0495652_0367966 3300046529 Bacteria 1025
234 Ga0495654_0065500 3300046530 Bacteria 1734
235 Ga0495665_0003278 3300046531 Bacteria 8767
236 Ga0495640_0010715 3300046533 Bacteria 7072
237 Ga0495640_0013397 3300046533 Bacteria 6229
238 Ga0495640_0062057 3300046533 Bacteria 2536
239 Ga0495640_0113026 3300046533 Bacteria 1772
240 Ga0495640_0322110 3300046533 Bacteria 957
241 Ga0495586_0161401 3300046535 Bacteria 1264
242 Ga0495587_0055190 3300046536 Bacteria 2340
243 Ga0495587_0317112 3300046536 Bacteria 871
244 Ga0495609_0006244 3300046538 Bacteria 6117
245 Ga0495597_0067523 3300046542 Bacteria 1546
246 Ga0495597_0153510 3300046542 Bacteria 943
247 Ga0495645_0026337 3300046543 Bacteria 4221
248 Ga0495645_0043677 3300046543 Bacteria 3269
249 Ga0495645_0178645 3300046543 Bacteria 1456
250 Ga0495622_0066528 3300046557 Bacteria 1666
251 Ga0495622_0123124 3300046557 Bacteria 1183
252 Ga0495622_0171724 3300046557 Bacteria 975
253 Ga0495622_0176417 3300046557 Bacteria 959
254 Ga0495622_0271164 3300046557 Bacteria 743
255 Ga0495633_0137393 3300046558 Bacteria 1130
256 Ga0495667_0162565 3300046559 Bacteria 1436
257 Ga0495667_0177479 3300046559 Bacteria 1368
258 Ga0495667_0273759 3300046559 Bacteria 1072
259 Ga0495667_0325838 3300046559 Bacteria 972
260 Ga0495667_0503801 3300046559 Bacteria 758
261 Ga0495668_0162770 3300046616 Bacteria 1222
262 Ga0495634_0002657 3300046642 Bacteria 14692
263 Ga0495634_0016279 3300046642 Bacteria 5320
264 Ga0495634_0025200 3300046642 Bacteria 4167
265 Ga0495634_0157094 3300046642 Bacteria 1435
266 Ga0495625_0045485 3300046660 Bacteria 3173
267 Ga0495625_0098790 3300046660 Bacteria 2007
268 Ga0495625_0130120 3300046660 Bacteria 1705
269 Ga0495635_0002156 3300046663 Bacteria 13366
270 Ga0495635_0060726 3300046663 Bacteria 2597
271 Ga0495635_0125546 3300046663 Bacteria 1750
272 Ga0495588_0005537 3300046674 Bacteria 5624
273 Ga0495588_0138837 3300046674 Bacteria 1283
274 Ga0495588_0297333 3300046674 Bacteria 850
275 Ga0495657_0003657 3300046675 Bacteria 12478
276 Ga0495657_0011455 3300046675 Bacteria 6629
277 Ga0495657_0047841 3300046675 Bacteria 2888
278 Ga0495657_0056059 3300046675 Bacteria 2626
279 Ga0495657_0263221 3300046675 Bacteria 1035
280 Ga0495599_0063902 3300046678 Bacteria 2299
281 Ga0495599_0245924 3300046678 Bacteria 1090
282 Ga0495623_0028200 3300046679 Bacteria 3612
283 Ga0495623_0067314 3300046679 Bacteria 2236
284 Ga0495623_0084377 3300046679 Bacteria 1960
285 Ga0495646_0001344 3300046680 Bacteria 14523
286 Ga0495646_0109685 3300046680 Bacteria 1572
287 Ga0495658_0271336 3300046683 Bacteria 1069
288 Ga0495613_0006748 3300046689 Bacteria 8572
289 Ga0495613_0020402 3300046689 Bacteria 4939
290 Ga0495613_0065837 3300046689 Bacteria 2647
291 Ga0495613_0134729 3300046689 Bacteria 1767
292 Ga0495613_0161824 3300046689 Bacteria 1592
293 Ga0495613_0212650 3300046689 Bacteria 1359
294 Ga0495613_0271107 3300046689 Bacteria 1180
295 Ga0495613_0300789 3300046689 Bacteria 1110
296 Ga0495624_0038498 3300046690 Bacteria 3072
297 Ga0495624_0086754 3300046690 Bacteria 1933
298 Ga0495624_0133310 3300046690 Bacteria 1523
299 Ga0495624_0156519 3300046690 Bacteria 1393
300 Ga0495624_0232352 3300046690 Bacteria 1117
301 Ga0495624_0308012 3300046690 Bacteria 954
302 Ga0495649_0312518 3300046694 Bacteria 798
303 Ga0495649_0346188 3300046694 Bacteria 751
304 Ga0495589_0031350 3300046794 Bacteria 2676
305 Ga0495589_0033040 3300046794 Bacteria 2599
306 Ga0495589_0230293 3300046794 Bacteria 869
307 Ga0495589_0247327 3300046794 Bacteria 834
308 Ga0495600_0002052 3300046809 Bacteria 11356
309 Ga0495600_0103059 3300046809 Bacteria 1859
310 Ga0495600_0103505 3300046809 Bacteria 1855
311 Ga0495660_0117211 3300046810 Bacteria 1351
312 Ga0495581_0007246 3300047315 Bacteria 6415
313 Ga0495581_0048645 3300047315 Bacteria 2448
314 Ga0495581_0303280 3300047315 Bacteria 933
315 Ga0495604_0002185 3300047317 Bacteria 15686
316 Ga0495604_0003125 3300047317 Bacteria 13234
317 Ga0495604_0016494 3300047317 Bacteria 5906
318 Ga0495604_0093642 3300047317 Bacteria 2222
319 Ga0495604_0094526 3300047317 Bacteria 2209
320 Ga0495604_0342183 3300047317 Bacteria 995
321 Ga0495636_0021712 3300047318 Bacteria 2593
322 Ga0495636_0042451 3300047318 Bacteria 1890
323 Ga0495636_0138997 3300047318 Bacteria 1084
324 Ga0495636_0196193 3300047318 Bacteria 920
325 Ga0495636_0202394 3300047318 Bacteria 907
326 Ga0495636_0308747 3300047318 Bacteria 741
327 Ga0495674_0026114 3300047319 Bacteria 5345
328 Ga0495674_0340686 3300047319 Bacteria 1218
329 Ga0495676_0005520 3300047321 Bacteria 11598
330 Ga0495676_0025641 3300047321 Bacteria 5087
331 Ga0495676_0028070 3300047321 Bacteria 4815
332 Ga0495676_0057556 3300047321 Bacteria 3064
333 Ga0495676_0104831 3300047321 Bacteria 2085
334 Ga0495676_0115497 3300047321 Bacteria 1962
335 Ga0495676_0336394 3300047321 Bacteria 1011
336 Ga0495680_0088825 3300047322 Bacteria 2321
337 Ga0495683_0178950 3300047323 Bacteria 970
338 Ga0495687_017250 3300047443 Bacteria 3607
339 Ga0495687_022227 3300047443 Bacteria 3049
340 Ga0495687_059388 3300047443 Bacteria 1582
341 Ga0495687_068416 3300047443 Bacteria 1433
342 Ga0495687_114226 3300047443 Bacteria 986
343 Ga0495687_121149 3300047443 Bacteria 943
344 Ga0495675_0004981 3300047444 Bacteria 8085
345 Ga0495675_0026133 3300047444 Bacteria 3722
346 Ga0495675_0055798 3300047444 Bacteria 2505
347 Ga0495675_0078181 3300047444 Bacteria 2083
348 Ga0495675_0099415 3300047444 Bacteria 1822
349 Ga0495675_0222983 3300047444 Bacteria 1140
350 Ga0495675_0248012 3300047444 Bacteria 1070
351 Ga0495677_0107659 3300047445 Bacteria 1058
352 Ga0495685_001064 3300047447 Bacteria 8370
353 Ga0495685_013149 3300047447 Bacteria 2807
354 Ga0495685_046331 3300047447 Bacteria 1479
355 Ga0495685_129543 3300047447 Bacteria 825
356 Ga0495685_137009 3300047447 Bacteria 798
357 Ga0495685_144410 3300047447 Bacteria 774
358 Ga0495681_0016612 3300047470 Bacteria 4115
359 Ga0495684_0002671 3300047471 Bacteria 14129
360 Ga0495684_0015480 3300047471 Bacteria 5868
361 Ga0495684_0302510 3300047471 Bacteria 1148
362 Ga0495593_0006676 3300047673 Bacteria 6754
363 Ga0495593_0018331 3300047673 Bacteria 3934
364 Ga0495593_0054501 3300047673 Bacteria 2107
365 Ga0495593_0153425 3300047673 Bacteria 1164
366 Ga0495602_0040299 3300048088 Bacteria 4286
367 Ga0495602_0061466 3300048088 Bacteria 3266
368 Ga0495614_0001050 3300048089 Bacteria 11791
369 Ga0495614_0011079 3300048089 Bacteria 3966
370 Ga0495614_0071724 3300048089 Bacteria 1493
371 Ga0495614_0089737 3300048089 Bacteria 1336
372 Ga0495614_0131298 3300048089 Bacteria 1108
373 Ga0495614_0197444 3300048089 Bacteria 909
374 Ga0495614_0244393 3300048089 Bacteria 820
375 Ga0495626_0117679 3300048091 Bacteria 1145
376 Ga0496102_0510201 3300048905 Bacteria 1125
377 Ga0496105_0654957 3300048908 Bacteria 810
378 Ga0496110_0166901 3300048913 Bacteria 1996
379 Ga0496110_0378615 3300048913 Bacteria 1290
380 Ga0496113_0200124 3300048916 Bacteria 1588
381 Ga0495678_086457 3300049459 Bacteria 1114
382 Ga0501031_0000983 3300049568 Bacteria 17336
383 Ga0501031_0026077 3300049568 Bacteria 3812
384 Ga0501031_0075410 3300049568 Bacteria 2196
385 Ga0501031_0326173 3300049568 Bacteria 994
386 Ga0501031_0391871 3300049568 Bacteria 898
387 Ga0501031_0413218 3300049568 Bacteria 872
388 Ga0501032_0012494 3300049569 Bacteria 6064
389 Ga0501032_0024039 3300049569 Bacteria 4208
390 Ga0501032_0047602 3300049569 Bacteria 2895
391 Ga0501032_0080714 3300049569 Bacteria 2164
392 Ga0501032_0101966 3300049569 Bacteria 1902
393 Ga0501032_0211151 3300049569 Bacteria 1265
394 Ga0501032_0362150 3300049569 Bacteria 933
395 Ga0501032_0451363 3300049569 Bacteria 823
396 Ga0501032_0634130 3300049569 Bacteria 679
397 Ga0501033_0038087 3300049570 Bacteria 3597
398 Ga0501033_0043101 3300049570 Bacteria 3361
399 Ga0501033_0133334 3300049570 Bacteria 1798
400 Ga0501033_0334443 3300049570 Bacteria 1062
401 Ga0501033_0400734 3300049570 Bacteria 957
402 Ga0501033_0483643 3300049570 Bacteria 857
403 Ga0501033_0580841 3300049570 Bacteria 770
404 Ga0501034_0044701 3300049571 Bacteria 4477
405 Ga0501034_0105663 3300049571 Bacteria 2808
406 Ga0501034_0158921 3300049571 Bacteria 2232
407 Ga0501034_0801523 3300049571 Bacteria 834
408 Ga0501036_0013747 3300049572 Bacteria 6730
409 Ga0501036_0023541 3300049572 Bacteria 5189
410 Ga0501036_0064959 3300049572 Bacteria 3088
411 Ga0501036_0182303 3300049572 Bacteria 1767
412 Ga0501036_0568129 3300049572 Bacteria 942
413 Ga0501036_0636344 3300049572 Bacteria 883
414 Ga0501036_0669534 3300049572 Bacteria 858
415 Ga0501037_0132792 3300049573 Bacteria 1784
416 Ga0501037_0188313 3300049573 Bacteria 1462
417 Ga0501038_0002380 3300049574 Bacteria 17520
418 Ga0501038_0017207 3300049574 Bacteria 6536
419 Ga0501038_0030731 3300049574 Bacteria 4749
420 Ga0501038_0069482 3300049574 Bacteria 2992
421 Ga0501038_0143265 3300049574 Bacteria 1953
422 Ga0501038_0209120 3300049574 Bacteria 1562
423 Ga0501039_0023711 3300049575 Bacteria 4710
424 Ga0501039_0045259 3300049575 Bacteria 3400
425 Ga0501040_0030998 3300049576 Bacteria 3613
426 Ga0501041_0075924 3300049577 Bacteria 2067
427 Ga0501041_0120995 3300049577 Bacteria 1627
428 Ga0501042_0109272 3300049578 Bacteria 1991
429 Ga0501042_0357142 3300049578 Bacteria 1057
430 Ga0501042_0462259 3300049578 Bacteria 920
431 Ga0501043_0016798 3300049579 Bacteria 5735
432 Ga0501043_0049777 3300049579 Bacteria 3294
433 Ga0501043_0063486 3300049579 Bacteria 2900
434 Ga0501043_0102817 3300049579 Bacteria 2245
435 Ga0501046_0134510 3300049580 Bacteria 1873
436 Ga0501046_0235150 3300049580 Bacteria 1353
437 Ga0501047_0195946 3300049581 Bacteria 1882
438 Ga0501047_0231224 3300049581 Bacteria 1702
439 Ga0501047_0233823 3300049581 Bacteria 1690
440 Ga0501047_0308190 3300049581 Bacteria 1424
441 Ga0501048_0030602 3300049582 Bacteria 3894
442 Ga0501048_0298237 3300049582 Bacteria 1146
443 Ga0501048_0437430 3300049582 Bacteria 936
444 Ga0501067_0056351 3300049583 Bacteria 2177
445 Ga0501068_0049647 3300049584 Bacteria 2535
446 Ga0501070_0003603 3300049586 Bacteria 13395
447 Ga0501070_0124919 3300049586 Bacteria 2126
448 Ga0501070_0178747 3300049586 Bacteria 1747
449 Ga0501070_0652930 3300049586 Bacteria 835
450 Ga0501070_0674363 3300049586 Bacteria 819
451 Ga0501071_0002754 3300049587 Bacteria 10789
452 Ga0501071_0070466 3300049587 Bacteria 2547
453 Ga0501072_0002394 3300049588 Bacteria 14060
454 Ga0501072_0019350 3300049588 Bacteria 5262
455 Ga0501073_0099279 3300049589 Bacteria 2021
456 Ga0501073_0527451 3300049589 Bacteria 816
457 Ga0501074_0164023 3300049590 Bacteria 1586
458 Ga0501074_0229695 3300049590 Bacteria 1321
459 Ga0501075_0026840 3300049591 Bacteria 4242
460 Ga0501076_0100661 3300049592 Bacteria 2328
461 Ga0501077_0030561 3300049593 Bacteria 3427
462 Ga0501077_0129296 3300049593 Bacteria 1601
463 Ga0501079_0013843 3300049741 Bacteria 6153
464 Ga0501079_0083385 3300049741 Bacteria 2473
465 Ga0501079_0265200 3300049741 Bacteria 1342
466 Ga0501080_0065326 3300049742 Bacteria 3385
467 Ga0501080_0137233 3300049742 Bacteria 2263
468 Ga0501081_0098040 3300049743 Bacteria 2069
469 Ga0501081_0123490 3300049743 Bacteria 1846
470 Ga0501083_0016152 3300049744 Bacteria 5228
471 Ga0501035_0001925 3300049822 Bacteria 20813
472 Ga0501035_0018676 3300049822 Bacteria 6386
473 Ga0501035_0042587 3300049822 Bacteria 4094
474 Ga0501035_0052616 3300049822 Bacteria 3643
475 Ga0501035_0112657 3300049822 Bacteria 2383
476 Ga0501044_0026918 3300049823 Bacteria 6085
477 Ga0501044_0042683 3300049823 Bacteria 4715
478 Ga0501044_0045040 3300049823 Bacteria 4575
479 Ga0501044_0056304 3300049823 Bacteria 4037
480 Ga0501044_0132047 3300049823 Bacteria 2490
481 Ga0501044_0170311 3300049823 Bacteria 2149
482 Ga0501044_0213462 3300049823 Bacteria 1883
483 Ga0501044_0223188 3300049823 Bacteria 1834
484 Ga0501044_0683491 3300049823 Bacteria 913
485 Ga0501045_0045693 3300049824 Bacteria 3188
486 Ga0501045_0292535 3300049824 Bacteria 1212
487 Ga0501045_0541294 3300049824 Bacteria 864
488 Ga0501045_0698499 3300049824 Bacteria 748
489 nmdc:mga03n38_178569_c1 3300050490 Bacteria 1086
490 nmdc:mga03n38_380216_c1 3300050490 Bacteria 774
491 nmdc:mga06z11_107359_c1 3300050494 Bacteria 1541
492 nmdc:mga04h51_155258_c1 3300050495 Bacteria 877
493 nmdc:mga05p37_637287_c1 3300050507 Bacteria 1196
494 nmdc:mga05p37_6430_c1 3300050507 Bacteria 13855
495 nmdc:mga05p37_911393_c1 3300050507 Bacteria 946
496 nmdc:mga09592_186372_c1 3300050508 Bacteria 1796
497 nmdc:mga0qj67_4731_c1 3300050509 Bacteria 9889
498 nmdc:mga06r32_130810_c1 3300050510 Bacteria 2482
499 nmdc:mga06r32_77690_c1 3300050510 Bacteria 3225
500 nmdc:mga0n895_15597_c1 3300050512 Bacteria 6935
501 nmdc:mga0n895_185134_c1 3300050512 Bacteria 2113
502 nmdc:mga0rr50_14584_c1 3300050513 Bacteria 5160
503 Ga0495601_0100012 3300053077 Bacteria 1872
504 Ga0495655_0135102 3300053083 Bacteria 763
505 Ga0495619_0062328 3300053085 Bacteria 2482
506 Ga0495619_0132636 3300053085 Bacteria 1712
507 Ga0500566_0071734 3300053094 Bacteria 1943
508 Ga0500640_008343 3300053095 Bacteria 4093
509 Ga0500654_060923 3300053099 Bacteria 1933
510 Ga0500654_172892 3300053099 Bacteria 706
511 Ga0500553_129684 3300053101 Bacteria 1019
512 Ga0500553_139802 3300053101 Bacteria 957
513 Ga0500560_048059 3300053107 Bacteria 1361
514 Ga0500569_064402 3300053109 Bacteria 1139
515 Ga0500561_0141312 3300053137 Bacteria 745
516 Ga0500573_0069991 3300053140 Bacteria 2002
517 Ga0500600_0102306 3300053149 Bacteria 1508
518 Ga0500600_0157237 3300053149 Bacteria 1122
519 Ga0500616_0046167 3300053153 Bacteria 2316
520 Ga0500636_0327252 3300053177 Bacteria 742
521 Ga0500587_023473 3300053739 Bacteria 815
522 Ga0501084_0020562 3300054114 Bacteria 5504
523 Ga0501084_0093400 3300054114 Bacteria 2526
524 Ga0501084_0275902 3300054114 Bacteria 1419
525 Ga0501082_0032395 3300060353 Bacteria 4508
526 Ga0501082_0065461 3300060353 Bacteria 3130
527 Ga0501082_0574842 3300060353 Bacteria 986
528 Ga0466962_0012876 3300061719 Bacteria 4023
529 Ga0466962_0057761 3300061719 Bacteria 1852
530 3006428948 3006425503 Bacteria 6491253
531 2547410212 2547132111 Bacteria 8013147
532 2554256980 2554235005 Bacteria 6457341
533 2585301207 2582581312 Bacteria 7308206
534 2585308338 2582581313 Bacteria 10042643
535 2585321693 2582581314 Bacteria 11452267
536 2616703181 2616644814 Bacteria 11555299
537 2616904702 2616644941 Bacteria 8510691
538 2643762864 2643221548 Bacteria 8053412
539 2643898332 2643221578 Bacteria 9213798
540 2643941811 2643221587 Bacteria 7586415
541 2643943386 2643221587 Bacteria 7586415
542 2644261858 2643221647 Bacteria 10741251
543 2644388550 2643221670 Bacteria 6497041
544 2644403797 2643221673 Bacteria 9196637
545 2644428894 2643221677 Bacteria 7584031
546 2644429963 2643221677 Bacteria 7584031
547 2644439098 2643221678 Bacteria 9540101
548 2644459967 2643221682 Bacteria 6743283
549 2644632345 2643221714 Bacteria 9015452
550 2676488188 2675903060 Bacteria 10051191
551 2784589474 2784132148 Bacteria 8627943
552 2785342113 2784746763 Bacteria 9783172
553 2785370547 2784746768 Bacteria 10036182
554 2786671704 2786546132 Bacteria 10419719
555 2793983277 2791355406 Bacteria 11364898
556 2804845787 2802429296 Bacteria 7227771
557 2808843104 2808606359 Bacteria 9866990
558 2808921452 2808606375 Bacteria 9466072
559 2809233138 2808606448 Bacteria 8656184
560 2811845294 2808606982 Bacteria 7791042
561 2812357016 2811994879 Bacteria 9313447
562 2812479678 2811994917 Bacteria 7761064
563 2816421094 2816332119 Bacteria 8120218
564 2819698103 2818991463 Bacteria 7948711
565 2852640612 2852635781 Bacteria 8251373
566 2862181580 2862178590 Bacteria 8583590
567 2862286854 2862281513 Bacteria 9621493
568 2862291311 2862290372 Bacteria 7471434
569 2862514559 2862507626 Bacteria 9425308
570 2862578375 2862574272 Bacteria 10567477
571 2863411796 2863404153 Bacteria 9672205
572 2867373042 2867369537 Bacteria 6501581
573 2867437637 2867428634 Bacteria 9590268
574 2873154899 2873151551 Bacteria 8625867
575 2875394619 2875391855 Bacteria 7600475
576 2877680076 2877676314 Bacteria 9512378
577 2912718668 2912715099 Bacteria 9460473
578 2912730994 2912723979 Bacteria 8557534
579 2912761928 2912757875 Bacteria 7940295
580 2918504549 2918501144 Bacteria 8668083
581 2919476051 2919468124 Bacteria 9133025
582 2935392377 2935390628 Bacteria 7043367
583 2946050014 2946045630 Bacteria 8527308
584 2946068864 2946064051 Bacteria 8957905
585 2946076904 2946072368 Bacteria 8999607
586 2947228048 2947224130 Bacteria 9938529
587 2954002834 2954002825 Bacteria 9173742
588 2954385006 2954380949 Bacteria 10050426
589 2954677989 2954673503 Bacteria 9685905
590 2954686168 2954682443 Bacteria 9862841
591 2954695823 2954691527 Bacteria 10720516
592 2954711014 2954701450 Bacteria 10834262
593 2954715232 2954711539 Bacteria 10867210
594 2954725173 2954721474 Bacteria 10456478
595 2954736645 2954731030 Bacteria 10243860
596 2954744106 2954740390 Bacteria 10229294
597 2954755492 2954749733 Bacteria 10366972
598 2954763048 2954759201 Bacteria 9358192
599 2966602541 2966598605 Bacteria 7676064
600 2990059983 2990059506 Bacteria 9321252
601 2990090895 2990088156 Bacteria 6657676
602 2995467974 2995463766 Bacteria 8577691
603 2997458070 2997451912 Bacteria 8492419
604 2997606259 2997600082 Bacteria 9896405
605 3006494369 3006493962 Bacteria 8825450
606 8008566292 8008558824 Bacteria 10610750
607 8008578006 8008574985 Bacteria 7815457
608 8023629979 8023623736 Bacteria 8593882
609 8025416878 8025413630 Bacteria 7014048
610 8025483068 8025478263 Bacteria 8209203
611 8025536425 8025530807 Bacteria 8495698
612 8047897142 8047893842 Bacteria 11723082
613 8048134762 8048127548 Bacteria 11053136
614 8048361810 8048356638 Bacteria 11044339
615 8048374126 8048369669 Bacteria 11666822
616 8048384100 8048379754 Bacteria 11877923
617 8048413506 8048406513 Bacteria 8936924
618 8054160656 8054160619 Bacteria 7783213
619 8056833750 8056829672 Bacteria 9045328
620 JGI24739J22299_10021130
621 JGI24739J22299_10042739
622 JGI24737J22298_10013796
623 JGI24735J21928_10011257
624 JGI24738J21930_10031039
625 rootH1_10031499
626 rootH1_10083305
627 JGI25160J50197_1017437
628 JGI25160J50197_1025504
629 Ga0006562J51391_1118550
630 Ga0070682_100359922
631 Ga0070688_100046845
632 Ga0070705_100048089
633 Ga0070708_100003748
634 Ga0070707_100031071
635 Ga0070698_100149854
636 Ga0068853_100276497
637 Ga0068853_100462343
638 Ga0070665_100703669
639 Ga0070704_100070314
640 Ga0070702_100510529
641 Ga0068861_100260956
642 Ga0081455_10117524
643 Ga0081455_10281653
644 Ga0075367_10001493
645 Ga0075428_100000918
646 Ga0075428_100016973
647 Ga0075430_100031735
648 Ga0075430_100178712
649 Ga0075431_100046338
650 Ga0075431_100133693
651 Ga0075433_10301024
652 Ga0075434_100083517
653 Ga0075429_100005183
654 Ga0075429_100099942
655 Ga0068865_100593632
656 Ga0099794_10017634
657 Ga0105251_10042895
658 Ga0111539_10235221
659 Ga0114129_10000234
660 Ga0114129_10050715
661 Ga0114129_10074575
662 Ga0114129_11046557
663 Ga0105241_10523435
664 Ga0105242_10271335
665 Ga0105248_10444950
666 Ga0105249_10553972
667 Ga0105239_10279572
668 Ga0105246_10010674
669 Ga0105246_10220239
670 Ga0105246_10756569
671 Ga0157375_11427198
672 Ga0182008_10072265
673 Ga0157379_10274855
674 Ga0157379_10484811
675 Ga0182007_10008879
676 Ga0183367_1002
677 Ga0207426_1004946
678 Ga0207426_1005010
679 Ga0207426_1009547
680 Ga0207426_1021679
681 Ga0207647_10090484
682 Ga0207647_10230119
683 Ga0207684_10130223
684 Ga0207646_10023858
685 Ga0207690_10337878
686 Ga0207706_10032658
687 Ga0207686_10171632
688 Ga0207709_10085637
689 Ga0207668_10085225
690 Ga0207668_10416291
691 Ga0207639_10153559
692 Ga0207674_10501451
693 Ga0207675_100594620
694 Ga0209813_10101513
695 Ga0307517_10008672
696 Ga0268256_1054667
697 Ga0307511_10000940
698 Ga0307511_10087226
699 Ga0307512_10004567
700 Ga0307512_10056820
701 Ga0307509_10057381
702 Ga0307508_10003855
703 Ga0307508_10005432
704 Ga0307508_10143259
705 Ga0307508_10189225
706 Ga0307508_10435880
707 Ga0307516_10119815
708 Ga0307518_10230763
709 Ga0307410_10331157
710 Ga0307407_10671291
711 Ga0307415_100198770
712 Ga0307507_10153221
713 Ga0307510_10058938
714 Ga0307510_10066437
715 Ga0307510_10160103
716 Ga0395898_0028094
717 Ga0395898_0484690
718 Ga0395898_0602636
719 Ga0395901_0498204
720 Ga0395901_0601256
721 Ga0439439_0022416
722 Ga0451797_0759924
723 Ga0451795_0759397
724 Ga0451853_0542090
725 Ga0451853_0672206
726 Ga0439433_0036362
727 Ga0439448_0007943
728 Ga0439449_0012461
729 Ga0439449_0071614
730 Ga0439449_0121547
731 Ga0439455_0013502
732 Ga0439457_002987
733 Ga0439457_010595
734 Ga0439462_0044530
735 Ga0450894_001448
736 Ga0450898_009397
737 Ga0450899_002009
738 Ga0450900_036300
739 Ga0450903_000232
740 Ga0450903_013525
741 Ga0450906_019413
742 Ga0466969_0004334
743 Ga0466969_0006588
744 Ga0466969_0056881
745 Ga0466972_0008438
746 Ga0466972_0175402
747 Ga0466972_0226754
748 Ga0466965_0007033
749 Ga0466965_0077934
750 Ga0466965_0146808
751 Ga0466966_0009969
752 Ga0466966_0028899
753 Ga0466966_0048430
754 Ga0466961_0001913
755 Ga0466961_0031248
756 Ga0466961_0031336
757 Ga0466961_0032924
758 Ga0466961_0296332
759 Ga0466963_0017463
760 Ga0466964_0005429
761 Ga0466971_0056294
762 Ga0466971_0297716
763 Ga0466970_0004687
764 Ga0466970_0091411
765 Ga0466970_0134700
766 Ga0466970_0461238
767 Ga0466957_0001776
768 Ga0466957_0028244
769 Ga0466957_0257030
770 Ga0466959_0013462
771 Ga0466959_0024614
772 Ga0466959_0034361
773 Ga0466958_0018722
774 Ga0466958_0158796
775 Ga0466967_0018680
776 Ga0466967_0432891
777 Ga0466967_0549729
778 Ga0466967_1052216
779 Ga0495617_020064
780 Ga0495592_0073897
781 Ga0495592_0090000
782 Ga0495592_0095679
783 Ga0495603_0017291
784 Ga0495603_0056249
785 Ga0495603_0064382
786 Ga0495603_0069739
787 Ga0495603_0075283
788 Ga0495603_0382020
789 Ga0495603_0423877
790 Ga0495590_0066927
791 Ga0495629_0018134
792 Ga0495629_0021330
793 Ga0495629_0111774
794 Ga0495629_0155595
795 Ga0495629_0209261
796 Ga0495629_0280858
797 Ga0495629_0449491
798 Ga0495638_0101850
799 Ga0495638_0121371
800 Ga0495638_0378731
801 Ga0495651_0001792
802 Ga0495651_0029295
803 Ga0495651_0130095
804 Ga0495653_0016437
805 Ga0495580_0026811
806 Ga0495582_0069225
807 Ga0495582_0451099
808 Ga0495605_0019117
809 Ga0495639_0021796
810 Ga0495662_0003416
811 Ga0495662_0007996
812 Ga0495662_0045721
813 Ga0495662_0071930
814 Ga0495662_0097036
815 Ga0495662_0232615
816 Ga0495662_0258922
817 Ga0495662_0269816
818 Ga0495664_0003498
819 Ga0495584_0080114
820 Ga0495585_0089283
821 Ga0495585_0317469
822 Ga0495594_0011111
823 Ga0495594_0100530
824 Ga0495594_0145735
825 Ga0495594_0376918
826 Ga0495594_0412336
827 Ga0495596_0061589
828 Ga0495607_0113400
829 Ga0495583_0025703
830 Ga0495583_0099678
831 Ga0495608_0002748
832 Ga0495608_0317874
833 Ga0495616_0002969
834 Ga0495618_0026221
835 Ga0495618_0069245
836 Ga0495620_0013671
837 Ga0495620_0026910
838 Ga0495628_0000894
839 Ga0495628_0142800
840 Ga0495628_0430432
841 Ga0495630_0007593
842 Ga0495630_0121446
843 Ga0495631_0042284
844 Ga0495643_0049380
845 Ga0495648_0084682
846 Ga0495666_0000866
847 Ga0495666_0061845
848 Ga0495666_0068321
849 Ga0495666_0069074
850 Ga0495652_0220759
851 Ga0495652_0324387
852 Ga0495652_0367966
853 Ga0495654_0065500
854 Ga0495665_0003278
855 Ga0495640_0010715
856 Ga0495640_0013397
857 Ga0495640_0062057
858 Ga0495640_0113026
859 Ga0495640_0322110
860 Ga0495586_0161401
861 Ga0495587_0055190
862 Ga0495587_0317112
863 Ga0495609_0006244
864 Ga0495597_0067523
865 Ga0495597_0153510
866 Ga0495645_0026337
867 Ga0495645_0043677
868 Ga0495645_0178645
869 Ga0495622_0066528
870 Ga0495622_0123124
871 Ga0495622_0171724
872 Ga0495622_0176417
873 Ga0495622_0271164
874 Ga0495633_0137393
875 Ga0495667_0162565
876 Ga0495667_0177479
877 Ga0495667_0273759
878 Ga0495667_0325838
879 Ga0495667_0503801
880 Ga0495668_0162770
881 Ga0495634_0002657
882 Ga0495634_0016279
883 Ga0495634_0025200
884 Ga0495634_0157094
885 Ga0495625_0045485
886 Ga0495625_0098790
887 Ga0495625_0130120
888 Ga0495635_0002156
889 Ga0495635_0060726
890 Ga0495635_0125546
891 Ga0495588_0005537
892 Ga0495588_0138837
893 Ga0495588_0297333
894 Ga0495657_0003657
895 Ga0495657_0011455
896 Ga0495657_0047841
897 Ga0495657_0056059
898 Ga0495657_0263221
899 Ga0495599_0063902
900 Ga0495599_0245924
901 Ga0495623_0028200
902 Ga0495623_0067314
903 Ga0495623_0084377
904 Ga0495646_0001344
905 Ga0495646_0109685
906 Ga0495658_0271336
907 Ga0495613_0006748
908 Ga0495613_0020402
909 Ga0495613_0065837
910 Ga0495613_0134729
911 Ga0495613_0161824
912 Ga0495613_0212650
913 Ga0495613_0271107
914 Ga0495613_0300789
915 Ga0495624_0038498
916 Ga0495624_0086754
917 Ga0495624_0133310
918 Ga0495624_0156519
919 Ga0495624_0232352
920 Ga0495624_0308012
921 Ga0495649_0312518
922 Ga0495649_0346188
923 Ga0495589_0031350
924 Ga0495589_0033040
925 Ga0495589_0230293
926 Ga0495589_0247327
927 Ga0495600_0002052
928 Ga0495600_0103059
929 Ga0495600_0103505
930 Ga0495660_0117211
931 Ga0495581_0007246
932 Ga0495581_0048645
933 Ga0495581_0303280
934 Ga0495604_0002185
935 Ga0495604_0003125
936 Ga0495604_0016494
937 Ga0495604_0093642
938 Ga0495604_0094526
939 Ga0495604_0342183
940 Ga0495636_0021712
941 Ga0495636_0042451
942 Ga0495636_0138997
943 Ga0495636_0196193
944 Ga0495636_0202394
945 Ga0495636_0308747
946 Ga0495674_0026114
947 Ga0495674_0340686
948 Ga0495676_0005520
949 Ga0495676_0025641
950 Ga0495676_0028070
951 Ga0495676_0057556
952 Ga0495676_0104831
953 Ga0495676_0115497
954 Ga0495676_0336394
955 Ga0495680_0088825
956 Ga0495683_0178950
957 Ga0495687_017250
958 Ga0495687_022227
959 Ga0495687_059388
960 Ga0495687_068416
961 Ga0495687_114226
962 Ga0495687_121149
963 Ga0495675_0004981
964 Ga0495675_0026133
965 Ga0495675_0055798
966 Ga0495675_0078181
967 Ga0495675_0099415
968 Ga0495675_0222983
969 Ga0495675_0248012
970 Ga0495677_0107659
971 Ga0495685_001064
972 Ga0495685_013149
973 Ga0495685_046331
974 Ga0495685_129543
975 Ga0495685_137009
976 Ga0495685_144410
977 Ga0495681_0016612
978 Ga0495684_0002671
979 Ga0495684_0015480
980 Ga0495684_0302510
981 Ga0495593_0006676
982 Ga0495593_0018331
983 Ga0495593_0054501
984 Ga0495593_0153425
985 Ga0495602_0040299
986 Ga0495602_0061466
987 Ga0495614_0001050
988 Ga0495614_0011079
989 Ga0495614_0071724
990 Ga0495614_0089737
991 Ga0495614_0131298
992 Ga0495614_0197444
993 Ga0495614_0244393
994 Ga0495626_0117679
995 Ga0496102_0510201
996 Ga0496105_0654957
997 Ga0496110_0166901
998 Ga0496110_0378615
999 Ga0496113_0200124
1000 Ga0495678_086457
1001 Ga0501031_0000983
1002 Ga0501031_0026077
1003 Ga0501031_0075410
1004 Ga0501031_0326173
1005 Ga0501031_0391871
1006 Ga0501031_0413218
1007 Ga0501032_0012494
1008 Ga0501032_0024039
1009 Ga0501032_0047602
1010 Ga0501032_0080714
1011 Ga0501032_0101966
1012 Ga0501032_0211151
1013 Ga0501032_0362150
1014 Ga0501032_0451363
1015 Ga0501032_0634130
1016 Ga0501033_0038087
1017 Ga0501033_0043101
1018 Ga0501033_0133334
1019 Ga0501033_0334443
1020 Ga0501033_0400734
1021 Ga0501033_0483643
1022 Ga0501033_0580841
1023 Ga0501034_0044701
1024 Ga0501034_0105663
1025 Ga0501034_0158921
1026 Ga0501034_0801523
1027 Ga0501036_0013747
1028 Ga0501036_0023541
1029 Ga0501036_0064959
1030 Ga0501036_0182303
1031 Ga0501036_0568129
1032 Ga0501036_0636344
1033 Ga0501036_0669534
1034 Ga0501037_0132792
1035 Ga0501037_0188313
1036 Ga0501038_0002380
1037 Ga0501038_0017207
1038 Ga0501038_0030731
1039 Ga0501038_0069482
1040 Ga0501038_0143265
1041 Ga0501038_0209120
1042 Ga0501039_0023711
1043 Ga0501039_0045259
1044 Ga0501040_0030998
1045 Ga0501041_0075924
1046 Ga0501041_0120995
1047 Ga0501042_0109272
1048 Ga0501042_0357142
1049 Ga0501042_0462259
1050 Ga0501043_0016798
1051 Ga0501043_0049777
1052 Ga0501043_0063486
1053 Ga0501043_0102817
1054 Ga0501046_0134510
1055 Ga0501046_0235150
1056 Ga0501047_0195946
1057 Ga0501047_0231224
1058 Ga0501047_0233823
1059 Ga0501047_0308190
1060 Ga0501048_0030602
1061 Ga0501048_0298237
1062 Ga0501048_0437430
1063 Ga0501067_0056351
1064 Ga0501068_0049647
1065 Ga0501070_0003603
1066 Ga0501070_0124919
1067 Ga0501070_0178747
1068 Ga0501070_0652930
1069 Ga0501070_0674363
1070 Ga0501071_0002754
1071 Ga0501071_0070466
1072 Ga0501072_0002394
1073 Ga0501072_0019350
1074 Ga0501073_0099279
1075 Ga0501073_0527451
1076 Ga0501074_0164023
1077 Ga0501074_0229695
1078 Ga0501075_0026840
1079 Ga0501076_0100661
1080 Ga0501077_0030561
1081 Ga0501077_0129296
1082 Ga0501079_0013843
1083 Ga0501079_0083385
1084 Ga0501079_0265200
1085 Ga0501080_0065326
1086 Ga0501080_0137233
1087 Ga0501081_0098040
1088 Ga0501081_0123490
1089 Ga0501083_0016152
1090 Ga0501035_0001925
1091 Ga0501035_0018676
1092 Ga0501035_0042587
1093 Ga0501035_0052616
1094 Ga0501035_0112657
1095 Ga0501044_0026918
1096 Ga0501044_0042683
1097 Ga0501044_0045040
1098 Ga0501044_0056304
1099 Ga0501044_0132047
1100 Ga0501044_0170311
1101 Ga0501044_0213462
1102 Ga0501044_0223188
1103 Ga0501044_0683491
1104 Ga0501045_0045693
1105 Ga0501045_0292535
1106 Ga0501045_0541294
1107 Ga0501045_0698499
1108 nmdc:mga03n38_178569_c1
1109 nmdc:mga03n38_380216_c1
1110 nmdc:mga06z11_107359_c1
1111 nmdc:mga04h51_155258_c1
1112 nmdc:mga05p37_637287_c1
1113 nmdc:mga05p37_6430_c1
1114 nmdc:mga05p37_911393_c1
1115 nmdc:mga09592_186372_c1
1116 nmdc:mga0qj67_4731_c1
1117 nmdc:mga06r32_130810_c1
1118 nmdc:mga06r32_77690_c1
1119 nmdc:mga0n895_15597_c1
1120 nmdc:mga0n895_185134_c1
1121 nmdc:mga0rr50_14584_c1
1122 Ga0495601_0100012
1123 Ga0495655_0135102
1124 Ga0495619_0062328
1125 Ga0495619_0132636
1126 Ga0500566_0071734
1127 Ga0500640_008343
1128 Ga0500654_060923
1129 Ga0500654_172892
1130 Ga0500553_129684
1131 Ga0500553_139802
1132 Ga0500560_048059
1133 Ga0500569_064402
1134 Ga0500561_0141312
1135 Ga0500573_0069991
1136 Ga0500600_0102306
1137 Ga0500600_0157237
1138 Ga0500616_0046167
1139 Ga0500636_0327252
1140 Ga0500587_023473
1141 Ga0501084_0020562
1142 Ga0501084_0093400
1143 Ga0501084_0275902
1144 Ga0501082_0032395
1145 Ga0501082_0065461
1146 Ga0501082_0574842
1147 Ga0466962_0012876
1148 Ga0466962_0057761
1149 3006428948
1150 2547410212
1151 2554256980
1152 2585301207
1153 2585308338
1154 2585321693
1155 2616703181
1156 2616904702
1157 2643762864
1158 2643898332
1159 2643941811
1160 2643943386
1161 2644261858
1162 2644388550
1163 2644403797
1164 2644428894
1165 2644429963
1166 2644439098
1167 2644459967
1168 2644632345
1169 2676488188
1170 2784589474
1171 2785342113
1172 2785370547
1173 2786671704
1174 2793983277
1175 2804845787
1176 2808843104
1177 2808921452
1178 2809233138
1179 2811845294
1180 2812357016
1181 2812479678
1182 2816421094
1183 2819698103
1184 2852640612
1185 2862181580
1186 2862286854
1187 2862291311
1188 2862514559
1189 2862578375
1190 2863411796
1191 2867373042
1192 2867437637
1193 2873154899
1194 2875394619
1195 2877680076
1196 2912718668
1197 2912730994
1198 2912761928
1199 2918504549
1200 2919476051
1201 2935392377
1202 2946050014
1203 2946068864
1204 2946076904
1205 2947228048
1206 2954002834
1207 2954385006
1208 2954677989
1209 2954686168
1210 2954695823
1211 2954711014
1212 2954715232
1213 2954725173
1214 2954736645
1215 2954744106
1216 2954755492
1217 2954763048
1218 2966602541
1219 2990059983
1220 2990090895
1221 2995467974
1222 2997458070
1223 2997606259
1224 3006494369
1225 8008566292
1226 8008578006
1227 8023629979
1228 8025416878
1229 8025483068
1230 8025536425
1231 8047897142
1232 8048134762
1233 8048361810
1234 8048374126
1235 8048384100
1236 8048413506
1237 8054160656
1238 8056833750

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

35

216

0.9

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

32

210

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4eek-assembly1.cif.gz_A crystal structure of had family hydrolase dr_1622 from deinococcus radiodurans r1 (target efi-501256) with bound phosphate and sodium 0.9075 25 233
2fdr-assembly1.cif.gz_A crystal structure of conserved haloacid dehalogenase-like protein of unknown function atu0790 from agrobacterium tumefaciens str. c58 0.8832 25 234
7ocp-assembly1.cif.gz_A nadph bound to the dehydrogenase domain of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii 0.8745 23 234
7ocn-assembly1.cif.gz_A crystal structure of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii 0.8705 23 234
7ocq-assembly1.cif.gz_A nadh bound to the dehydrogenase domain of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii 0.8702 23 234
ID Description Score Start End Superfamily
4gibB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9467 108 228 3.40.50.1000
af_P32662_111_227_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9448 108 205 3.40.50.1000
af_Q84MD8_87_222_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9326 101 225 3.40.50.1000
af_Q652P6_229_339_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9319 118 222 3.40.50.1000
af_A0A0R0KYK9_29_156_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9159 111 222 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A127SWG5-F1-model_v4 Haloacid dehalogenase-like hydrolase 0.9766 98 234 GO:0016787
AF-A0A516PW09-F1-model_v4 HAD family phosphatase 0.9749 24 234 GO:0003824
AF-A0A2E2DZ58-F1-model_v4 Hydrolase 0.9644 27 233 GO:0016787
AF-A0A257JS04-F1-model_v4 Haloacid dehalogenase 0.964 23 235 GO:0003824
AF-A0A850DDC4-F1-model_v4 deleted 0.9441 18 161

Map