F469821

General Info

Members Datasets Scaffolds Average Seq Length
619 310 585 272

Family's Representative Sequence

Representative Sequence 3300025261|Ga0209233_1001186|Ga0209233_10011864
Length 306
Sequence MYSAHTLRFLRSARAQNLFARYGSEAMTNPNLPLATTGSVSLITPPPGTDKASVAASPKMSARGLDFYYDKFHALKNVNLDIAEKKVTALIGPSGCGKSTLLRIFNRIYSIYPKLEAKGQVLLDGDNILDPKYPLNRLRSKVGMVFQKPVPFPMSIYDNVAYAIRHYERLSKADMDVRVEEALRQGALWEEAKSKLHQSALGLSGGQQQRLCIARAIALKPEVILLDEPTSALDPIATGKIEQLVEELKERYTIAIVTHNMQQASRVSDYTAFMYLGELIEFGDTTTIFENPTKKMTEDYITGRYG

Samples

Sample ID Description Type Environment
1 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
2 2643221559 Lysobacter sp. Root559 Isolate Unclassified
3 2643221573 Lysobacter sp. Root604 Isolate Unclassified
4 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
5 2643221586 Lysobacter sp. Root667 Isolate Unclassified
6 2643221593 Lysobacter sp. Root690 Isolate Unclassified
7 2643221612 Lysobacter sp. Root76 Isolate Unclassified
8 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
9 2643221720 Lysobacter sp. Root916 Isolate Unclassified
10 2643221727 Lysobacter sp. Root96 Isolate Unclassified
11 2643221728 Lysobacter sp. Root983 Isolate Unclassified
12 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
13 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
14 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
15 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
16 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
17 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
18 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
19 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
20 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
21 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
22 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
23 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
24 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
25 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
26 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
27 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
28 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
29 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
30 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
31 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
32 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
33 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
34 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
35 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
36 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
37 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
38 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
39 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
40 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
41 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
42 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
43 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
44 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
45 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
46 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
47 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
48 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
49 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
50 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
51 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
52 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
53 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
54 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
55 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
56 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
57 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
58 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
59 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
60 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
61 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
62 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
63 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
64 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
65 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
66 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
67 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
68 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
69 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
70 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
71 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
72 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
73 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
74 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
75 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
76 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
77 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
78 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
79 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
80 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
81 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
82 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
83 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
84 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
85 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
86 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
87 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
88 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
89 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
90 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
91 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
92 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
93 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
94 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
95 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
96 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
97 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
98 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
99 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
100 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
101 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
102 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
103 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
105 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
106 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
108 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
111 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
132 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
133 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
134 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
138 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
139 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
142 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
143 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
147 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
150 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
152 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
208 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
209 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
210 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
211 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
212 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
213 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
214 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
215 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
216 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
217 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
218 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
219 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
220 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
221 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
222 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
223 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
224 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
225 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
226 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
227 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
228 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
229 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
230 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
231 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
232 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
233 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
235 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
236 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
237 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
238 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
239 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
240 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
241 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
242 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
243 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
244 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
245 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
246 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
247 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
248 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
249 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
250 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
251 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
252 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
253 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
254 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
255 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
256 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
257 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
258 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
259 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
260 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
261 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
262 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
263 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
264 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
265 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
266 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
267 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
268 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
269 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
270 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
271 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
272 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
273 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
286 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
287 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
288 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
289 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
290 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
291 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
292 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
293 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
294 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
295 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
296 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
297 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
298 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
299 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
300 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
303 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
304 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
305 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
306 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
307 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
308 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
309 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
310 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.51
Metatranscriptomes 0
Isolates 5.49

Biome Distribution

Category Percentage (%)
Aerial Root 0.16
Bulb 0
Endosphere 10.5
Nodule 0.16
Rhizoplane 1.13
Rhizosphere 76.9
Stem 0
Stem Tuber 0
Unclassified 11.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1014601 3300001904 Bacteria 1264
2 JGI24744J21845_10022836 3300002077 Bacteria 1226
3 JGI25156J39149_1002466 3300002705 Bacteria 6618
4 JGI25156J39149_1027473 3300002705 Bacteria 889
5 JGI25157J39369_1000362 3300002741 Bacteria 31445
6 JGI25157J39369_1003264 3300002741 Bacteria 3400
7 JGI25151J46595_10000183 3300003187 Bacteria 78518
8 JGI25151J46595_10032164 3300003187 Bacteria 2037
9 JGI25151J46595_10064024 3300003187 Bacteria 1153
10 rootH2_10022390 3300003320 Bacteria 1600
11 Ga0055539_1000476 3300003752 Bacteria 13159
12 Ga0055533_1000833 3300003756 Bacteria 9484
13 Ga0055527_1000066 3300003760 Bacteria 88276
14 Ga0055535_1000058 3300003761 Bacteria 125370
15 Ga0055542_1000085 3300003762 Bacteria 125370
16 Ga0055529_1000240 3300003763 Bacteria 68255
17 Ga0055526_1001709 3300003771 Bacteria 15305
18 Ga0055526_1011090 3300003771 Bacteria 4110
19 Ga0055537_1000392 3300003773 Bacteria 29390
20 Ga0055524_1006136 3300003775 Bacteria 5256
21 Ga0055524_1029241 3300003775 Bacteria 1633
22 Ga0055536_1034567 3300003781 Bacteria 1274
23 Ga0055534_1000328 3300003784 Bacteria 31317
24 Ga0055528_1000115 3300003790 Bacteria 64238
25 Ga0055530_10003425 3300003791 Bacteria 9026
26 Ga0055531_10011828 3300003794 Bacteria 4165
27 Ga0058692_1000002 3300003856 Bacteria 508401
28 Ga0065704_10112150 3300005289 Bacteria 1940
29 Ga0070658_10051561 3300005327 Bacteria 3334
30 Ga0070658_10052653 3300005327 Bacteria 3302
31 Ga0070690_100111813 3300005330 Bacteria 1824
32 Ga0070690_100262442 3300005330 Bacteria 1226
33 Ga0070670_100000064 3300005331 Bacteria 110044
34 Ga0070670_100201832 3300005331 Bacteria 1728
35 Ga0070677_10106168 3300005333 Bacteria 1247
36 Ga0068869_100141397 3300005334 Bacteria 1858
37 Ga0070666_10001547 3300005335 Bacteria 13970
38 Ga0070666_10004389 3300005335 Bacteria 8592
39 Ga0070666_10029642 3300005335 Bacteria 3599
40 Ga0070666_10118456 3300005335 Bacteria 1835
41 Ga0070680_100008797 3300005336 Bacteria 7746
42 Ga0070680_100507803 3300005336 Bacteria 1032
43 Ga0070682_100038344 3300005337 Bacteria 2939
44 Ga0070682_100068133 3300005337 Bacteria 2268
45 Ga0068868_100011542 3300005338 Bacteria 6435
46 Ga0070660_100013179 3300005339 Bacteria 5924
47 Ga0070660_100036610 3300005339 Bacteria 3717
48 Ga0070660_100280854 3300005339 Bacteria 1362
49 Ga0070691_10151904 3300005341 Bacteria 1188
50 Ga0070661_100005490 3300005344 Bacteria 8744
51 Ga0070661_100072421 3300005344 Bacteria 2535
52 Ga0070661_100426693 3300005344 Bacteria 1052
53 Ga0070692_10087951 3300005345 Bacteria 1684
54 Ga0070692_10102237 3300005345 Bacteria 1573
55 Ga0070668_100005796 3300005347 Bacteria 9162
56 Ga0070668_100102463 3300005347 Bacteria 2270
57 Ga0070668_100446723 3300005347 Bacteria 1111
58 Ga0070669_100004232 3300005353 Bacteria 10381
59 Ga0070671_100000025 3300005355 Bacteria 121912
60 Ga0070671_100477053 3300005355 Bacteria 1071
61 Ga0070671_100546584 3300005355 Bacteria 998
62 Ga0070688_100002099 3300005365 Bacteria 10058
63 Ga0070659_100072079 3300005366 Bacteria 2748
64 Ga0070659_100364382 3300005366 Bacteria 1215
65 Ga0070667_100000012 3300005367 Bacteria 258575
66 Ga0070667_100000095 3300005367 Bacteria 109595
67 Ga0070667_100018607 3300005367 Bacteria 5762
68 Ga0070667_100028690 3300005367 Bacteria 4634
69 Ga0070711_100317931 3300005439 Bacteria 1243
70 Ga0070694_100354199 3300005444 Bacteria 1138
71 Ga0070663_100000126 3300005455 Bacteria 36101
72 Ga0070663_100012441 3300005455 Bacteria 5383
73 Ga0070663_100020053 3300005455 Bacteria 4419
74 Ga0070663_100032355 3300005455 Bacteria 3604
75 Ga0070678_100055092 3300005456 Bacteria 2901
76 Ga0070678_100064834 3300005456 Bacteria 2709
77 Ga0070678_100249918 3300005456 Bacteria 1486
78 Ga0070662_100115063 3300005457 Bacteria 2054
79 Ga0070681_10000099 3300005458 Bacteria 64409
80 Ga0070681_10003393 3300005458 Bacteria 14907
81 Ga0070681_10107674 3300005458 Bacteria 2727
82 Ga0070681_10148395 3300005458 Bacteria 2272
83 Ga0068867_100018794 3300005459 Bacteria 4916
84 Ga0070685_10000005 3300005466 Bacteria 190119
85 Ga0070685_10000377 3300005466 Bacteria 27028
86 Ga0070679_100002883 3300005530 Bacteria 15619
87 Ga0068853_100008635 3300005539 Bacteria 8193
88 Ga0068853_100059903 3300005539 Bacteria 3289
89 Ga0068853_100135468 3300005539 Bacteria 2207
90 Ga0070693_100029848 3300005547 Bacteria 2976
91 Ga0070665_100000077 3300005548 Bacteria 188308
92 Ga0070665_100000285 3300005548 Bacteria 80546
93 Ga0070665_100036667 3300005548 Bacteria 4930
94 Ga0070665_100151098 3300005548 Bacteria 2325
95 Ga0070665_100285458 3300005548 Bacteria 1652
96 Ga0070665_100393031 3300005548 Bacteria 1394
97 Ga0070665_100752298 3300005548 Bacteria 988
98 Ga0068855_100008373 3300005563 Bacteria 12506
99 Ga0068855_100105694 3300005563 Bacteria 3236
100 Ga0068855_100297662 3300005563 Bacteria 1787
101 Ga0068855_100298134 3300005563 Bacteria 1786
102 Ga0068857_100479452 3300005577 Bacteria 1165
103 Ga0068854_100022759 3300005578 Bacteria 4275
104 Ga0068854_100052885 3300005578 Bacteria 2914
105 Ga0068854_100300788 3300005578 Bacteria 1298
106 Ga0068856_100000192 3300005614 Bacteria 64464
107 Ga0068856_100003624 3300005614 Bacteria 15510
108 Ga0068856_100010797 3300005614 Bacteria 8870
109 Ga0068856_100184188 3300005614 Bacteria 2101
110 Ga0068852_100021053 3300005616 Bacteria 5196
111 Ga0068852_100056273 3300005616 Bacteria 3398
112 Ga0068852_100079577 3300005616 Bacteria 2903
113 Ga0068852_100134308 3300005616 Bacteria 2283
114 Ga0068859_100004966 3300005617 Bacteria 13512
115 Ga0068859_100007853 3300005617 Bacteria 10828
116 Ga0068859_100420338 3300005617 Bacteria 1433
117 Ga0068864_100000073 3300005618 Bacteria 109681
118 Ga0068864_100063909 3300005618 Bacteria 3190
119 Ga0068864_100327733 3300005618 Bacteria 1440
120 Ga0068864_100358312 3300005618 Bacteria 1378
121 Ga0068861_100149025 3300005719 Bacteria 1918
122 Ga0068870_10054056 3300005840 Bacteria 2135
123 Ga0068863_100015435 3300005841 Bacteria 7342
124 Ga0068863_100162783 3300005841 Bacteria 2138
125 Ga0068863_100462055 3300005841 Bacteria 1247
126 Ga0068858_100026607 3300005842 Bacteria 5373
127 Ga0068858_100048477 3300005842 Bacteria 3936
128 Ga0068858_100261007 3300005842 Bacteria 1646
129 Ga0068858_100443937 3300005842 Bacteria 1250
130 Ga0068858_100729912 3300005842 Bacteria 965
131 Ga0068860_100002476 3300005843 Bacteria 19371
132 Ga0068860_100010778 3300005843 Bacteria 9022
133 Ga0068860_100297791 3300005843 Bacteria 1580
134 Ga0068862_100000164 3300005844 Bacteria 73885
135 Ga0068862_100001217 3300005844 Bacteria 24281
136 Ga0081455_10194488 3300005937 Bacteria 1524
137 Ga0081540_1000823 3300005983 Bacteria 28364
138 Ga0075367_10032536 3300006178 Bacteria 3002
139 Ga0097621_100065104 3300006237 Bacteria 2999
140 Ga0097621_100092851 3300006237 Bacteria 2528
141 Ga0097621_100131025 3300006237 Bacteria 2135
142 Ga0097621_100252512 3300006237 Bacteria 1544
143 Ga0097621_100506861 3300006237 Bacteria 1094
144 Ga0068871_100176427 3300006358 Bacteria 1834
145 Ga0068865_100004664 3300006881 Bacteria 8280
146 Ga0068865_100245968 3300006881 Bacteria 1409
147 Ga0068865_100248683 3300006881 Bacteria 1402
148 Ga0097620_100004965 3300006931 Bacteria 13512
149 Ga0097620_100007853 3300006931 Bacteria 10828
150 Ga0097620_100420392 3300006931 Bacteria 1433
151 Ga0105244_10045735 3300009036 Bacteria 2251
152 Ga0105240_10016289 3300009093 Bacteria 10070
153 Ga0105240_10020645 3300009093 Bacteria 8779
154 Ga0105240_10022344 3300009093 Bacteria 8387
155 Ga0105240_10033737 3300009093 Bacteria 6609
156 Ga0105240_10200916 3300009093 Bacteria 2336
157 Ga0105240_10987848 3300009093 Bacteria 901
158 Ga0105245_10024940 3300009098 Bacteria 5255
159 Ga0105245_10093279 3300009098 Bacteria 2774
160 Ga0105247_10060326 3300009101 Bacteria 2351
161 Ga0105241_10053273 3300009174 Bacteria 3093
162 Ga0105241_10114700 3300009174 Bacteria 2161
163 Ga0105242_10006154 3300009176 Bacteria 9246
164 Ga0105248_10000179 3300009177 Bacteria 73845
165 Ga0105248_10079710 3300009177 Bacteria 3680
166 Ga0105237_10000348 3300009545 Bacteria 65042
167 Ga0105237_10002762 3300009545 Bacteria 21342
168 Ga0105237_10015674 3300009545 Bacteria 7879
169 Ga0105237_10045573 3300009545 Bacteria 4412
170 Ga0105237_10075983 3300009545 Bacteria 3350
171 Ga0105238_10001019 3300009551 Bacteria 28524
172 Ga0105238_10004286 3300009551 Bacteria 14157
173 Ga0105249_10000262 3300009553 Bacteria 56551
174 Ga0105249_10031832 3300009553 Bacteria 4772
175 Ga0105249_10046262 3300009553 Bacteria 3960
176 Ga0105249_10451272 3300009553 Bacteria 1325
177 Ga0105239_10000022 3300010375 Bacteria 257744
178 Ga0105239_10018900 3300010375 Bacteria 7613
179 Ga0105239_10093972 3300010375 Bacteria 3311
180 Ga0105239_10458597 3300010375 Bacteria 1446
181 Ga0105239_10472115 3300010375 Bacteria 1425
182 Ga0157373_10298453 3300013100 Bacteria 1143
183 Ga0157371_10025417 3300013102 Bacteria 4316
184 Ga0157371_10246320 3300013102 Bacteria 1286
185 Ga0157370_10105988 3300013104 Bacteria 2631
186 Ga0157370_10208794 3300013104 Bacteria 1810
187 Ga0157369_10000057 3300013105 Bacteria 157096
188 Ga0157369_10041103 3300013105 Bacteria 5047
189 Ga0157369_10356171 3300013105 Bacteria 1520
190 Ga0157374_10149793 3300013296 Bacteria 2268
191 Ga0157374_10793723 3300013296 Bacteria 962
192 Ga0157378_10012011 3300013297 Bacteria 7581
193 Ga0157378_10015193 3300013297 Bacteria 6742
194 Ga0157378_10056431 3300013297 Bacteria 3500
195 Ga0157378_10451641 3300013297 Bacteria 1276
196 Ga0163162_10000021 3300013306 Bacteria 214873
197 Ga0163162_10002567 3300013306 Bacteria 17186
198 Ga0163162_10008312 3300013306 Bacteria 10126
199 Ga0163162_10531015 3300013306 Bacteria 1306
200 Ga0157372_10015442 3300013307 Bacteria 8184
201 Ga0157372_10037322 3300013307 Bacteria 5358
202 Ga0157372_10041904 3300013307 Bacteria 5062
203 Ga0157372_10044856 3300013307 Bacteria 4901
204 Ga0157372_10055941 3300013307 Bacteria 4407
205 Ga0157372_10108396 3300013307 Bacteria 3178
206 Ga0157372_10112631 3300013307 Bacteria 3117
207 Ga0157372_10253252 3300013307 Bacteria 2044
208 Ga0157375_10001325 3300013308 Bacteria 21337
209 Ga0163163_10004778 3300014325 Bacteria 11625
210 Ga0163163_10007588 3300014325 Bacteria 9581
211 Ga0163163_10341485 3300014325 Bacteria 1553
212 Ga0163163_10360550 3300014325 Bacteria 1510
213 Ga0182008_10016594 3300014497 Bacteria 3826
214 Ga0182008_10027901 3300014497 Bacteria 2856
215 Ga0157379_10008775 3300014968 Bacteria 8816
216 Ga0157379_10405495 3300014968 Bacteria 1254
217 Ga0157376_10002515 3300014969 Bacteria 12422
218 Ga0157376_10010376 3300014969 Bacteria 6810
219 Ga0157376_10070100 3300014969 Bacteria 2974
220 Ga0157376_10593797 3300014969 Bacteria 1101
221 Ga0182006_1012945 3300015261 Bacteria 3637
222 Ga0182007_10000184 3300015262 Bacteria 42443
223 Ga0182007_10015116 3300015262 Bacteria 2889
224 Ga0182005_1000444 3300015265 Bacteria 21987
225 Ga0209674_100202 3300025226 Bacteria 61028
226 Ga0209674_100700 3300025226 Bacteria 11650
227 Ga0209672_100018 3300025228 Bacteria 432924
228 Ga0209258_100024 3300025242 Bacteria 542096
229 Ga0207425_1006281 3300025245 Bacteria 3268
230 Ga0209026_1000056 3300025250 Bacteria 236450
231 Ga0209026_1000162 3300025250 Bacteria 102867
232 Ga0209026_1005359 3300025250 Bacteria 3471
233 Ga0209677_102067 3300025253 Bacteria 7930
234 Ga0209148_1000009 3300025254 Bacteria 1395625
235 Ga0209759_1000317 3300025256 Bacteria 64752
236 Ga0209759_1000906 3300025256 Bacteria 22092
237 Ga0209233_1001186 3300025261 Bacteria 10530
238 Ga0209565_1000014 3300025263 Bacteria 530302
239 Ga0209455_1000029 3300025272 Bacteria 542096
240 Ga0209455_1000261 3300025272 Bacteria 60720
241 Ga0209673_1000623 3300025273 Bacteria 54075
242 Ga0209673_1018051 3300025273 Bacteria 2579
243 Ga0209130_1015664 3300025284 Bacteria 1860
244 Ga0209675_1000021 3300025291 Bacteria 334833
245 Ga0209676_1000079 3300025292 Bacteria 290447
246 Ga0209676_1000891 3300025292 Bacteria 38072
247 Ga0209676_1005540 3300025292 Bacteria 6545
248 Ga0209676_1005741 3300025292 Bacteria 6365
249 Ga0209676_1027492 3300025292 Bacteria 1789
250 Ga0209025_1000015 3300025294 Bacteria 808120
251 Ga0209025_1007720 3300025294 Bacteria 7936
252 Ga0209025_1026333 3300025294 Bacteria 2924
253 Ga0209025_1065617 3300025294 Bacteria 1324
254 Ga0209564_1000263 3300025295 Bacteria 112148
255 Ga0209564_1017552 3300025295 Bacteria 2781
256 Ga0209758_1040568 3300025297 Bacteria 1754
257 Ga0209050_1000153 3300025298 Bacteria 160851
258 Ga0209050_1001146 3300025298 Bacteria 31752
259 Ga0209256_1007068 3300025299 Bacteria 5679
260 Ga0209256_1009918 3300025299 Bacteria 4086
261 Ga0209256_1030599 3300025299 Bacteria 1484
262 Ga0209051_1001823 3300025303 Bacteria 16847
263 Ga0209257_1000081 3300025304 Bacteria 306577
264 Ga0209257_1000988 3300025304 Bacteria 38563
265 Ga0209257_1001062 3300025304 Bacteria 36333
266 Ga0209257_1001230 3300025304 Bacteria 31830
267 Ga0209257_1004325 3300025304 Bacteria 11138
268 Ga0209257_1008865 3300025304 Bacteria 5553
269 Ga0209257_1046868 3300025304 Bacteria 1246
270 Ga0207656_10000993 3300025321 Bacteria 9261
271 Ga0207710_10082809 3300025900 Bacteria 1491
272 Ga0207710_10102399 3300025900 Bacteria 1352
273 Ga0207680_10006961 3300025903 Bacteria 5486
274 Ga0207680_10028614 3300025903 Bacteria 3119
275 Ga0207680_10052056 3300025903 Bacteria 2451
276 Ga0207680_10165638 3300025903 Bacteria 1485
277 Ga0207647_10000060 3300025904 Bacteria 84009
278 Ga0207647_10004943 3300025904 Bacteria 9828
279 Ga0207647_10009246 3300025904 Bacteria 7009
280 Ga0207647_10232430 3300025904 Bacteria 1060
281 Ga0207645_10052879 3300025907 Bacteria 2596
282 Ga0207643_10049275 3300025908 Bacteria 2387
283 Ga0207705_10078739 3300025909 Bacteria 2399
284 Ga0207705_10080784 3300025909 Bacteria 2369
285 Ga0207654_10067696 3300025911 Bacteria 2110
286 Ga0207654_10087156 3300025911 Bacteria 1894
287 Ga0207707_10000241 3300025912 Bacteria 59575
288 Ga0207707_10002396 3300025912 Bacteria 16876
289 Ga0207707_10007639 3300025912 Bacteria 9420
290 Ga0207695_10000033 3300025913 Bacteria 507477
291 Ga0207695_10000256 3300025913 Bacteria 135850
292 Ga0207695_10000596 3300025913 Bacteria 72426
293 Ga0207695_10007083 3300025913 Bacteria 14372
294 Ga0207695_10021003 3300025913 Bacteria 7458
295 Ga0207695_10052748 3300025913 Bacteria 4258
296 Ga0207695_10112656 3300025913 Bacteria 2698
297 Ga0207671_10000167 3300025914 Bacteria 100428
298 Ga0207671_10001767 3300025914 Bacteria 24286
299 Ga0207671_10005441 3300025914 Bacteria 11721
300 Ga0207671_10020004 3300025914 Bacteria 5106
301 Ga0207671_10028714 3300025914 Bacteria 4156
302 Ga0207671_10166239 3300025914 Bacteria 1711
303 Ga0207660_10001209 3300025917 Bacteria 17282
304 Ga0207657_10042170 3300025919 Bacteria 4028
305 Ga0207657_10479244 3300025919 Bacteria 975
306 Ga0207649_10000586 3300025920 Bacteria 24818
307 Ga0207649_10031404 3300025920 Bacteria 3156
308 Ga0207649_10172190 3300025920 Bacteria 1509
309 Ga0207652_10000531 3300025921 Bacteria 38731
310 Ga0207681_10005843 3300025923 Bacteria 7543
311 Ga0207681_10176702 3300025923 Bacteria 1623
312 Ga0207694_10000417 3300025924 Bacteria 39736
313 Ga0207694_10001224 3300025924 Bacteria 22235
314 Ga0207694_10009855 3300025924 Bacteria 7213
315 Ga0207694_10097659 3300025924 Bacteria 2324
316 Ga0207650_10000106 3300025925 Bacteria 110058
317 Ga0207650_10021772 3300025925 Bacteria 4533
318 Ga0207650_10092200 3300025925 Bacteria 2317
319 Ga0207659_10134704 3300025926 Bacteria 1911
320 Ga0207687_10057162 3300025927 Bacteria 2739
321 Ga0207644_10000049 3300025931 Bacteria 95260
322 Ga0207644_10326465 3300025931 Bacteria 1242
323 Ga0207690_10001747 3300025932 Bacteria 13344
324 Ga0207690_10022943 3300025932 Bacteria 3889
325 Ga0207690_10139243 3300025932 Bacteria 1786
326 Ga0207706_10142881 3300025933 Bacteria 2105
327 Ga0207686_10176337 3300025934 Bacteria 1512
328 Ga0207686_10223322 3300025934 Bacteria 1361
329 Ga0207709_10000805 3300025935 Bacteria 24411
330 Ga0207704_10009861 3300025938 Bacteria 4629
331 Ga0207704_10303543 3300025938 Bacteria 1224
332 Ga0207704_10513899 3300025938 Bacteria 967
333 Ga0207691_10015575 3300025940 Bacteria 7229
334 Ga0207691_10043709 3300025940 Bacteria 4127
335 Ga0207711_10000393 3300025941 Bacteria 46458
336 Ga0207711_10000406 3300025941 Bacteria 45644
337 Ga0207689_10029972 3300025942 Bacteria 4536
338 Ga0207689_10104390 3300025942 Bacteria 2328
339 Ga0207689_10150189 3300025942 Bacteria 1920
340 Ga0207679_10266852 3300025945 Bacteria 1462
341 Ga0207667_10015579 3300025949 Bacteria 8627
342 Ga0207667_10115210 3300025949 Bacteria 2770
343 Ga0207712_10000447 3300025961 Bacteria 35147
344 Ga0207712_10044567 3300025961 Bacteria 3066
345 Ga0207712_10663613 3300025961 Bacteria 907
346 Ga0207668_10009979 3300025972 Bacteria 5714
347 Ga0207668_10137899 3300025972 Bacteria 1872
348 Ga0207668_10232722 3300025972 Bacteria 1486
349 Ga0207668_10328000 3300025972 Bacteria 1272
350 Ga0207640_10002178 3300025981 Bacteria 10540
351 Ga0207640_10014359 3300025981 Bacteria 4557
352 Ga0207658_10000027 3300025986 Bacteria 174626
353 Ga0207658_10000073 3300025986 Bacteria 111738
354 Ga0207658_10018218 3300025986 Bacteria 4845
355 Ga0207677_10006752 3300026023 Bacteria 6302
356 Ga0207703_10001707 3300026035 Bacteria 19720
357 Ga0207703_10284004 3300026035 Bacteria 1504
358 Ga0207703_10413370 3300026035 Bacteria 1254
359 Ga0207703_10472127 3300026035 Bacteria 1174
360 Ga0207639_10010688 3300026041 Bacteria 6357
361 Ga0207639_10045687 3300026041 Bacteria 3300
362 Ga0207639_10085844 3300026041 Bacteria 2504
363 Ga0207639_10094940 3300026041 Bacteria 2395
364 Ga0207678_10000258 3300026067 Bacteria 48084
365 Ga0207678_10010442 3300026067 Bacteria 8153
366 Ga0207678_10035254 3300026067 Bacteria 4356
367 Ga0207678_10043497 3300026067 Bacteria 3886
368 Ga0207678_10199387 3300026067 Bacteria 1711
369 Ga0207702_10000113 3300026078 Bacteria 94003
370 Ga0207702_10015220 3300026078 Bacteria 6377
371 Ga0207641_10008263 3300026088 Bacteria 8601
372 Ga0207641_10012294 3300026088 Bacteria 7022
373 Ga0207641_10184217 3300026088 Bacteria 1914
374 Ga0207641_10443625 3300026088 Bacteria 1253
375 Ga0207648_10102741 3300026089 Bacteria 2506
376 Ga0207648_10429099 3300026089 Bacteria 1201
377 Ga0207676_10000010 3300026095 Bacteria 519402
378 Ga0207676_10021103 3300026095 Bacteria 4776
379 Ga0207674_10004016 3300026116 Bacteria 17867
380 Ga0207674_10506207 3300026116 Bacteria 1167
381 Ga0207675_100177489 3300026118 Bacteria 2038
382 Ga0207683_10036568 3300026121 Bacteria 4277
383 Ga0207683_10045802 3300026121 Bacteria 3825
384 Ga0207683_10467057 3300026121 Bacteria 1164
385 Ga0207698_10094523 3300026142 Bacteria 2458
386 Ga0207698_10110812 3300026142 Bacteria 2300
387 Ga0207698_10215635 3300026142 Bacteria 1730
388 Ga0207698_10309589 3300026142 Bacteria 1474
389 Ga0209371_1000004 3300027312 Bacteria 1098197
390 Ga0268266_10000001 3300028379 Bacteria 4040580
391 Ga0268266_10000006 3300028379 Bacteria 1410021
392 Ga0268266_10064242 3300028379 Bacteria 3171
393 Ga0268266_10085465 3300028379 Bacteria 2756
394 Ga0268266_10127989 3300028379 Bacteria 2268
395 Ga0268265_10000186 3300028380 Bacteria 73892
396 Ga0268265_10001086 3300028380 Bacteria 24228
397 Ga0268264_10000123 3300028381 Bacteria 189361
398 Ga0268256_1000005 3300030500 Bacteria 1082342
399 Ga0316183_1103403 3300030742 Bacteria 3231
400 Ga0316181_1133242 3300030744 Bacteria 3057
401 Ga0265330_10000317 3300031235 Bacteria 34538
402 Ga0265332_10001593 3300031238 Bacteria 12435
403 Ga0265320_10084474 3300031240 Bacteria 1478
404 Ga0265325_10117546 3300031241 Bacteria 1285
405 Ga0265329_10002813 3300031242 Bacteria 7769
406 Ga0265339_10043209 3300031249 Bacteria 2493
407 Ga0265331_10045614 3300031250 Bacteria 2116
408 Ga0265327_10001978 3300031251 Bacteria 23328
409 Ga0265316_10000399 3300031344 Bacteria 49576
410 Ga0307509_10071672 3300031507 Bacteria 3613
411 Ga0307408_100144827 3300031548 Bacteria 1869
412 Ga0307508_10226878 3300031616 Bacteria 1467
413 Ga0265314_10000532 3300031711 Bacteria 49131
414 Ga0265342_10000369 3300031712 Bacteria 49518
415 Ga0316578_10208404 3300031728 Bacteria 1176
416 Ga0307516_10076107 3300031730 Bacteria 3209
417 Ga0307413_10047572 3300031824 Bacteria 2559
418 Ga0307409_100155666 3300031995 Bacteria 1991
419 Ga0307411_10424565 3300032005 Bacteria 1105
420 Ga0307507_10069788 3300033179 Bacteria 3194
421 Ga0373923_0174248 3300035111 Bacteria 986
422 Ga0373957_0027112 3300035120 Bacteria 2079
423 Ga0316574_0031332 3300035398 Bacteria 3225
424 Ga0373925_0509623 3300037068 Bacteria 988
425 Ga0395899_0000119 3300037312 Bacteria 127184
426 Ga0395899_0071506 3300037312 Bacteria 2539
427 Ga0395900_0000107 3300037418 Bacteria 149024
428 Ga0395900_0000189 3300037418 Bacteria 98932
429 Ga0395900_0005182 3300037418 Bacteria 13684
430 Ga0395900_0153600 3300037418 Bacteria 2351
431 Ga0395900_0156570 3300037418 Bacteria 2327
432 Ga0395898_0000211 3300037466 Bacteria 149301
433 Ga0395898_0041348 3300037466 Bacteria 4553
434 Ga0395898_0090907 3300037466 Bacteria 2937
435 Ga0395905_0099892 3300037471 Bacteria 2725
436 Ga0395901_0055402 3300038443 Bacteria 4123
437 Ga0395901_0221676 3300038443 Bacteria 1976
438 Ga0436365_1811309 3300039437 Bacteria 2391
439 Ga0451807_1480785 3300041486 Bacteria 1523
440 Ga0466969_0019427 3300044656 Bacteria 3532
441 Ga0466972_0000629 3300044658 Bacteria 17099
442 Ga0466966_0004172 3300044684 Bacteria 9546
443 Ga0466970_0000172 3300044765 Bacteria 30789
444 Ga0466959_0000467 3300045049 Bacteria 23599
445 Ga0495639_0027996 3300046475 Bacteria 2496
446 Ga0495643_0002426 3300046522 Bacteria 14817
447 Ga0495645_0034740 3300046543 Bacteria 3676
448 Ga0495656_0043190 3300046615 Bacteria 1891
449 Ga0495635_0319493 3300046663 Bacteria 1039
450 Ga0495647_0102464 3300046681 Bacteria 1187
451 Ga0495658_0033180 3300046683 Bacteria 2825
452 Ga0495670_0107757 3300046691 Bacteria 1440
453 Ga0495649_0052193 3300046694 Bacteria 2216
454 Ga0495636_0019738 3300047318 Bacteria 2711
455 Ga0495636_0121786 3300047318 Bacteria 1154
456 Ga0495672_0000308 3300047320 Bacteria 65628
457 Ga0495686_0001563 3300047472 Bacteria 24398
458 Ga0496102_0278493 3300048905 Bacteria 1577
459 Ga0496103_0166498 3300048906 Bacteria 1414
460 Ga0496104_0000017 3300048907 Bacteria 325877
461 Ga0496105_0000009 3300048908 Bacteria 325734
462 Ga0496105_0000297 3300048908 Bacteria 32702
463 Ga0496115_0000148 3300048918 Bacteria 64816
464 Ga0496117_0002543 3300048920 Bacteria 22759
465 Ga0496117_0032221 3300048920 Bacteria 3985
466 Ga0496118_0000145 3300048921 Bacteria 123886
467 Ga0496118_0000681 3300048921 Bacteria 55339
468 Ga0496118_0000682 3300048921 Bacteria 55209
469 Ga0496118_0003292 3300048921 Bacteria 20547
470 Ga0496118_0016769 3300048921 Bacteria 6698
471 Ga0496118_0029186 3300048921 Bacteria 4630
472 Ga0496118_0041089 3300048921 Bacteria 3667
473 Ga0496118_0046092 3300048921 Bacteria 3395
474 Ga0496119_0000150 3300048922 Bacteria 97299
475 Ga0496119_0001728 3300048922 Bacteria 25473
476 Ga0496120_0000605 3300048923 Bacteria 54408
477 Ga0496120_0006390 3300048923 Bacteria 9059
478 Ga0496120_0006457 3300048923 Bacteria 8993
479 Ga0496121_0000651 3300048924 Bacteria 64980
480 Ga0496121_0033055 3300048924 Bacteria 4690
481 Ga0496122_0000220 3300048925 Bacteria 127065
482 Ga0496122_0001331 3300048925 Bacteria 40422
483 Ga0496123_0000107 3300048926 Bacteria 166923
484 Ga0496123_0000151 3300048926 Bacteria 141062
485 Ga0496124_0049688 3300048927 Bacteria 3576
486 Ga0496124_0074610 3300048927 Bacteria 2803
487 Ga0496124_0212936 3300048927 Bacteria 1460
488 Ga0496124_0216497 3300048927 Bacteria 1444
489 Ga0496125_0108391 3300048928 Bacteria 2020
490 Ga0496126_0000033 3300048929 Bacteria 368851
491 Ga0496126_0003202 3300048929 Bacteria 21008
492 Ga0496126_0023236 3300048929 Bacteria 6009
493 Ga0496126_0049967 3300048929 Bacteria 3815
494 Ga0496126_0171340 3300048929 Bacteria 1849
495 Ga0501031_0042417 3300049568 Bacteria 2970
496 Ga0501031_0084313 3300049568 Bacteria 2071
497 Ga0501031_0124400 3300049568 Bacteria 1684
498 Ga0501032_0013460 3300049569 Bacteria 5818
499 Ga0501032_0084159 3300049569 Bacteria 2114
500 Ga0501033_0005157 3300049570 Bacteria 10385
501 Ga0501033_0009648 3300049570 Bacteria 7425
502 Ga0501034_0003879 3300049571 Bacteria 16827
503 Ga0501034_0004123 3300049571 Bacteria 16282
504 Ga0501034_0023790 3300049571 Bacteria 6238
505 Ga0501034_0061627 3300049571 Bacteria 3766
506 Ga0501034_0091816 3300049571 Bacteria 3033
507 Ga0501034_0231669 3300049571 Bacteria 1796
508 Ga0501036_0057770 3300049572 Bacteria 3287
509 Ga0501036_0259244 3300049572 Bacteria 1456
510 Ga0501037_0055906 3300049573 Bacteria 2884
511 Ga0501037_0326080 3300049573 Bacteria 1062
512 Ga0501038_0006070 3300049574 Bacteria 11177
513 Ga0501038_0026746 3300049574 Bacteria 5136
514 Ga0501038_0150283 3300049574 Bacteria 1899
515 Ga0501042_0109683 3300049578 Bacteria 1987
516 Ga0501043_0010830 3300049579 Bacteria 7140
517 Ga0501043_0020494 3300049579 Bacteria 5187
518 Ga0501043_0047144 3300049579 Bacteria 3388
519 Ga0501043_0158648 3300049579 Bacteria 1768
520 Ga0501046_0014070 3300049580 Bacteria 6757
521 Ga0501046_0059916 3300049580 Bacteria 2980
522 Ga0501047_0002958 3300049581 Bacteria 16102
523 Ga0501047_0012080 3300049581 Bacteria 8174
524 Ga0501047_0023481 3300049581 Bacteria 5919
525 Ga0501047_0026836 3300049581 Bacteria 5544
526 Ga0501047_0048587 3300049581 Bacteria 4097
527 Ga0501047_0253791 3300049581 Bacteria 1607
528 Ga0501047_0262809 3300049581 Bacteria 1573
529 Ga0501047_0315897 3300049581 Bacteria 1402
530 Ga0501048_0029612 3300049582 Bacteria 3968
531 Ga0501048_0101533 3300049582 Bacteria 2029
532 Ga0501067_0003364 3300049583 Bacteria 8794
533 Ga0501067_0131219 3300049583 Bacteria 1394
534 Ga0501068_0010971 3300049584 Bacteria 5100
535 Ga0501068_0020417 3300049584 Bacteria 3859
536 Ga0501069_0008112 3300049585 Bacteria 5518
537 Ga0501069_0017577 3300049585 Bacteria 3852
538 Ga0501069_0046954 3300049585 Bacteria 2396
539 Ga0501070_0000511 3300049586 Bacteria 35493
540 Ga0501070_0010348 3300049586 Bacteria 7883
541 Ga0501070_0044482 3300049586 Bacteria 3694
542 Ga0501070_0083368 3300049586 Bacteria 2646
543 Ga0501071_0057860 3300049587 Bacteria 2802
544 Ga0501072_0168734 3300049588 Bacteria 1746
545 Ga0501073_0000441 3300049589 Bacteria 28676
546 Ga0501073_0007672 3300049589 Bacteria 8006
547 Ga0501073_0016619 3300049589 Bacteria 5331
548 Ga0501073_0048484 3300049589 Bacteria 2981
549 Ga0501073_0078093 3300049589 Bacteria 2303
550 Ga0501074_0098120 3300049590 Bacteria 2097
551 Ga0501074_0107488 3300049590 Bacteria 1997
552 Ga0501074_0110056 3300049590 Bacteria 1971
553 Ga0501077_0155131 3300049593 Bacteria 1453
554 Ga0501238_004700 3300049671 Bacteria 1714
555 Ga0501252_000558 3300049682 Bacteria 2935
556 Ga0501079_0046049 3300049741 Bacteria 3365
557 Ga0501079_0051332 3300049741 Bacteria 3184
558 Ga0501080_0000627 3300049742 Bacteria 28011
559 Ga0501080_0006579 3300049742 Bacteria 10440
560 Ga0501080_0017160 3300049742 Bacteria 6686
561 Ga0501080_0029396 3300049742 Bacteria 5115
562 Ga0501080_0094317 3300049742 Bacteria 2779
563 Ga0501080_0514025 3300049742 Bacteria 1069
564 Ga0501081_0046086 3300049743 Bacteria 2996
565 Ga0501083_0005730 3300049744 Bacteria 8791
566 Ga0501035_0017552 3300049822 Bacteria 6603
567 Ga0501035_0034410 3300049822 Bacteria 4603
568 Ga0501044_0039203 3300049823 Bacteria 4942
569 Ga0501044_0057599 3300049823 Bacteria 3987
570 Ga0501044_0092060 3300049823 Bacteria 3058
571 Ga0501044_0149537 3300049823 Bacteria 2318
572 Ga0501044_0257845 3300049823 Bacteria 1683
573 Ga0501044_0386676 3300049823 Bacteria 1313
574 Ga0501044_0521916 3300049823 Bacteria 1087
575 Ga0501045_0023664 3300049824 Bacteria 4406
576 Ga0500643_001164 3300053087 Bacteria 15686
577 Ga0500651_0000461 3300053093 Bacteria 21522
578 Ga0500566_0193438 3300053094 Bacteria 1033
579 Ga0500614_027770 3300053123 Bacteria 1363
580 Ga0500634_0012485 3300053161 Bacteria 4424
581 Ga0501084_0133685 3300054114 Bacteria 2088
582 Ga0501084_0399144 3300054114 Bacteria 1162
583 Ga0501082_0007415 3300060353 Bacteria 9465
584 Ga0501082_0047113 3300060353 Bacteria 3715
585 Ga0501082_0089973 3300060353 Bacteria 2650

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_0156570 Ga0395900_0156570_1149_1964 244
2 3300031548 Ga0307408_100144827 Ga0307408_1001448272 245
3 3300005331 Ga0070670_100201832 Ga0070670_1002018322 247
4 3300048905 Ga0496102_0278493 Ga0496102_0278493_33_776 247
5 3300049742 Ga0501080_0514025 Ga0501080_0514025_26_769 247
6 3300048927 Ga0496124_0074610 Ga0496124_0074610_1987_2790 248
7 3300003856 Ga0058692_1000002 Ga0058692_1000002313 249
8 3300027312 Ga0209371_1000004 Ga0209371_1000004521 249
9 3300030500 Ga0268256_1000005 Ga0268256_1000005525 249
10 3300031728 Ga0316578_10208404 Ga0316578_102084041 250
11 3300014969 Ga0157376_10593797 Ga0157376_105937971 251
12 3300041486 Ga0451807_1480785 Ga0451807_1480785_498_1322 252
13 3300025931 Ga0207644_10326465 Ga0207644_103264651 253
14 3300026089 Ga0207648_10102741 Ga0207648_101027412 253
15 3300049671 Ga0501238_004700 Ga0501238_004700_427_1248 253
16 3300049682 Ga0501252_000558 Ga0501252_000558_629_1450 253
17 3300049581 Ga0501047_0048587 Ga0501047_0048587_2423_3241 256
18 3300005334 Ga0068869_100141397 Ga0068869_1001413971 257
19 3300006237 Ga0097621_100252512 Ga0097621_1002525122 257
20 3300013102 Ga0157371_10246320 Ga0157371_102463202 257
21 3300015262 Ga0182007_10000184 Ga0182007_100001844 257
22 3300015265 Ga0182005_1000444 Ga0182005_10004444 257
23 3300025942 Ga0207689_10104390 Ga0207689_101043902 257
24 3300048920 Ga0496117_0002543 Ga0496117_0002543_1117_1974 257
25 3300048921 Ga0496118_0000681 Ga0496118_0000681_1120_1977 257
26 3300048922 Ga0496119_0001728 Ga0496119_0001728_6041_6898 257
27 3300048923 Ga0496120_0000605 Ga0496120_0000605_6029_6886 257
28 3300048927 Ga0496124_0049688 Ga0496124_0049688_1987_2817 257
29 3300048929 Ga0496126_0003202 Ga0496126_0003202_1229_2086 257
30 iso_pu_bacteria 2643221577 2643894173 257
31 iso_pu_bacteria 2643221685 2644476375 257
32 3300014969 Ga0157376_10010376 Ga0157376_100103766 258
33 3300049581 Ga0501047_0253791 Ga0501047_0253791_718_1545 258
34 3300054114 Ga0501084_0399144 Ga0501084_0399144_351_1130 258
35 3300037418 Ga0395900_0153600 Ga0395900_0153600_374_1177 259
36 3300037466 Ga0395898_0041348 Ga0395898_0041348_806_1624 259
37 3300037471 Ga0395905_0099892 Ga0395905_0099892_375_1193 259
38 3300038443 Ga0395901_0055402 Ga0395901_0055402_1408_2211 259
39 3300038443 Ga0395901_0221676 Ga0395901_0221676_806_1624 259
40 3300049568 Ga0501031_0124400 Ga0501031_0124400_15_821 259
41 3300049570 Ga0501033_0005157 Ga0501033_0005157_7326_8132 259
42 3300049572 Ga0501036_0259244 Ga0501036_0259244_474_1280 259
43 3300049573 Ga0501037_0326080 Ga0501037_0326080_223_1029 259
44 3300049574 Ga0501038_0150283 Ga0501038_0150283_648_1454 259
45 3300049579 Ga0501043_0020494 Ga0501043_0020494_4021_4827 259
46 3300049581 Ga0501047_0315897 Ga0501047_0315897_139_945 259
47 3300049582 Ga0501048_0029612 Ga0501048_0029612_2435_3241 259
48 3300049742 Ga0501080_0094317 Ga0501080_0094317_1165_1971 259
49 3300049823 Ga0501044_0386676 Ga0501044_0386676_339_1145 259
50 3300009093 Ga0105240_10033737 Ga0105240_100337377 260
51 3300009545 Ga0105237_10015674 Ga0105237_100156748 260
52 3300009551 Ga0105238_10004286 Ga0105238_100042867 260
53 3300009553 Ga0105249_10046262 Ga0105249_100462622 260
54 3300010375 Ga0105239_10093972 Ga0105239_100939724 260
55 3300013105 Ga0157369_10000057 Ga0157369_1000005795 260
56 3300025913 Ga0207695_10021003 Ga0207695_100210032 260
57 3300025914 Ga0207671_10001767 Ga0207671_1000176716 260
58 3300025924 Ga0207694_10001224 Ga0207694_1000122417 260
59 3300025961 Ga0207712_10044567 Ga0207712_100445672 260
60 3300005367 Ga0070667_100000012 Ga0070667_100000012131 261
61 3300005455 Ga0070663_100000126 Ga0070663_1000001264 261
62 3300005539 Ga0068853_100008635 Ga0068853_1000086352 261
63 3300009177 Ga0105248_10000179 Ga0105248_1000017954 261
64 3300009545 Ga0105237_10002762 Ga0105237_1000276212 261
65 3300009553 Ga0105249_10000262 Ga0105249_1000026255 261
66 3300010375 Ga0105239_10018900 Ga0105239_100189005 261
67 3300025900 Ga0207710_10082809 Ga0207710_100828092 261
68 3300025914 Ga0207671_10020004 Ga0207671_100200045 261
69 3300025941 Ga0207711_10000406 Ga0207711_1000040618 261
70 3300025986 Ga0207658_10000027 Ga0207658_10000027120 261
71 3300026041 Ga0207639_10085844 Ga0207639_100858441 261
72 3300026067 Ga0207678_10000258 Ga0207678_1000025827 261
73 3300026142 Ga0207698_10215635 Ga0207698_102156351 261
74 3300047472 Ga0495686_0001563 Ga0495686_0001563_16498_17322 261
75 3300048925 Ga0496122_0001331 Ga0496122_0001331_39464_40288 261
76 3300048926 Ga0496123_0000107 Ga0496123_0000107_152296_153120 261
77 3300049569 Ga0501032_0084159 Ga0501032_0084159_1166_1993 261
78 3300049570 Ga0501033_0009648 Ga0501033_0009648_1228_2055 261
79 3300049571 Ga0501034_0023790 Ga0501034_0023790_3418_4245 261
80 3300049574 Ga0501038_0006070 Ga0501038_0006070_6656_7483 261
81 3300049579 Ga0501043_0010830 Ga0501043_0010830_4308_5135 261
82 3300049580 Ga0501046_0014070 Ga0501046_0014070_4123_4950 261
83 3300049581 Ga0501047_0023481 Ga0501047_0023481_2702_3529 261
84 3300049586 Ga0501070_0044482 Ga0501070_0044482_826_1653 261
85 3300049589 Ga0501073_0007672 Ga0501073_0007672_335_1162 261
86 3300049590 Ga0501074_0098120 Ga0501074_0098120_1103_1930 261
87 3300049741 Ga0501079_0051332 Ga0501079_0051332_1407_2234 261
88 3300049742 Ga0501080_0006579 Ga0501080_0006579_3783_4610 261
89 3300049822 Ga0501035_0034410 Ga0501035_0034410_3460_4287 261
90 3300049823 Ga0501044_0039203 Ga0501044_0039203_1228_2055 261
91 3300053087 Ga0500643_001164 Ga0500643_001164_5939_6763 261
92 3300048921 Ga0496118_0000682 Ga0496118_0000682_16855_17682 262
93 3300048924 Ga0496121_0033055 Ga0496121_0033055_2628_3455 262
94 3300048929 Ga0496126_0171340 Ga0496126_0171340_667_1494 262
95 iso_pu_bacteria 2738541281 2738744409 262
96 iso_pu_bacteria 2738543032 2739353639 262
97 3300005937 Ga0081455_10194488 Ga0081455_101944882 263
98 3300044658 Ga0466972_0000629 Ga0466972_0000629_13343_14167 263
99 3300044765 Ga0466970_0000172 Ga0466970_0000172_2891_3715 263
100 3300005337 Ga0070682_100068133 Ga0070682_1000681333 264
101 3300005339 Ga0070660_100280854 Ga0070660_1002808542 264
102 3300005341 Ga0070691_10151904 Ga0070691_101519042 264
103 3300005345 Ga0070692_10102237 Ga0070692_101022372 264
104 3300005366 Ga0070659_100072079 Ga0070659_1000720793 264
105 3300005539 Ga0068853_100059903 Ga0068853_1000599032 264
106 3300005577 Ga0068857_100479452 Ga0068857_1004794521 264
107 3300009174 Ga0105241_10053273 Ga0105241_100532735 264
108 3300013100 Ga0157373_10298453 Ga0157373_102984532 264
109 3300013306 Ga0163162_10000021 Ga0163162_1000002161 264
110 3300013307 Ga0157372_10037322 Ga0157372_100373225 264
111 3300025904 Ga0207647_10232430 Ga0207647_102324301 264
112 3300025911 Ga0207654_10087156 Ga0207654_100871562 264
113 3300025919 Ga0207657_10479244 Ga0207657_104792441 264
114 3300025949 Ga0207667_10015579 Ga0207667_100155797 264
115 3300026041 Ga0207639_10010688 Ga0207639_100106882 264
116 3300026116 Ga0207674_10506207 Ga0207674_105062072 264
117 3300031824 Ga0307413_10047572 Ga0307413_100475723 264
118 3300031995 Ga0307409_100155666 Ga0307409_1001556662 264
119 3300032005 Ga0307411_10424565 Ga0307411_104245651 264
120 3300037312 Ga0395899_0071506 Ga0395899_0071506_786_1592 264
121 3300049573 Ga0501037_0055906 Ga0501037_0055906_426_1220 264
122 3300049581 Ga0501047_0026836 Ga0501047_0026836_1540_2343 264
123 3300049823 Ga0501044_0521916 Ga0501044_0521916_113_907 264
124 3300002705 JGI25156J39149_1027473 JGI25156J39149_10274731 265
125 3300002741 JGI25157J39369_1000362 JGI25157J39369_100036230 265
126 3300003752 Ga0055539_1000476 Ga0055539_10004769 265
127 3300003756 Ga0055533_1000833 Ga0055533_10008331 265
128 3300003760 Ga0055527_1000066 Ga0055527_100006684 265
129 3300003761 Ga0055535_1000058 Ga0055535_10000585 265
130 3300003762 Ga0055542_1000085 Ga0055542_10000855 265
131 3300003763 Ga0055529_1000240 Ga0055529_100024063 265
132 3300005327 Ga0070658_10052653 Ga0070658_100526532 265
133 3300005563 Ga0068855_100008373 Ga0068855_1000083737 265
134 3300005563 Ga0068855_100298134 Ga0068855_1002981342 265
135 3300005614 Ga0068856_100003624 Ga0068856_1000036248 265
136 3300013307 Ga0157372_10112631 Ga0157372_101126312 265
137 3300025226 Ga0209674_100202 Ga0209674_10020234 265
138 3300025226 Ga0209674_100700 Ga0209674_10070010 265
139 3300025228 Ga0209672_100018 Ga0209672_100018226 265
140 3300025242 Ga0209258_100024 Ga0209258_100024332 265
141 3300025250 Ga0209026_1000056 Ga0209026_1000056112 265
142 3300025253 Ga0209677_102067 Ga0209677_1020678 265
143 3300025254 Ga0209148_1000009 Ga0209148_1000009660 265
144 3300025256 Ga0209759_1000317 Ga0209759_100031751 265
145 3300025272 Ga0209455_1000029 Ga0209455_1000029332 265
146 3300026078 Ga0207702_10015220 Ga0207702_100152206 265
147 3300031730 Ga0307516_10076107 Ga0307516_100761071 265
148 3300037312 Ga0395899_0000119 Ga0395899_0000119_94008_94808 265
149 3300037418 Ga0395900_0000107 Ga0395900_0000107_125358_126158 265
150 3300037418 Ga0395900_0000189 Ga0395900_0000189_75924_76742 265
151 3300037418 Ga0395900_0005182 Ga0395900_0005182_694_1524 265
152 3300037466 Ga0395898_0000211 Ga0395898_0000211_70887_71687 265
153 3300037466 Ga0395898_0090907 Ga0395898_0090907_1393_2211 265
154 3300044656 Ga0466969_0019427 Ga0466969_0019427_465_1265 265
155 3300044684 Ga0466966_0004172 Ga0466966_0004172_5455_6255 265
156 3300045049 Ga0466959_0000467 Ga0466959_0000467_7615_8415 265
157 3300005355 Ga0070671_100477053 Ga0070671_1004770531 266
158 3300005367 Ga0070667_100018607 Ga0070667_1000186077 266
159 3300005548 Ga0070665_100000077 Ga0070665_100000077140 266
160 3300013297 Ga0157378_10451641 Ga0157378_104516412 266
161 3300025986 Ga0207658_10018218 Ga0207658_100182184 266
162 3300028379 Ga0268266_10000001 Ga0268266_100000011550 266
163 3300039437 Ga0436365_1811309 Ga0436365_1811309_677_1477 266
164 3300048918 Ga0496115_0000148 Ga0496115_0000148_32840_33640 266
165 3300048921 Ga0496118_0041089 Ga0496118_0041089_1858_2658 266
166 3300048929 Ga0496126_0000033 Ga0496126_0000033_275639_276439 266
167 3300049585 Ga0501069_0008112 Ga0501069_0008112_2148_2951 266
168 3300002077 JGI24744J21845_10022836 JGI24744J21845_100228362 267
169 3300003320 rootH2_10022390 rootH2_100223902 267
170 3300005330 Ga0070690_100262442 Ga0070690_1002624422 267
171 3300005333 Ga0070677_10106168 Ga0070677_101061681 267
172 3300005335 Ga0070666_10001547 Ga0070666_100015471 267
173 3300005335 Ga0070666_10118456 Ga0070666_101184562 267
174 3300005347 Ga0070668_100446723 Ga0070668_1004467232 267
175 3300005355 Ga0070671_100546584 Ga0070671_1005465841 267
176 3300005456 Ga0070678_100055092 Ga0070678_1000550922 267
177 3300005456 Ga0070678_100064834 Ga0070678_1000648342 267
178 3300005456 Ga0070678_100249918 Ga0070678_1002499182 267
179 3300005459 Ga0068867_100018794 Ga0068867_1000187944 267
180 3300005548 Ga0070665_100393031 Ga0070665_1003930311 267
181 3300005548 Ga0070665_100752298 Ga0070665_1007522981 267
182 3300005614 Ga0068856_100184188 Ga0068856_1001841882 267
183 3300005617 Ga0068859_100420338 Ga0068859_1004203382 267
184 3300005618 Ga0068864_100063909 Ga0068864_1000639093 267
185 3300005840 Ga0068870_10054056 Ga0068870_100540563 267
186 3300005841 Ga0068863_100015435 Ga0068863_1000154359 267
187 3300005841 Ga0068863_100162783 Ga0068863_1001627832 267
188 3300005842 Ga0068858_100261007 Ga0068858_1002610072 267
189 3300005843 Ga0068860_100010778 Ga0068860_1000107784 267
190 3300005843 Ga0068860_100297791 Ga0068860_1002977912 267
191 3300006237 Ga0097621_100131025 Ga0097621_1001310252 267
192 3300006237 Ga0097621_100506861 Ga0097621_1005068612 267
193 3300006358 Ga0068871_100176427 Ga0068871_1001764272 267
194 3300006881 Ga0068865_100004664 Ga0068865_1000046647 267
195 3300006881 Ga0068865_100245968 Ga0068865_1002459682 267
196 3300006881 Ga0068865_100248683 Ga0068865_1002486832 267
197 3300006931 Ga0097620_100420392 Ga0097620_1004203922 267
198 3300009098 Ga0105245_10024940 Ga0105245_100249404 267
199 3300009098 Ga0105245_10093279 Ga0105245_100932792 267
200 3300009174 Ga0105241_10114700 Ga0105241_101147003 267
201 3300009176 Ga0105242_10006154 Ga0105242_100061547 267
202 3300009177 Ga0105248_10079710 Ga0105248_100797104 267
203 3300009553 Ga0105249_10451272 Ga0105249_104512721 267
204 3300013296 Ga0157374_10793723 Ga0157374_107937231 267
205 3300013297 Ga0157378_10056431 Ga0157378_100564312 267
206 3300013306 Ga0163162_10002567 Ga0163162_100025676 267
207 3300013306 Ga0163162_10008312 Ga0163162_100083125 267
208 3300013306 Ga0163162_10531015 Ga0163162_105310151 267
209 3300013307 Ga0157372_10055941 Ga0157372_100559415 267
210 3300013308 Ga0157375_10001325 Ga0157375_100013258 267
211 3300014325 Ga0163163_10004778 Ga0163163_1000477812 267
212 3300014325 Ga0163163_10360550 Ga0163163_103605502 267
213 3300014968 Ga0157379_10008775 Ga0157379_1000877510 267
214 3300014968 Ga0157379_10405495 Ga0157379_104054952 267
215 3300014969 Ga0157376_10002515 Ga0157376_100025153 267
216 3300025903 Ga0207680_10006961 Ga0207680_100069616 267
217 3300025903 Ga0207680_10052056 Ga0207680_100520563 267
218 3300025903 Ga0207680_10165638 Ga0207680_101656382 267
219 3300025908 Ga0207643_10049275 Ga0207643_100492753 267
220 3300025911 Ga0207654_10067696 Ga0207654_100676963 267
221 3300025926 Ga0207659_10134704 Ga0207659_101347042 267
222 3300025927 Ga0207687_10057162 Ga0207687_100571622 267
223 3300025934 Ga0207686_10176337 Ga0207686_101763371 267
224 3300025934 Ga0207686_10223322 Ga0207686_102233221 267
225 3300025938 Ga0207704_10009861 Ga0207704_100098612 267
226 3300025940 Ga0207691_10015575 Ga0207691_100155756 267
227 3300025942 Ga0207689_10029972 Ga0207689_100299724 267
228 3300025942 Ga0207689_10150189 Ga0207689_101501892 267
229 3300025961 Ga0207712_10663613 Ga0207712_106636131 267
230 3300025972 Ga0207668_10328000 Ga0207668_103280002 267
231 3300026035 Ga0207703_10472127 Ga0207703_104721271 267
232 3300026088 Ga0207641_10008263 Ga0207641_100082639 267
233 3300026088 Ga0207641_10184217 Ga0207641_101842172 267
234 3300026089 Ga0207648_10429099 Ga0207648_104290991 267
235 3300026121 Ga0207683_10036568 Ga0207683_100365683 267
236 3300026121 Ga0207683_10045802 Ga0207683_100458024 267
237 3300026121 Ga0207683_10467057 Ga0207683_104670572 267
238 3300028379 Ga0268266_10064242 Ga0268266_100642422 267
239 3300031251 Ga0265327_10001978 Ga0265327_1000197817 267
240 3300035111 Ga0373923_0174248 Ga0373923_0174248_151_969 267
241 3300035120 Ga0373957_0027112 Ga0373957_0027112_287_1105 267
242 3300037068 Ga0373925_0509623 Ga0373925_0509623_86_904 267
243 3300046475 Ga0495639_0027996 Ga0495639_0027996_1571_2389 267
244 3300046543 Ga0495645_0034740 Ga0495645_0034740_2266_3084 267
245 3300046663 Ga0495635_0319493 Ga0495635_0319493_165_983 267
246 3300046681 Ga0495647_0102464 Ga0495647_0102464_140_958 267
247 3300046683 Ga0495658_0033180 Ga0495658_0033180_494_1312 267
248 3300048907 Ga0496104_0000017 Ga0496104_0000017_206645_207463 267
249 3300048908 Ga0496105_0000009 Ga0496105_0000009_7531_8349 267
250 3300049569 Ga0501032_0013460 Ga0501032_0013460_1887_2693 267
251 3300049571 Ga0501034_0004123 Ga0501034_0004123_1828_2634 267
252 3300049571 Ga0501034_0231669 Ga0501034_0231669_210_1028 267
253 3300049572 Ga0501036_0057770 Ga0501036_0057770_571_1377 267
254 3300049581 Ga0501047_0012080 Ga0501047_0012080_6146_6952 267
255 3300049583 Ga0501067_0003364 Ga0501067_0003364_1995_2801 267
256 3300049585 Ga0501069_0017577 Ga0501069_0017577_1855_2661 267
257 3300049586 Ga0501070_0000511 Ga0501070_0000511_413_1219 267
258 3300049589 Ga0501073_0000441 Ga0501073_0000441_11128_11934 267
259 3300049590 Ga0501074_0107488 Ga0501074_0107488_540_1346 267
260 3300049742 Ga0501080_0017160 Ga0501080_0017160_2053_2859 267
261 3300049744 Ga0501083_0005730 Ga0501083_0005730_6116_6922 267
262 3300049822 Ga0501035_0017552 Ga0501035_0017552_3652_4470 267
263 3300049823 Ga0501044_0149537 Ga0501044_0149537_839_1657 267
264 3300053094 Ga0500566_0193438 Ga0500566_0193438_203_1021 267
265 3300053123 Ga0500614_027770 Ga0500614_027770_481_1299 267
266 3300060353 Ga0501082_0047113 Ga0501082_0047113_1340_2146 267
267 iso_pu_bacteria 2547132130 2547501598 267
268 iso_pu_bacteria 2643221573 2643879508 267
269 iso_pu_bacteria 2643221593 2643974388 267
270 iso_pu_bacteria 2643221720 2644662881 267
271 iso_pu_bacteria 2643221728 2644698164 267
272 iso_pu_bacteria 2816332141 2816516413 267
273 iso_pu_bacteria 2857442823 2857446844 267
274 iso_pu_bacteria 2874220319 2874221014 267
275 iso_pu_bacteria 2919089067 2919091225 267
276 iso_pu_bacteria 2919134579 2919136741 267
277 iso_pu_bacteria 2928496128 2928497856 267
278 iso_pu_bacteria 2931380184 2931381342 267
279 iso_pu_bacteria 2937610967 2937611835 267
280 iso_pu_bacteria 2939626828 2939627776 267
281 iso_pu_bacteria 2961047084 2961047779 267
282 iso_pu_bacteria 2961064222 2961067121 267
283 iso_pu_bacteria 2987605356 2987605817 267
284 3300005327 Ga0070658_10051561 Ga0070658_100515613 268
285 3300005330 Ga0070690_100111813 Ga0070690_1001118131 268
286 3300005339 Ga0070660_100036610 Ga0070660_1000366103 268
287 3300005344 Ga0070661_100005490 Ga0070661_1000054908 268
288 3300005366 Ga0070659_100364382 Ga0070659_1003643822 268
289 3300005367 Ga0070667_100028690 Ga0070667_1000286903 268
290 3300005458 Ga0070681_10148395 Ga0070681_101483951 268
291 3300005578 Ga0068854_100300788 Ga0068854_1003007881 268
292 3300005616 Ga0068852_100021053 Ga0068852_1000210533 268
293 3300005842 Ga0068858_100026607 Ga0068858_1000266072 268
294 3300013104 Ga0157370_10208794 Ga0157370_102087941 268
295 3300013105 Ga0157369_10356171 Ga0157369_103561712 268
296 3300013307 Ga0157372_10044856 Ga0157372_100448565 268
297 3300025904 Ga0207647_10004943 Ga0207647_100049438 268
298 3300025913 Ga0207695_10000256 Ga0207695_1000025698 268
299 3300025914 Ga0207671_10005441 Ga0207671_1000544110 268
300 3300025920 Ga0207649_10000586 Ga0207649_1000058615 268
301 3300025924 Ga0207694_10097659 Ga0207694_100976592 268
302 3300025945 Ga0207679_10266852 Ga0207679_102668522 268
303 3300026035 Ga0207703_10284004 Ga0207703_102840042 268
304 3300026041 Ga0207639_10094940 Ga0207639_100949402 268
305 3300026067 Ga0207678_10199387 Ga0207678_101993872 268
306 3300026116 Ga0207674_10004016 Ga0207674_100040165 268
307 3300049571 Ga0501034_0003879 Ga0501034_0003879_3347_4156 268
308 3300049579 Ga0501043_0047144 Ga0501043_0047144_1581_2390 268
309 3300049581 Ga0501047_0002958 Ga0501047_0002958_13313_14122 268
310 3300049584 Ga0501068_0020417 Ga0501068_0020417_457_1266 268
311 3300049586 Ga0501070_0010348 Ga0501070_0010348_6801_7610 268
312 3300049590 Ga0501074_0110056 Ga0501074_0110056_188_997 268
313 3300049742 Ga0501080_0000627 Ga0501080_0000627_21496_22305 268
314 3300049823 Ga0501044_0092060 Ga0501044_0092060_1724_2533 268
315 3300002705 JGI25156J39149_1002466 JGI25156J39149_10024663 269
316 3300002741 JGI25157J39369_1003264 JGI25157J39369_10032643 269
317 3300003187 JGI25151J46595_10064024 JGI25151J46595_100640242 269
318 3300005337 Ga0070682_100038344 Ga0070682_1000383443 269
319 3300005344 Ga0070661_100072421 Ga0070661_1000724212 269
320 3300005345 Ga0070692_10087951 Ga0070692_100879512 269
321 3300005444 Ga0070694_100354199 Ga0070694_1003541991 269
322 3300005455 Ga0070663_100032355 Ga0070663_1000323553 269
323 3300005457 Ga0070662_100115063 Ga0070662_1001150632 269
324 3300005458 Ga0070681_10107674 Ga0070681_101076743 269
325 3300005547 Ga0070693_100029848 Ga0070693_1000298482 269
326 3300005563 Ga0068855_100105694 Ga0068855_1001056944 269
327 3300005578 Ga0068854_100052885 Ga0068854_1000528851 269
328 3300009093 Ga0105240_10200916 Ga0105240_102009162 269
329 3300009545 Ga0105237_10000348 Ga0105237_1000034815 269
330 3300013307 Ga0157372_10253252 Ga0157372_102532522 269
331 3300014497 Ga0182008_10027901 Ga0182008_100279012 269
332 3300015261 Ga0182006_1012945 Ga0182006_10129455 269
333 3300015262 Ga0182007_10015116 Ga0182007_100151164 269
334 3300025250 Ga0209026_1000162 Ga0209026_100016272 269
335 3300025250 Ga0209026_1005359 Ga0209026_10053592 269
336 3300025256 Ga0209759_1000906 Ga0209759_10009069 269
337 3300025272 Ga0209455_1000261 Ga0209455_100026137 269
338 3300025294 Ga0209025_1065617 Ga0209025_10656172 269
339 3300025904 Ga0207647_10009246 Ga0207647_100092466 269
340 3300025909 Ga0207705_10080784 Ga0207705_100807842 269
341 3300025912 Ga0207707_10007639 Ga0207707_100076396 269
342 3300025913 Ga0207695_10112656 Ga0207695_101126563 269
343 3300025914 Ga0207671_10000167 Ga0207671_1000016750 269
344 3300025914 Ga0207671_10166239 Ga0207671_101662392 269
345 3300025920 Ga0207649_10172190 Ga0207649_101721901 269
346 3300025932 Ga0207690_10001747 Ga0207690_100017472 269
347 3300025932 Ga0207690_10022943 Ga0207690_100229434 269
348 3300025933 Ga0207706_10142881 Ga0207706_101428812 269
349 3300025949 Ga0207667_10115210 Ga0207667_101152102 269
350 3300025981 Ga0207640_10014359 Ga0207640_100143594 269
351 3300026067 Ga0207678_10043497 Ga0207678_100434973 269
352 3300031235 Ga0265330_10000317 Ga0265330_1000031727 269
353 3300031238 Ga0265332_10001593 Ga0265332_100015932 269
354 3300031240 Ga0265320_10084474 Ga0265320_100844742 269
355 3300031241 Ga0265325_10117546 Ga0265325_101175461 269
356 3300031242 Ga0265329_10002813 Ga0265329_100028132 269
357 3300031249 Ga0265339_10043209 Ga0265339_100432092 269
358 3300031250 Ga0265331_10045614 Ga0265331_100456141 269
359 3300031344 Ga0265316_10000399 Ga0265316_1000039929 269
360 3300031711 Ga0265314_10000532 Ga0265314_1000053215 269
361 3300031712 Ga0265342_10000369 Ga0265342_1000036915 269
362 3300046615 Ga0495656_0043190 Ga0495656_0043190_492_1301 269
363 3300046691 Ga0495670_0107757 Ga0495670_0107757_190_999 269
364 3300047318 Ga0495636_0019738 Ga0495636_0019738_1803_2672 269
365 3300047318 Ga0495636_0121786 Ga0495636_0121786_248_1057 269
366 3300005335 Ga0070666_10029642 Ga0070666_100296422 270
367 3300005353 Ga0070669_100004232 Ga0070669_1000042324 270
368 3300005355 Ga0070671_100000025 Ga0070671_100000025100 270
369 3300005365 Ga0070688_100002099 Ga0070688_1000020995 270
370 3300005466 Ga0070685_10000005 Ga0070685_1000000510 270
371 3300005548 Ga0070665_100285458 Ga0070665_1002854582 270
372 3300005614 Ga0068856_100000192 Ga0068856_10000019248 270
373 3300005617 Ga0068859_100004966 Ga0068859_10000496612 270
374 3300005843 Ga0068860_100002476 Ga0068860_10000247614 270
375 3300005844 Ga0068862_100001217 Ga0068862_10000121715 270
376 3300006931 Ga0097620_100004965 Ga0097620_10000496512 270
377 3300009093 Ga0105240_10020645 Ga0105240_100206454 270
378 3300009093 Ga0105240_10022344 Ga0105240_100223444 270
379 3300009101 Ga0105247_10060326 Ga0105247_100603262 270
380 3300009553 Ga0105249_10031832 Ga0105249_100318323 270
381 3300010375 Ga0105239_10000022 Ga0105239_10000022199 270
382 3300025292 Ga0209676_1005741 Ga0209676_10057412 270
383 3300025299 Ga0209256_1009918 Ga0209256_10099183 270
384 3300025900 Ga0207710_10102399 Ga0207710_101023992 270
385 3300025913 Ga0207695_10000596 Ga0207695_100005966 270
386 3300025913 Ga0207695_10007083 Ga0207695_100070834 270
387 3300025923 Ga0207681_10005843 Ga0207681_100058436 270
388 3300025931 Ga0207644_10000049 Ga0207644_1000004974 270
389 3300025941 Ga0207711_10000393 Ga0207711_1000039315 270
390 3300026078 Ga0207702_10000113 Ga0207702_1000011342 270
391 3300026088 Ga0207641_10012294 Ga0207641_100122944 270
392 3300028380 Ga0268265_10001086 Ga0268265_100010868 270
393 3300028381 Ga0268264_10000123 Ga0268264_10000123173 270
394 3300031616 Ga0307508_10226878 Ga0307508_102268782 270
395 3300048908 Ga0496105_0000297 Ga0496105_0000297_972_1787 270
396 3300048920 Ga0496117_0032221 Ga0496117_0032221_2314_3129 270
397 3300048921 Ga0496118_0029186 Ga0496118_0029186_2517_3332 270
398 3300048921 Ga0496118_0046092 Ga0496118_0046092_1018_1833 270
399 3300048922 Ga0496119_0000150 Ga0496119_0000150_59360_60175 270
400 3300048923 Ga0496120_0006390 Ga0496120_0006390_5162_5977 270
401 3300048923 Ga0496120_0006457 Ga0496120_0006457_5093_5908 270
402 3300048924 Ga0496121_0000651 Ga0496121_0000651_58202_59017 270
403 3300048927 Ga0496124_0216497 Ga0496124_0216497_271_1089 270
404 3300048928 Ga0496125_0108391 Ga0496125_0108391_574_1392 270
405 3300048929 Ga0496126_0023236 Ga0496126_0023236_1087_1902 270
406 3300048929 Ga0496126_0049967 Ga0496126_0049967_660_1475 270
407 3300003187 JGI25151J46595_10000183 JGI25151J46595_1000018334 271
408 3300003187 JGI25151J46595_10032164 JGI25151J46595_100321641 271
409 3300003771 Ga0055526_1001709 Ga0055526_100170910 271
410 3300003771 Ga0055526_1011090 Ga0055526_10110903 271
411 3300003773 Ga0055537_1000392 Ga0055537_100039218 271
412 3300003775 Ga0055524_1006136 Ga0055524_10061363 271
413 3300003775 Ga0055524_1029241 Ga0055524_10292412 271
414 3300003781 Ga0055536_1034567 Ga0055536_10345671 271
415 3300003784 Ga0055534_1000328 Ga0055534_100032824 271
416 3300003790 Ga0055528_1000115 Ga0055528_100011541 271
417 3300003791 Ga0055530_10003425 Ga0055530_100034253 271
418 3300003794 Ga0055531_10011828 Ga0055531_100118284 271
419 3300005289 Ga0065704_10112150 Ga0065704_101121502 271
420 3300005331 Ga0070670_100000064 Ga0070670_10000006494 271
421 3300005347 Ga0070668_100102463 Ga0070668_1001024631 271
422 3300005367 Ga0070667_100000095 Ga0070667_1000000958 271
423 3300005548 Ga0070665_100151098 Ga0070665_1001510982 271
424 3300005618 Ga0068864_100000073 Ga0068864_1000000738 271
425 3300006178 Ga0075367_10032536 Ga0075367_100325364 271
426 3300009036 Ga0105244_10045735 Ga0105244_100457352 271
427 3300014325 Ga0163163_10007588 Ga0163163_100075888 271
428 3300014497 Ga0182008_10016594 Ga0182008_100165945 271
429 3300025245 Ga0207425_1006281 Ga0207425_10062812 271
430 3300025263 Ga0209565_1000014 Ga0209565_1000014335 271
431 3300025273 Ga0209673_1000623 Ga0209673_100062331 271
432 3300025273 Ga0209673_1018051 Ga0209673_10180512 271
433 3300025284 Ga0209130_1015664 Ga0209130_10156641 271
434 3300025291 Ga0209675_1000021 Ga0209675_1000021153 271
435 3300025292 Ga0209676_1000079 Ga0209676_100007923 271
436 3300025292 Ga0209676_1000891 Ga0209676_10008919 271
437 3300025292 Ga0209676_1005540 Ga0209676_10055405 271
438 3300025292 Ga0209676_1027492 Ga0209676_10274922 271
439 3300025294 Ga0209025_1000015 Ga0209025_1000015187 271
440 3300025294 Ga0209025_1007720 Ga0209025_10077206 271
441 3300025294 Ga0209025_1026333 Ga0209025_10263332 271
442 3300025295 Ga0209564_1000263 Ga0209564_100026368 271
443 3300025295 Ga0209564_1017552 Ga0209564_10175523 271
444 3300025297 Ga0209758_1040568 Ga0209758_10405682 271
445 3300025298 Ga0209050_1000153 Ga0209050_1000153144 271
446 3300025298 Ga0209050_1001146 Ga0209050_100114616 271
447 3300025299 Ga0209256_1007068 Ga0209256_10070683 271
448 3300025299 Ga0209256_1030599 Ga0209256_10305991 271
449 3300025303 Ga0209051_1001823 Ga0209051_100182313 271
450 3300025304 Ga0209257_1000081 Ga0209257_100008133 271
451 3300025304 Ga0209257_1000988 Ga0209257_100098815 271
452 3300025304 Ga0209257_1001062 Ga0209257_100106213 271
453 3300025304 Ga0209257_1001230 Ga0209257_10012304 271
454 3300025304 Ga0209257_1004325 Ga0209257_10043259 271
455 3300025304 Ga0209257_1008865 Ga0209257_10088652 271
456 3300025304 Ga0209257_1046868 Ga0209257_10468682 271
457 3300025923 Ga0207681_10176702 Ga0207681_101767022 271
458 3300025925 Ga0207650_10000106 Ga0207650_1000010692 271
459 3300025935 Ga0207709_10000805 Ga0207709_100008056 271
460 3300025972 Ga0207668_10009979 Ga0207668_100099795 271
461 3300025986 Ga0207658_10000073 Ga0207658_1000007392 271
462 3300026095 Ga0207676_10000010 Ga0207676_1000001092 271
463 3300028379 Ga0268266_10085465 Ga0268266_100854652 271
464 3300030742 Ga0316183_1103403 Ga0316183_11034034 271
465 3300030744 Ga0316181_1133242 Ga0316181_11332424 271
466 3300035398 Ga0316574_0031332 Ga0316574_0031332_732_1553 271
467 3300046522 Ga0495643_0002426 Ga0495643_0002426_12956_13813 271
468 3300047320 Ga0495672_0000308 Ga0495672_0000308_62330_63187 271
469 3300048921 Ga0496118_0000145 Ga0496118_0000145_103943_104800 271
470 3300048925 Ga0496122_0000220 Ga0496122_0000220_90727_91569 271
471 3300048926 Ga0496123_0000151 Ga0496123_0000151_35486_36328 271
472 3300048927 Ga0496124_0212936 Ga0496124_0212936_226_1083 271
473 3300053161 Ga0500634_0012485 Ga0500634_0012485_3350_4180 271
474 iso_pu_bacteria 2643221559 2643818987 271
475 iso_pu_bacteria 2643221586 2643941342 271
476 iso_pu_bacteria 2643221612 2644080413 271
477 iso_pu_bacteria 2643221727 2644697026 271
478 iso_pu_bacteria 2842391507 2842392876 271
479 iso_pu_bacteria 2939589442 2939590521 271
480 iso_pu_bacteria 2974307012 2974309435 271
481 iso_pu_bacteria 2977247770 2977250154 271
482 iso_pu_bacteria 2984514374 2984515354 271
483 iso_pu_bacteria 8003014200 8003014723 271
484 3300005336 Ga0070680_100008797 Ga0070680_1000087976 272
485 3300005458 Ga0070681_10000099 Ga0070681_1000009938 272
486 3300005458 Ga0070681_10003393 Ga0070681_100033938 272
487 3300005530 Ga0070679_100002883 Ga0070679_1000028838 272
488 3300025912 Ga0207707_10000241 Ga0207707_1000024143 272
489 3300025912 Ga0207707_10002396 Ga0207707_100023969 272
490 3300025917 Ga0207660_10001209 Ga0207660_100012092 272
491 3300025921 Ga0207652_10000531 Ga0207652_1000053112 272
492 3300048921 Ga0496118_0003292 Ga0496118_0003292_16444_17268 272
493 3300049593 Ga0501077_0155131 Ga0501077_0155131_273_1100 272
494 iso_pu_bacteria 2895511927 2895512236 272
495 iso_pu_bacteria 2895522137 2895522247 272
496 iso_pu_bacteria 2895525241 2895527310 272
497 3300005344 Ga0070661_100426693 Ga0070661_1004266932 273
498 3300005347 Ga0070668_100005796 Ga0070668_1000057962 273
499 3300005439 Ga0070711_100317931 Ga0070711_1003179311 273
500 3300005455 Ga0070663_100020053 Ga0070663_1000200534 273
501 3300005539 Ga0068853_100135468 Ga0068853_1001354683 273
502 3300005548 Ga0070665_100000285 Ga0070665_1000002857 273
503 3300005548 Ga0070665_100036667 Ga0070665_1000366674 273
504 3300005563 Ga0068855_100297662 Ga0068855_1002976622 273
505 3300005614 Ga0068856_100010797 Ga0068856_10001079710 273
506 3300005616 Ga0068852_100134308 Ga0068852_1001343082 273
507 3300005617 Ga0068859_100007853 Ga0068859_1000078539 273
508 3300005618 Ga0068864_100327733 Ga0068864_1003277332 273
509 3300005618 Ga0068864_100358312 Ga0068864_1003583122 273
510 3300005719 Ga0068861_100149025 Ga0068861_1001490252 273
511 3300005841 Ga0068863_100462055 Ga0068863_1004620551 273
512 3300005842 Ga0068858_100048477 Ga0068858_1000484777 273
513 3300005842 Ga0068858_100729912 Ga0068858_1007299122 273
514 3300005844 Ga0068862_100000164 Ga0068862_10000016462 273
515 3300005983 Ga0081540_1000823 Ga0081540_10008239 273
516 3300006237 Ga0097621_100065104 Ga0097621_1000651043 273
517 3300006237 Ga0097621_100092851 Ga0097621_1000928512 273
518 3300006931 Ga0097620_100007853 Ga0097620_1000078539 273
519 3300009093 Ga0105240_10987848 Ga0105240_109878481 273
520 3300009545 Ga0105237_10075983 Ga0105237_100759832 273
521 3300013296 Ga0157374_10149793 Ga0157374_101497933 273
522 3300013297 Ga0157378_10012011 Ga0157378_100120116 273
523 3300013297 Ga0157378_10015193 Ga0157378_100151932 273
524 3300013307 Ga0157372_10041904 Ga0157372_100419044 273
525 3300014969 Ga0157376_10070100 Ga0157376_100701003 273
526 3300025907 Ga0207645_10052879 Ga0207645_100528793 273
527 3300025913 Ga0207695_10052748 Ga0207695_100527485 273
528 3300025924 Ga0207694_10009855 Ga0207694_100098555 273
529 3300025925 Ga0207650_10021772 Ga0207650_100217724 273
530 3300025925 Ga0207650_10092200 Ga0207650_100922003 273
531 3300025938 Ga0207704_10303543 Ga0207704_103035432 273
532 3300025938 Ga0207704_10513899 Ga0207704_105138991 273
533 3300025940 Ga0207691_10043709 Ga0207691_100437093 273
534 3300025972 Ga0207668_10137899 Ga0207668_101378992 273
535 3300025972 Ga0207668_10232722 Ga0207668_102327222 273
536 3300026023 Ga0207677_10006752 Ga0207677_100067522 273
537 3300026035 Ga0207703_10001707 Ga0207703_1000170717 273
538 3300026041 Ga0207639_10045687 Ga0207639_100456872 273
539 3300026067 Ga0207678_10035254 Ga0207678_100352544 273
540 3300026088 Ga0207641_10443625 Ga0207641_104436252 273
541 3300026095 Ga0207676_10021103 Ga0207676_100211033 273
542 3300026118 Ga0207675_100177489 Ga0207675_1001774892 273
543 3300026142 Ga0207698_10110812 Ga0207698_101108122 273
544 3300026142 Ga0207698_10309589 Ga0207698_103095891 273
545 3300028379 Ga0268266_10000006 Ga0268266_100000061216 273
546 3300028379 Ga0268266_10127989 Ga0268266_101279892 273
547 3300028380 Ga0268265_10000186 Ga0268265_1000018661 273
548 3300031507 Ga0307509_10071672 Ga0307509_100716723 273
549 3300033179 Ga0307507_10069788 Ga0307507_100697883 273
550 3300046694 Ga0495649_0052193 Ga0495649_0052193_1076_1903 273
551 3300049568 Ga0501031_0084313 Ga0501031_0084313_1056_1883 273
552 3300049571 Ga0501034_0061627 Ga0501034_0061627_1494_2321 273
553 3300049571 Ga0501034_0091816 Ga0501034_0091816_1446_2273 273
554 3300049574 Ga0501038_0026746 Ga0501038_0026746_2695_3522 273
555 3300049578 Ga0501042_0109683 Ga0501042_0109683_880_1707 273
556 3300049579 Ga0501043_0158648 Ga0501043_0158648_419_1246 273
557 3300049580 Ga0501046_0059916 Ga0501046_0059916_292_1119 273
558 3300049581 Ga0501047_0262809 Ga0501047_0262809_589_1419 273
559 3300049582 Ga0501048_0101533 Ga0501048_0101533_1114_1944 273
560 3300049583 Ga0501067_0131219 Ga0501067_0131219_299_1126 273
561 3300049584 Ga0501068_0010971 Ga0501068_0010971_747_1574 273
562 3300049585 Ga0501069_0046954 Ga0501069_0046954_184_1014 273
563 3300049586 Ga0501070_0083368 Ga0501070_0083368_1291_2118 273
564 3300049587 Ga0501071_0057860 Ga0501071_0057860_853_1680 273
565 3300049588 Ga0501072_0168734 Ga0501072_0168734_897_1724 273
566 3300049589 Ga0501073_0016619 Ga0501073_0016619_2776_3603 273
567 3300049589 Ga0501073_0048484 Ga0501073_0048484_373_1203 273
568 3300049589 Ga0501073_0078093 Ga0501073_0078093_278_1108 273
569 3300049741 Ga0501079_0046049 Ga0501079_0046049_1229_2056 273
570 3300049742 Ga0501080_0029396 Ga0501080_0029396_2232_3059 273
571 3300049743 Ga0501081_0046086 Ga0501081_0046086_1164_1991 273
572 3300049823 Ga0501044_0057599 Ga0501044_0057599_2302_3129 273
573 3300049823 Ga0501044_0257845 Ga0501044_0257845_328_1155 273
574 3300049824 Ga0501045_0023664 Ga0501045_0023664_1916_2743 273
575 3300053093 Ga0500651_0000461 Ga0500651_0000461_1488_2312 273
576 3300054114 Ga0501084_0133685 Ga0501084_0133685_1079_1909 273
577 3300060353 Ga0501082_0007415 Ga0501082_0007415_698_1528 273
578 3300060353 Ga0501082_0089973 Ga0501082_0089973_1211_2038 273
579 3300049568 Ga0501031_0042417 Ga0501031_0042417_1873_2784 274
580 3300005336 Ga0070680_100507803 Ga0070680_1005078031 277
581 3300005339 Ga0070660_100013179 Ga0070660_1000131795 277
582 3300013102 Ga0157371_10025417 Ga0157371_100254172 277
583 3300013104 Ga0157370_10105988 Ga0157370_101059881 277
584 3300013105 Ga0157369_10041103 Ga0157369_100411035 277
585 3300013307 Ga0157372_10015442 Ga0157372_100154427 277
586 3300025909 Ga0207705_10078739 Ga0207705_100787392 277
587 3300025919 Ga0207657_10042170 Ga0207657_100421704 277
588 3300025932 Ga0207690_10139243 Ga0207690_101392432 277
589 3300005466 Ga0070685_10000377 Ga0070685_1000037720 280
590 3300005616 Ga0068852_100056273 Ga0068852_1000562732 280
591 3300005842 Ga0068858_100443937 Ga0068858_1004439372 280
592 3300009093 Ga0105240_10016289 Ga0105240_100162896 280
593 3300009545 Ga0105237_10045573 Ga0105237_100455732 280
594 3300009551 Ga0105238_10001019 Ga0105238_1000101926 280
595 3300010375 Ga0105239_10472115 Ga0105239_104721152 280
596 3300013307 Ga0157372_10108396 Ga0157372_101083962 280
597 3300025261 Ga0209233_1001186 Ga0209233_10011864 280
598 3300025913 Ga0207695_10000033 Ga0207695_10000033416 280
599 3300025924 Ga0207694_10000417 Ga0207694_1000041724 280
600 3300026035 Ga0207703_10413370 Ga0207703_104133702 280
601 3300026142 Ga0207698_10094523 Ga0207698_100945232 280
602 3300048906 Ga0496103_0166498 Ga0496103_0166498_219_1061 280
603 3300048921 Ga0496118_0016769 Ga0496118_0016769_1500_2342 280
604 3300001904 JGI24736J21556_1014601 JGI24736J21556_10146012 282
605 3300005335 Ga0070666_10004389 Ga0070666_100043899 282
606 3300005338 Ga0068868_100011542 Ga0068868_1000115429 282
607 3300005455 Ga0070663_100012441 Ga0070663_1000124418 282
608 3300005578 Ga0068854_100022759 Ga0068854_1000227593 282
609 3300005616 Ga0068852_100079577 Ga0068852_1000795773 282
610 3300010375 Ga0105239_10458597 Ga0105239_104585971 282
611 3300014325 Ga0163163_10341485 Ga0163163_103414852 282
612 3300025321 Ga0207656_10000993 Ga0207656_100009939 282
613 3300025903 Ga0207680_10028614 Ga0207680_100286145 282
614 3300025904 Ga0207647_10000060 Ga0207647_1000006021 282
615 3300025914 Ga0207671_10028714 Ga0207671_100287142 282
616 3300025920 Ga0207649_10031404 Ga0207649_100314047 282
617 3300025961 Ga0207712_10000447 Ga0207712_1000044727 282
618 3300025981 Ga0207640_10002178 Ga0207640_1000217811 282
619 3300026067 Ga0207678_10010442 Ga0207678_100104424 282

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

75

231

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9272 32 264
4yms-assembly1.cif.gz_A crystal structure of an amino acid abc transporter 0.9241 36 279
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.923 32 264
7ch8-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with adp-v 0.9219 33 280
8fee-assembly1.cif.gz_H structure of mce1 transporter from mycobacterium smegmatis in the absence of lucb (map2) 0.9215 36 282
ID Description Score Start End Superfamily
af_Q2FYQ0_38_279_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9874 37 277 3.40.50.300
af_Q2FYQ0_38_279_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9794 37 277 3.40.50.300
af_P9WQK9_23_275_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9739 38 280 3.40.50.300
af_Q58762_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9338 36 277 3.40.50.300
af_P9WQK9_23_275_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9287 38 280 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2S8F541-F1-model_v4 Phosphate ABC transporter ATP-binding protein 0.9858 33 282 GO:0005524
GO:0005886
GO:0015415
GO:0016887
GO:0035435
AF-A0A7U9C389-F1-model_v4 Phosphate import ATP-binding protein pstB 2 0.9848 33 282 GO:0005315
GO:0005524
GO:0016020
GO:0016887
GO:0035435
AF-A0A7J3HNY0-F1-model_v4 Phosphate ABC transporter ATP-binding protein 0.9843 33 282 GO:0005524
GO:0015415
GO:0016020
GO:0016887
GO:0035435
AF-A0A0U2ZM53-F1-model_v4 Phosphate ABC transporter ATP-binding protein 0.9827 34 282 GO:0005524
GO:0005886
GO:0015415
GO:0016887
GO:0035435
AF-A0A1F7BME5-F1-model_v4 Phosphate ABC transporter ATP-binding protein 0.9816 32 282 GO:0005524
GO:0015415
GO:0016020
GO:0016887
GO:0035435

Feature Viewer

pLDDT pTM Quality
87.25 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map