F469725

General Info

Members Datasets Scaffolds Average Seq Length
618 285 617 347

Family's Representative Sequence

Representative Sequence 3300009036|Ga0105244_10055981|Ga0105244_100559811
Length 385
Sequence VGRVLAQLALQQGTVYDIGRFTSARFGGVAERVGFVSELEGRVSSSIVDRLADQGSGPVLGAEGYVFELERRGYIKAGPFVPEVVLDYPDAVRELHREFLRAGADVMVALTYYAHREKLRDVGREGDLEAMNRQAVRLAREVASEGDALVAGNVCNTWAYDPDDPATGQTVRAMYTEQLGWAVEEGVDFVISETNDYLGEALIAVEVIRDLGLPAMVTLAPTQPDQTRDGYGYAEACRILAAEGAQVVGLNCDRGPLTMLPLVADIRQAVDCAVAVQPVPYRTDAAAPTMETLRSADGDRAFPIALDSFTCTRFEMAQFAAQARELGVDYVGICCGAGPHHVRAMAEALGREVPASKYSPSMDLHPMFRADVAAKDAAFLHSWSA

Samples

Sample ID Description Type Environment
1 2734482000 Kineosporia rhizophila JCM 9960 Isolate Unclassified
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
67 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
86 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
89 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
131 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
132 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
133 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
134 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
135 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
136 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
137 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
138 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
139 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
140 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
141 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
142 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
143 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
144 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
145 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
146 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
147 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
148 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
149 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
150 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
151 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
156 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
157 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
158 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
159 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
160 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
161 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
162 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
163 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
164 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
166 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
167 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
168 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
169 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
170 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
171 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
172 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
173 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
174 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
175 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
176 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
177 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
178 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
180 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
183 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
184 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
187 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
188 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
189 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
190 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
191 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
192 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
193 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
194 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
195 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
196 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
197 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
198 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
199 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
200 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
201 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
202 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
203 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
204 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
205 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
206 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
207 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
208 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
209 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
210 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
211 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
212 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
213 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
214 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
215 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
216 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
217 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
218 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
219 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
220 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
221 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
222 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
223 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
224 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
225 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
226 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
227 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
228 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
229 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
230 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
231 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
232 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
233 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
234 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
235 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
236 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
237 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
238 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
239 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
240 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
241 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
242 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
243 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
244 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
245 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
246 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
247 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
248 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
249 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
250 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
251 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
252 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
253 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
254 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
255 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
256 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
257 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
258 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
259 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
260 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
261 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
262 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
263 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
264 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
265 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
266 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
267 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
268 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
269 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
270 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
271 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
273 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
274 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
275 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
276 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
277 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
278 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
279 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
280 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
281 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
282 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
283 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
284 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
285 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.84
Metatranscriptomes 0
Isolates 0.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.65
Nodule 0
Rhizoplane 11.65
Rhizosphere 84.14
Stem 0
Stem Tuber 0
Unclassified 3.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10005468 3300003659 Bacteria 2625
2 JGI25404J52841_10024711 3300003659 Bacteria 1294
3 Ga0070683_100095733 3300005329 Bacteria 2792
4 Ga0068869_100167926 3300005334 Bacteria 1712
5 Ga0070682_100028659 3300005337 Bacteria 3350
6 Ga0070682_100096773 3300005337 Bacteria 1941
7 Ga0070682_100098893 3300005337 Bacteria 1923
8 Ga0068868_100068682 3300005338 Bacteria 2822
9 Ga0070660_100079315 3300005339 Bacteria 2576
10 Ga0070689_100062161 3300005340 Bacteria 2905
11 Ga0070668_100054139 3300005347 Bacteria 3095
12 Ga0070675_100074003 3300005354 Unclassified 2829
13 Ga0070671_100066715 3300005355 Unclassified 2999
14 Ga0070674_100249688 3300005356 Bacteria 1393
15 Ga0070659_100102539 3300005366 Bacteria 2304
16 Ga0070667_100263835 3300005367 Unclassified 1543
17 Ga0070709_10001054 3300005434 Bacteria 15212
18 Ga0070709_10035032 3300005434 Bacteria 3048
19 Ga0070714_100003000 3300005435 Bacteria 12514
20 Ga0070714_100017113 3300005435 Bacteria 5869
21 Ga0070714_100058482 3300005435 Bacteria 3303
22 Ga0070713_100004246 3300005436 Bacteria 9579
23 Ga0070713_100120281 3300005436 Bacteria 2302
24 Ga0070713_100205290 3300005436 Bacteria 1781
25 Ga0070710_10002866 3300005437 Bacteria 8210
26 Ga0070710_10007980 3300005437 Bacteria 5148
27 Ga0070710_10056320 3300005437 Bacteria 2224
28 Ga0070711_100002119 3300005439 Bacteria 11234
29 Ga0070694_100139907 3300005444 Unclassified 1757
30 Ga0070708_100004332 3300005445 Bacteria 11147
31 Ga0070708_100010622 3300005445 Bacteria 7464
32 Ga0070708_100022016 3300005445 Bacteria 5402
33 Ga0070708_100073307 3300005445 Bacteria 3085
34 Ga0070708_100269466 3300005445 Bacteria 1601
35 Ga0070663_100040425 3300005455 Bacteria 3264
36 Ga0070681_10095741 3300005458 Bacteria 2917
37 Ga0070681_10170089 3300005458 Bacteria 2101
38 Ga0068867_100144473 3300005459 Bacteria 1863
39 Ga0070685_10148840 3300005466 Unclassified 1482
40 Ga0070685_10195136 3300005466 Bacteria 1313
41 Ga0070706_100003350 3300005467 Bacteria 15807
42 Ga0070706_100007331 3300005467 Bacteria 10347
43 Ga0070706_100008557 3300005467 Bacteria 9536
44 Ga0070706_100011810 3300005467 Bacteria 8108
45 Ga0070706_100041687 3300005467 Bacteria 4239
46 Ga0070706_100045756 3300005467 Bacteria 4041
47 Ga0070706_100058586 3300005467 Bacteria 3554
48 Ga0070706_100231663 3300005467 Bacteria 1724
49 Ga0070706_100232364 3300005467 Bacteria 1721
50 Ga0070707_100001852 3300005468 Bacteria 20316
51 Ga0070707_100013680 3300005468 Bacteria 7597
52 Ga0070707_100014484 3300005468 Bacteria 7390
53 Ga0070707_100017961 3300005468 Bacteria 6651
54 Ga0070707_100025995 3300005468 Bacteria 5556
55 Ga0070707_100041084 3300005468 Unclassified 4426
56 Ga0070707_100213725 3300005468 Unclassified 1879
57 Ga0070707_100229568 3300005468 Bacteria 1807
58 Ga0070698_100001492 3300005471 Bacteria 25989
59 Ga0070698_100002646 3300005471 Bacteria 19744
60 Ga0070698_100004059 3300005471 Bacteria 16101
61 Ga0070698_100004413 3300005471 Bacteria 15458
62 Ga0070698_100030848 3300005471 Bacteria 5558
63 Ga0070698_100052130 3300005471 Unclassified 4164
64 Ga0070698_100056549 3300005471 Bacteria 3975
65 Ga0070698_100060077 3300005471 Bacteria 3836
66 Ga0070698_100091738 3300005471 Bacteria 3020
67 Ga0070698_100100625 3300005471 Unclassified 2863
68 Ga0070698_100109975 3300005471 Bacteria 2722
69 Ga0070698_100250635 3300005471 Bacteria 1703
70 Ga0070698_100274950 3300005471 Bacteria 1616
71 Ga0070699_100001142 3300005518 Bacteria 24670
72 Ga0070699_100006327 3300005518 Bacteria 10325
73 Ga0070699_100048972 3300005518 Unclassified 3657
74 Ga0070699_100105945 3300005518 Bacteria 2466
75 Ga0070699_100115633 3300005518 Bacteria 2357
76 Ga0070699_100197415 3300005518 Unclassified 1789
77 Ga0070679_100017896 3300005530 Bacteria 6864
78 Ga0070679_100154814 3300005530 Bacteria 2267
79 Ga0070684_100024436 3300005535 Bacteria 5070
80 Ga0070684_100028797 3300005535 Bacteria 4700
81 Ga0070697_100001890 3300005536 Bacteria 16009
82 Ga0070697_100010665 3300005536 Bacteria 7172
83 Ga0070697_100017641 3300005536 Bacteria 5622
84 Ga0070697_100026241 3300005536 Bacteria 4652
85 Ga0070697_100030377 3300005536 Bacteria 4340
86 Ga0068853_100270137 3300005539 Bacteria 1566
87 Ga0070686_100081314 3300005544 Bacteria 2146
88 Ga0070696_100150923 3300005546 Bacteria 1705
89 Ga0070665_100093063 3300005548 Bacteria 3019
90 Ga0068855_100013363 3300005563 Bacteria 9903
91 Ga0070664_100309565 3300005564 Bacteria 1429
92 Ga0068857_100060392 3300005577 Bacteria 3367
93 Ga0068854_100201303 3300005578 Bacteria 1565
94 Ga0068856_100061143 3300005614 Bacteria 3721
95 Ga0070702_100030189 3300005615 Bacteria 2953
96 Ga0070702_100032016 3300005615 Bacteria 2883
97 Ga0068852_100197413 3300005616 Bacteria 1902
98 Ga0068864_100152712 3300005618 Bacteria 2093
99 Ga0068861_100007858 3300005719 Bacteria 7336
100 Ga0068861_100116486 3300005719 Bacteria 2149
101 Ga0068861_100178963 3300005719 Bacteria 1763
102 Ga0068851_10087552 3300005834 Bacteria 1635
103 Ga0068863_100057463 3300005841 Bacteria 3682
104 Ga0068863_100140366 3300005841 Bacteria 2309
105 Ga0068858_100128251 3300005842 Bacteria 2377
106 Ga0068860_100171855 3300005843 Bacteria 2093
107 Ga0068860_100261356 3300005843 Bacteria 1687
108 Ga0081455_10037377 3300005937 Bacteria 4313
109 Ga0081455_10069868 3300005937 Bacteria 2918
110 Ga0081455_10138099 3300005937 Bacteria 1896
111 Ga0081538_10102674 3300005981 Bacteria 1433
112 Ga0081540_1000251 3300005983 Bacteria 56572
113 Ga0081540_1004475 3300005983 Bacteria 10637
114 Ga0081540_1014769 3300005983 Bacteria 4979
115 Ga0081539_10002380 3300005985 Bacteria 26874
116 Ga0081539_10004254 3300005985 Bacteria 16066
117 Ga0081539_10012438 3300005985 Bacteria 6561
118 Ga0081539_10015847 3300005985 Bacteria 5438
119 Ga0081539_10051188 3300005985 Bacteria 2330
120 Ga0070717_10011712 3300006028 Bacteria 6671
121 Ga0070717_10016279 3300006028 Bacteria 5763
122 Ga0070717_10016411 3300006028 Bacteria 5739
123 Ga0070717_10034398 3300006028 Unclassified 4096
124 Ga0070717_10044572 3300006028 Bacteria 3623
125 Ga0070717_10112880 3300006028 Unclassified 2320
126 Ga0070717_10249911 3300006028 Bacteria 1566
127 Ga0070717_10408504 3300006028 Unclassified 1220
128 Ga0070715_10033471 3300006163 Bacteria 2100
129 Ga0070715_10047211 3300006163 Bacteria 1834
130 Ga0070715_10079234 3300006163 Bacteria 1487
131 Ga0070716_100008672 3300006173 Bacteria 5050
132 Ga0070716_100078426 3300006173 Unclassified 1964
133 Ga0070716_100081721 3300006173 Bacteria 1930
134 Ga0070716_100113164 3300006173 Bacteria 1685
135 Ga0070716_100122611 3300006173 Bacteria 1630
136 Ga0070712_100007917 3300006175 Bacteria 6662
137 Ga0070712_100023366 3300006175 Bacteria 4083
138 Ga0070712_100283054 3300006175 Bacteria 1336
139 Ga0097621_100038113 3300006237 Bacteria 3856
140 Ga0068871_100080604 3300006358 Bacteria 2695
141 Ga0068871_100285509 3300006358 Bacteria 1445
142 Ga0075431_100261425 3300006847 Bacteria 1756
143 Ga0075433_10058299 3300006852 Bacteria 3377
144 Ga0075433_10137835 3300006852 Bacteria 2169
145 Ga0075434_100003966 3300006871 Bacteria 13258
146 Ga0075434_100081895 3300006871 Bacteria 3224
147 Ga0075434_100132291 3300006871 Bacteria 2514
148 Ga0075436_100004661 3300006914 Bacteria 9395
149 Ga0075436_100010988 3300006914 Bacteria 6216
150 Ga0075435_100004546 3300007076 Bacteria 9541
151 Ga0075435_100047059 3300007076 Bacteria 3462
152 Ga0075435_100074095 3300007076 Bacteria 2784
153 Ga0075435_100151377 3300007076 Bacteria 1951
154 Ga0099794_10077202 3300007265 Bacteria 1638
155 Ga0105251_10014638 3300009011 Bacteria 4325
156 Ga0105244_10055981 3300009036 Bacteria 1997
157 Ga0111539_10002081 3300009094 Bacteria 26737
158 Ga0111539_10062238 3300009094 Bacteria 4418
159 Ga0111539_10437488 3300009094 Bacteria 1523
160 Ga0105247_10103407 3300009101 Bacteria 1824
161 Ga0105247_10147362 3300009101 Unclassified 1548
162 Ga0114129_10013858 3300009147 Bacteria 11487
163 Ga0114129_10468521 3300009147 Unclassified 1650
164 Ga0105243_10005512 3300009148 Bacteria 9865
165 Ga0105248_10079472 3300009177 Bacteria 3686
166 Ga0105248_10158614 3300009177 Unclassified 2553
167 Ga0105249_10137445 3300009553 Bacteria 2340
168 Ga0105246_10015359 3300011119 Bacteria 4835
169 Ga0105246_10059406 3300011119 Unclassified 2652
170 Ga0157371_10043493 3300013102 Bacteria 3199
171 Ga0157369_10070048 3300013105 Bacteria 3768
172 Ga0157378_10461414 3300013297 Bacteria 1262
173 Ga0163162_10050417 3300013306 Bacteria 4174
174 Ga0163162_10128984 3300013306 Bacteria 2637
175 Ga0157372_10173121 3300013307 Bacteria 2498
176 Ga0157375_10128142 3300013308 Bacteria 2656
177 Ga0157375_10661536 3300013308 Bacteria 1200
178 Ga0163163_10012499 3300014325 Bacteria 7738
179 Ga0163163_10098472 3300014325 Bacteria 2945
180 Ga0163163_10352754 3300014325 Bacteria 1527
181 Ga0157380_10086384 3300014326 Unclassified 2577
182 Ga0157379_10109260 3300014968 Bacteria 2483
183 Ga0157376_10122454 3300014969 Bacteria 2308
184 Ga0157376_10152166 3300014969 Bacteria 2087
185 Ga0213873_10035523 3300021358 Unclassified 1261
186 Ga0213874_10006597 3300021377 Bacteria 2752
187 Ga0213876_10006736 3300021384 Bacteria 6273
188 Ga0213875_10000148 3300021388 Bacteria 74125
189 Ga0213875_10011400 3300021388 Unclassified 4422
190 Ga0224572_1012925 3300024225 Unclassified 1591
191 Ga0207692_10002566 3300025898 Bacteria 6982
192 Ga0207692_10005594 3300025898 Bacteria 5045
193 Ga0207692_10029937 3300025898 Bacteria 2592
194 Ga0207692_10061454 3300025898 Bacteria 1947
195 Ga0207710_10046161 3300025900 Bacteria 1945
196 Ga0207688_10013767 3300025901 Bacteria 4396
197 Ga0207688_10116445 3300025901 Unclassified 1556
198 Ga0207647_10000879 3300025904 Bacteria 23320
199 Ga0207647_10040693 3300025904 Bacteria 2926
200 Ga0207685_10000657 3300025905 Bacteria 6151
201 Ga0207685_10006692 3300025905 Bacteria 3159
202 Ga0207699_10000629 3300025906 Bacteria 17043
203 Ga0207699_10006768 3300025906 Bacteria 5570
204 Ga0207699_10017329 3300025906 Bacteria 3787
205 Ga0207699_10031377 3300025906 Unclassified 2983
206 Ga0207699_10046549 3300025906 Bacteria 2538
207 Ga0207699_10084631 3300025906 Bacteria 1976
208 Ga0207645_10233683 3300025907 Bacteria 1214
209 Ga0207643_10011015 3300025908 Bacteria 4880
210 Ga0207643_10012839 3300025908 Bacteria 4528
211 Ga0207684_10000253 3300025910 Bacteria 79773
212 Ga0207684_10001497 3300025910 Bacteria 25099
213 Ga0207684_10003148 3300025910 Bacteria 16236
214 Ga0207684_10007382 3300025910 Bacteria 9907
215 Ga0207684_10019275 3300025910 Bacteria 5837
216 Ga0207684_10039551 3300025910 Bacteria 3999
217 Ga0207684_10039865 3300025910 Bacteria 3982
218 Ga0207684_10084566 3300025910 Bacteria 2702
219 Ga0207684_10161225 3300025910 Bacteria 1931
220 Ga0207684_10205637 3300025910 Unclassified 1698
221 Ga0207684_10221831 3300025910 Bacteria 1631
222 Ga0207684_10431869 3300025910 Bacteria 1131
223 Ga0207693_10009218 3300025915 Bacteria 8057
224 Ga0207693_10075655 3300025915 Bacteria 2637
225 Ga0207663_10003613 3300025916 Bacteria 7594
226 Ga0207663_10016926 3300025916 Unclassified 4053
227 Ga0207663_10082005 3300025916 Unclassified 2114
228 Ga0207663_10089920 3300025916 Bacteria 2034
229 Ga0207657_10059413 3300025919 Unclassified 3285
230 Ga0207652_10002441 3300025921 Bacteria 15700
231 Ga0207646_10001473 3300025922 Bacteria 29119
232 Ga0207646_10002713 3300025922 Bacteria 20752
233 Ga0207646_10002949 3300025922 Bacteria 19708
234 Ga0207646_10007561 3300025922 Bacteria 11014
235 Ga0207646_10016968 3300025922 Bacteria 6823
236 Ga0207646_10039287 3300025922 Unclassified 4259
237 Ga0207646_10060949 3300025922 Bacteria 3368
238 Ga0207646_10084322 3300025922 Bacteria 2843
239 Ga0207646_10120187 3300025922 Bacteria 2360
240 Ga0207646_10121481 3300025922 Bacteria 2347
241 Ga0207646_10320933 3300025922 Unclassified 1400
242 Ga0207646_10422108 3300025922 Bacteria 1204
243 Ga0207659_10092465 3300025926 Bacteria 2262
244 Ga0207687_10015600 3300025927 Bacteria 4984
245 Ga0207687_10047199 3300025927 Bacteria 2985
246 Ga0207700_10001515 3300025928 Bacteria 13161
247 Ga0207700_10002599 3300025928 Bacteria 10386
248 Ga0207700_10010060 3300025928 Bacteria 5945
249 Ga0207700_10015276 3300025928 Bacteria 5057
250 Ga0207700_10048048 3300025928 Bacteria 3166
251 Ga0207700_10062428 3300025928 Bacteria 2830
252 Ga0207700_10108935 3300025928 Bacteria 2225
253 Ga0207700_10132655 3300025928 Unclassified 2036
254 Ga0207700_10224320 3300025928 Bacteria 1595
255 Ga0207664_10000725 3300025929 Bacteria 22432
256 Ga0207664_10030230 3300025929 Bacteria 4136
257 Ga0207664_10031034 3300025929 Bacteria 4085
258 Ga0207664_10042027 3300025929 Bacteria 3565
259 Ga0207664_10079766 3300025929 Bacteria 2658
260 Ga0207644_10110735 3300025931 Bacteria 2076
261 Ga0207644_10289002 3300025931 Bacteria 1318
262 Ga0207706_10303099 3300025933 Bacteria 1392
263 Ga0207670_10041944 3300025936 Bacteria 3012
264 Ga0207665_10014440 3300025939 Bacteria 5202
265 Ga0207665_10109103 3300025939 Unclassified 1942
266 Ga0207665_10129287 3300025939 Unclassified 1791
267 Ga0207665_10132085 3300025939 Unclassified 1774
268 Ga0207665_10134025 3300025939 Bacteria 1761
269 Ga0207689_10005636 3300025942 Bacteria 11157
270 Ga0207689_10163691 3300025942 Bacteria 1833
271 Ga0207689_10340119 3300025942 Unclassified 1246
272 Ga0207661_10104916 3300025944 Bacteria 2381
273 Ga0207679_10187880 3300025945 Bacteria 1715
274 Ga0207679_10324153 3300025945 Bacteria 1335
275 Ga0207667_10024494 3300025949 Bacteria 6625
276 Ga0207712_10039804 3300025961 Bacteria 3222
277 Ga0207712_10087859 3300025961 Bacteria 2281
278 Ga0207668_10086767 3300025972 Bacteria 2287
279 Ga0207640_10029853 3300025981 Unclassified 3352
280 Ga0207677_10048749 3300026023 Bacteria 2853
281 Ga0207639_10254992 3300026041 Bacteria 1531
282 Ga0207678_10009825 3300026067 Bacteria 8409
283 Ga0207678_10066656 3300026067 Bacteria 3091
284 Ga0207708_10237008 3300026075 Unclassified 1466
285 Ga0207702_10024493 3300026078 Bacteria 5008
286 Ga0207702_10084537 3300026078 Unclassified 2763
287 Ga0207702_10328845 3300026078 Bacteria 1457
288 Ga0207648_10173445 3300026089 Bacteria 1907
289 Ga0207676_10078187 3300026095 Unclassified 2679
290 Ga0207676_10176511 3300026095 Unclassified 1866
291 Ga0207676_10209801 3300026095 Bacteria 1727
292 Ga0207674_10028952 3300026116 Bacteria 5839
293 Ga0207674_10059235 3300026116 Bacteria 3876
294 Ga0207675_100024791 3300026118 Bacteria 5581
295 Ga0207675_100070897 3300026118 Bacteria 3257
296 Ga0207675_100110851 3300026118 Unclassified 2589
297 Ga0207675_100194670 3300026118 Bacteria 1946
298 Ga0207683_10001205 3300026121 Bacteria 23426
299 Ga0207683_10200222 3300026121 Unclassified 1815
300 Ga0207683_10456894 3300026121 Bacteria 1178
301 Ga0268265_10437206 3300028380 Bacteria 1219
302 Ga0265337_1004147 3300028556 Bacteria 6083
303 Ga0265326_10000783 3300028558 Bacteria 11762
304 Ga0265319_1003966 3300028563 Bacteria 7511
305 Ga0265334_10006877 3300028573 Bacteria 4885
306 Ga0265318_10033684 3300028577 Bacteria 1976
307 Ga0265323_10009561 3300028653 Unclassified 3954
308 Ga0265336_10008948 3300028666 Unclassified 3485
309 Ga0265338_10000757 3300028800 Bacteria 55097
310 Ga0265338_10007876 3300028800 Bacteria 13078
311 Ga0265338_10024806 3300028800 Bacteria 6110
312 Ga0265338_10029061 3300028800 Bacteria 5493
313 Ga0265324_10003374 3300029957 Bacteria 7635
314 Ga0265332_10003276 3300031238 Bacteria 7868
315 Ga0265320_10011675 3300031240 Bacteria 5157
316 Ga0265340_10009819 3300031247 Bacteria 5127
317 Ga0265339_10018769 3300031249 Bacteria 4072
318 Ga0265316_10075726 3300031344 Unclassified 2587
319 Ga0307513_10000126 3300031456 Bacteria 107665
320 Ga0265313_10033113 3300031595 Unclassified 2630
321 Ga0316575_10003459 3300031665 Bacteria 5449
322 Ga0316575_10009596 3300031665 Bacteria 3544
323 Ga0316575_10031507 3300031665 Bacteria 2076
324 Ga0265314_10012190 3300031711 Bacteria 7040
325 Ga0265342_10020260 3300031712 Unclassified 4270
326 Ga0316576_10010262 3300031727 Bacteria 6077
327 Ga0316576_10021225 3300031727 Bacteria 4487
328 Ga0316576_10176509 3300031727 Bacteria 1612
329 Ga0316576_10238119 3300031727 Unclassified 1368
330 Ga0316578_10000196 3300031728 Bacteria 17119
331 Ga0316578_10023814 3300031728 Bacteria 3430
332 Ga0316578_10122628 3300031728 Unclassified 1563
333 Ga0316577_10000247 3300031733 Bacteria 18981
334 Ga0316577_10007595 3300031733 Bacteria 5785
335 Ga0307410_10079657 3300031852 Bacteria 2296
336 Ga0307409_100224880 3300031995 Bacteria 1697
337 Ga0307415_100057494 3300032126 Bacteria 2673
338 Ga0316583_10009154 3300032133 Bacteria 3572
339 Ga0316585_10053199 3300032137 Bacteria 1301
340 Ga0316580_10000271 3300032139 Bacteria 11105
341 Ga0373950_0003976 3300034818 Bacteria 2149
342 Ga0373959_0017991 3300034820 Bacteria 1325
343 Ga0373934_0004401 3300035086 Bacteria 5204
344 Ga0373934_0006948 3300035086 Bacteria 4200
345 Ga0373940_0038640 3300035088 Bacteria 1303
346 Ga0373944_0001319 3300035089 Bacteria 6238
347 Ga0373952_0003338 3300035092 Unclassified 2893
348 Ga0373923_0000311 3300035111 Bacteria 10843
349 Ga0373923_0001290 3300035111 Bacteria 7074
350 Ga0373932_0012708 3300035112 Bacteria 2079
351 Ga0373932_0015256 3300035112 Unclassified 1946
352 Ga0373945_0003956 3300035116 Bacteria 4686
353 Ga0373953_0003403 3300035117 Bacteria 4947
354 Ga0373953_0003923 3300035117 Bacteria 4688
355 Ga0373953_0022080 3300035117 Bacteria 2396
356 Ga0373954_0031087 3300035118 Bacteria 2463
357 Ga0373954_0033057 3300035118 Bacteria 2393
358 Ga0373956_0000076 3300035119 Bacteria 32516
359 Ga0373957_0000009 3300035120 Bacteria 50764
360 Ga0373957_0001254 3300035120 Bacteria 6793
361 Ga0373960_0067507 3300035121 Bacteria 1099
362 Ga0373943_0004905 3300035170 Bacteria 6044
363 Ga0373943_0026142 3300035170 Bacteria 2733
364 Ga0373946_0035440 3300035171 Bacteria 2019
365 Ga0373955_0000014 3300035172 Bacteria 72349
366 Ga0373942_0036599 3300035207 Bacteria 1323
367 Ga0316574_0000335 3300035398 Bacteria 18134
368 Ga0316574_0073321 3300035398 Bacteria 2164
369 Ga0316574_0257632 3300035398 Bacteria 1114
370 Ga0373924_0000396 3300035410 Bacteria 13378
371 Ga0373924_0044218 3300035410 Bacteria 1830
372 Ga0373935_0123129 3300035692 Bacteria 1734
373 Ga0373935_0128839 3300035692 Unclassified 1698
374 Ga0373927_0025613 3300035695 Unclassified 3856
375 Ga0373933_0000115 3300035724 Bacteria 51833
376 Ga0373933_0000337 3300035724 Bacteria 30069
377 Ga0373933_0048187 3300035724 Bacteria 2536
378 Ga0373933_0182894 3300035724 Bacteria 1337
379 Ga0373937_0000032 3300036401 Bacteria 120148
380 Ga0373937_0069764 3300036401 Bacteria 3240
381 Ga0316582_0009778 3300036647 Bacteria 5217
382 Ga0316584_0012926 3300036712 Bacteria 5896
383 Ga0316584_0101274 3300036712 Bacteria 2157
384 Ga0316584_0101961 3300036712 Bacteria 2149
385 Ga0316584_0125790 3300036712 Bacteria 1914
386 Ga0373925_0000231 3300037068 Bacteria 59007
387 Ga0373925_0061247 3300037068 Bacteria 2826
388 Ga0373925_0173895 3300037068 Bacteria 1701
389 Ga0395900_0207821 3300037418 Unclassified 1978
390 Ga0316581_0003157 3300037588 Bacteria 4068
391 Ga0436364_0736590 3300037853 Bacteria 15640
392 Ga0436364_0899784 3300037853 Bacteria 68912
393 Ga0436364_1105580 3300037853 Bacteria 94835
394 Ga0436364_1197580 3300037853 Bacteria 3047
395 Ga0436364_1394990 3300037853 Bacteria 3996
396 Ga0395901_0058420 3300038443 Bacteria 4012
397 Ga0395901_0172510 3300038443 Bacteria 2269
398 Ga0436365_1173075 3300039437 Unclassified 1184
399 Ga0436365_1582105 3300039437 Bacteria 8587
400 Ga0436365_1659451 3300039437 Bacteria 13752
401 Ga0436363_0810518 3300039450 Bacteria 6259
402 Ga0436363_1432344 3300039450 Bacteria 2385
403 Ga0436363_1633984 3300039450 Bacteria 7784
404 Ga0436362_0885787 3300039453 Bacteria 2533
405 Ga0451787_756802 3300041441 Bacteria 1150
406 Ga0451791_1384070 3300041451 Bacteria 1462
407 Ga0451793_1156241 3300041452 Bacteria 2981
408 Ga0451795_1653433 3300041456 Bacteria 2381
409 Ga0451839_0764437 3300041496 Bacteria 1331
410 Ga0451839_1508461 3300041496 Bacteria 3167
411 Ga0451853_0309492 3300041512 Bacteria 4146
412 Ga0466966_0174839 3300044684 Archaea 1304
413 Ga0466963_0007989 3300044694 Bacteria 6333
414 Ga0466963_0116411 3300044694 Unclassified 1837
415 Ga0466963_0120340 3300044694 Bacteria 1806
416 Ga0466964_0047398 3300044706 Bacteria 1754
417 Ga0466960_0042449 3300044901 Bacteria 2159
418 Ga0466959_0085538 3300045049 Bacteria 2269
419 Ga0466967_0244327 3300045976 Bacteria 1713
420 Ga0466967_0270189 3300045976 Bacteria 1629
421 Ga0495592_0000079 3300046454 Bacteria 85581
422 Ga0495592_0020557 3300046454 Bacteria 5023
423 Ga0495603_0001329 3300046455 Bacteria 14353
424 Ga0495603_0055016 3300046455 Bacteria 2358
425 Ga0495629_0004876 3300046459 Bacteria 10068
426 Ga0495641_0004673 3300046461 Bacteria 9559
427 Ga0495651_0000010 3300046462 Bacteria 148763
428 Ga0495651_0003105 3300046462 Bacteria 12822
429 Ga0495653_0005012 3300046463 Bacteria 10744
430 Ga0495653_0017441 3300046463 Bacteria 5839
431 Ga0495653_0046822 3300046463 Bacteria 3347
432 Ga0495653_0170123 3300046463 Bacteria 1505
433 Ga0495580_0002884 3300046472 Bacteria 14806
434 Ga0495580_0135205 3300046472 Bacteria 1709
435 Ga0495582_0215661 3300046473 Unclassified 1098
436 Ga0495639_0001380 3300046475 Bacteria 10887
437 Ga0495639_0041957 3300046475 Bacteria 2062
438 Ga0495662_0000054 3300046476 Bacteria 39454
439 Ga0495662_0027670 3300046476 Bacteria 2738
440 Ga0495664_0025168 3300046477 Bacteria 3464
441 Ga0495584_0121248 3300046491 Bacteria 1324
442 Ga0495594_0003877 3300046499 Bacteria 7691
443 Ga0495596_0083235 3300046500 Bacteria 1242
444 Ga0495608_0000037 3300046511 Bacteria 125064
445 Ga0495608_0033472 3300046511 Unclassified 3472
446 Ga0495618_0101106 3300046514 Bacteria 1845
447 Ga0495628_0000227 3300046516 Bacteria 49431
448 Ga0495628_0003319 3300046516 Bacteria 14392
449 Ga0495628_0014366 3300046516 Bacteria 6638
450 Ga0495628_0141542 3300046516 Bacteria 1836
451 Ga0495630_0016104 3300046517 Bacteria 5462
452 Ga0495666_0000320 3300046526 Bacteria 20909
453 Ga0495666_0048015 3300046526 Bacteria 2056
454 Ga0495652_0000180 3300046529 Bacteria 71646
455 Ga0495652_0074293 3300046529 Bacteria 2827
456 Ga0495652_0128088 3300046529 Bacteria 2014
457 Ga0495665_0001132 3300046531 Bacteria 14133
458 Ga0495665_0028454 3300046531 Bacteria 2996
459 Ga0495640_0001333 3300046533 Bacteria 19402
460 Ga0495640_0053509 3300046533 Bacteria 2767
461 Ga0495640_0169056 3300046533 Bacteria 1397
462 Ga0495586_0003317 3300046535 Bacteria 8639
463 Ga0495587_0000024 3300046536 Bacteria 148753
464 Ga0495587_0002360 3300046536 Bacteria 12609
465 Ga0495587_0067226 3300046536 Bacteria 2089
466 Ga0495645_0026089 3300046543 Bacteria 4241
467 Ga0495645_0102647 3300046543 Bacteria 2032
468 Ga0495645_0218584 3300046543 Bacteria 1283
469 Ga0495645_0262903 3300046543 Bacteria 1141
470 Ga0495622_0035469 3300046557 Bacteria 2326
471 Ga0495667_0000024 3300046559 Bacteria 168313
472 Ga0495667_0016932 3300046559 Bacteria 4922
473 Ga0495656_0008948 3300046615 Bacteria 3592
474 Ga0495634_0029983 3300046642 Bacteria 3761
475 Ga0495634_0061977 3300046642 Bacteria 2484
476 Ga0495635_0015699 3300046663 Bacteria 5290
477 Ga0495635_0040551 3300046663 Bacteria 3217
478 Ga0495635_0077101 3300046663 Bacteria 2283
479 Ga0495588_0100893 3300046674 Bacteria 1517
480 Ga0495657_0000121 3300046675 Bacteria 69526
481 Ga0495657_0011263 3300046675 Bacteria 6698
482 Ga0495657_0022148 3300046675 Bacteria 4555
483 Ga0495599_0000147 3300046678 Bacteria 45782
484 Ga0495599_0001204 3300046678 Bacteria 14660
485 Ga0495599_0026350 3300046678 Bacteria 3642
486 Ga0495623_0005725 3300046679 Bacteria 8115
487 Ga0495623_0071085 3300046679 Bacteria 2166
488 Ga0495646_0017216 3300046680 Bacteria 4586
489 Ga0495646_0047107 3300046680 Bacteria 2626
490 Ga0495647_0084753 3300046681 Bacteria 1290
491 Ga0495658_0023344 3300046683 Bacteria 3282
492 Ga0495613_0004929 3300046689 Bacteria 10028
493 Ga0495624_0000590 3300046690 Bacteria 28259
494 Ga0495600_0000969 3300046809 Bacteria 15449
495 Ga0495600_0003937 3300046809 Bacteria 8823
496 Ga0495581_0002158 3300047315 Bacteria 11100
497 Ga0495581_0040874 3300047315 Unclassified 2682
498 Ga0495581_0060085 3300047315 Bacteria 2197
499 Ga0495604_0000024 3300047317 Bacteria 148542
500 Ga0495604_0013137 3300047317 Bacteria 6595
501 Ga0495604_0038152 3300047317 Bacteria 3781
502 Ga0495674_0040736 3300047319 Bacteria 4152
503 Ga0495674_0158015 3300047319 Bacteria 1898
504 Ga0495676_0012245 3300047321 Bacteria 7730
505 Ga0495676_0043544 3300047321 Bacteria 3671
506 Ga0495676_0109686 3300047321 Bacteria 2027
507 Ga0495680_0000005 3300047322 Bacteria 168308
508 Ga0495680_0006044 3300047322 Bacteria 11317
509 Ga0495680_0007072 3300047322 Bacteria 10339
510 Ga0495675_0003613 3300047444 Bacteria 9328
511 Ga0495675_0078322 3300047444 Bacteria 2081
512 Ga0495684_0001885 3300047471 Bacteria 16802
513 Ga0495684_0002509 3300047471 Bacteria 14621
514 Ga0495684_0135067 3300047471 Bacteria 1851
515 Ga0495593_0022942 3300047673 Bacteria 3472
516 Ga0495593_0024694 3300047673 Bacteria 3328
517 Ga0495602_0000198 3300048088 Bacteria 56006
518 Ga0495602_0012883 3300048088 Bacteria 8569
519 Ga0495602_0196016 3300048088 Unclassified 1544
520 Ga0495614_0010473 3300048089 Unclassified 4089
521 Ga0496100_0275979 3300048903 Bacteria 1251
522 Ga0496101_0011639 3300048904 Bacteria 5844
523 Ga0496101_0036387 3300048904 Unclassified 3486
524 Ga0496101_0107391 3300048904 Bacteria 2097
525 Ga0496101_0279988 3300048904 Unclassified 1303
526 Ga0496102_0039903 3300048905 Unclassified 4244
527 Ga0496102_0068842 3300048905 Bacteria 3248
528 Ga0496102_0186101 3300048905 Bacteria 1957
529 Ga0496102_0200438 3300048905 Unclassified 1881
530 Ga0496103_0017956 3300048906 Bacteria 4239
531 Ga0496103_0074606 3300048906 Bacteria 2127
532 Ga0496103_0082117 3300048906 Unclassified 2028
533 Ga0496104_0001775 3300048907 Bacteria 18658
534 Ga0496104_0013971 3300048907 Bacteria 7243
535 Ga0496104_0048802 3300048907 Unclassified 3991
536 Ga0496104_0139080 3300048907 Bacteria 2333
537 Ga0496104_0146164 3300048907 Unclassified 2270
538 Ga0496104_0199404 3300048907 Unclassified 1913
539 Ga0496105_0001663 3300048908 Bacteria 15835
540 Ga0496105_0007219 3300048908 Bacteria 8579
541 Ga0496105_0009644 3300048908 Bacteria 7558
542 Ga0496105_0019059 3300048908 Bacteria 5530
543 Ga0496105_0318405 3300048908 Unclassified 1247
544 Ga0496106_0050943 3300048909 Bacteria 3121
545 Ga0496106_0101693 3300048909 Bacteria 2229
546 Ga0496106_0275017 3300048909 Bacteria 1349
547 Ga0496107_0016058 3300048910 Bacteria 5255
548 Ga0496107_0072963 3300048910 Bacteria 2496
549 Ga0496107_0163849 3300048910 Bacteria 1648
550 Ga0496108_0000699 3300048911 Bacteria 26051
551 Ga0496108_0006352 3300048911 Bacteria 9581
552 Ga0496108_0013794 3300048911 Bacteria 6591
553 Ga0496108_0094097 3300048911 Bacteria 2550
554 Ga0496108_0131370 3300048911 Bacteria 2152
555 Ga0496108_0229129 3300048911 Bacteria 1615
556 Ga0496108_0232877 3300048911 Bacteria 1602
557 Ga0496108_0243511 3300048911 Unclassified 1564
558 Ga0496109_0002411 3300048912 Bacteria 15647
559 Ga0496109_0002951 3300048912 Bacteria 14231
560 Ga0496109_0005015 3300048912 Bacteria 11057
561 Ga0496109_0030488 3300048912 Unclassified 4833
562 Ga0496109_0049842 3300048912 Bacteria 3813
563 Ga0496109_0061137 3300048912 Bacteria 3443
564 Ga0496109_0104279 3300048912 Bacteria 2633
565 Ga0496110_0000964 3300048913 Bacteria 20143
566 Ga0496110_0036332 3300048913 Unclassified 4277
567 Ga0496110_0096467 3300048913 Bacteria 2649
568 Ga0496110_0300377 3300048913 Bacteria 1462
569 Ga0496110_0322336 3300048913 Bacteria 1408
570 Ga0496111_0002511 3300048914 Bacteria 11066
571 Ga0496111_0029572 3300048914 Unclassified 3891
572 Ga0496111_0041272 3300048914 Bacteria 3311
573 Ga0496111_0051776 3300048914 Bacteria 2964
574 Ga0496111_0056397 3300048914 Bacteria 2842
575 Ga0496111_0089630 3300048914 Unclassified 2253
576 Ga0496112_0008446 3300048915 Bacteria 9225
577 Ga0496112_0156970 3300048915 Unclassified 2242
578 Ga0496112_0165117 3300048915 Bacteria 2180
579 Ga0496112_0328858 3300048915 Bacteria 1472
580 Ga0496113_0009400 3300048916 Bacteria 6411
581 Ga0496113_0037712 3300048916 Bacteria 3549
582 Ga0496113_0055172 3300048916 Unclassified 2977
583 Ga0496113_0097975 3300048916 Unclassified 2269
584 Ga0496114_0035702 3300048917 Bacteria 4106
585 Ga0496114_0177574 3300048917 Unclassified 1858
586 Ga0496115_0046685 3300048918 Bacteria 3462
587 Ga0496115_0057982 3300048918 Bacteria 3115
588 Ga0496115_0112255 3300048918 Bacteria 2239
589 Ga0496126_0079258 3300048929 Bacteria 2908
590 Ga0496126_0335961 3300048929 Unclassified 1239
591 Ga0501034_0074518 3300049571 Bacteria 3402
592 Ga0501070_0146245 3300049586 Unclassified 1951
593 Ga0501044_0042118 3300049823 Bacteria 4752
594 nmdc:mga05p37_30825_c1 3300050507 Bacteria 6546
595 nmdc:mga08y16_11975_c1 3300050511 Bacteria 9108
596 nmdc:mga08y16_567799_c1 3300050511 Bacteria 1147
597 nmdc:mga0n895_16547_c1 3300050512 Bacteria 6771
598 nmdc:mga0n895_30906_c1 3300050512 Bacteria 5123
599 nmdc:mga0rr50_101215_c1 3300050513 Bacteria 2265
600 nmdc:mga0rr50_3773_c1 3300050513 Bacteria 8788
601 nmdc:mga08x19_6579_c1 3300050514 Bacteria 6887
602 nmdc:mga08x19_89201_c1 3300050514 Bacteria 2033
603 nmdc:mga0a205_127950_c1 3300050515 Bacteria 2440
604 nmdc:mga0a205_21165_c1 3300050515 Bacteria 6151
605 Ga0495601_0005539 3300053077 Bacteria 7366
606 Ga0495601_0007347 3300053077 Bacteria 6460
607 Ga0495595_0001856 3300053084 Bacteria 8194
608 Ga0495595_0002796 3300053084 Bacteria 6865
609 Ga0495595_0023996 3300053084 Bacteria 2690
610 Ga0495595_0065463 3300053084 Bacteria 1709
611 Ga0495619_0018349 3300053085 Bacteria 4439
612 Ga0495619_0046944 3300053085 Unclassified 2841
613 Ga0495619_0168726 3300053085 Bacteria 1513
614 Ga0500583_0001451 3300053092 Bacteria 6801
615 Ga0500568_0008461 3300053139 Bacteria 4953
616 Ga0500616_0000601 3300053153 Bacteria 43603
617 Ga0500616_0001662 3300053153 Bacteria 20526

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048908 Ga0496105_0318405 Ga0496105_0318405_10_936 277
2 3300044684 Ga0466966_0174839 Ga0466966_0174839_446_1294 278
3 3300048911 Ga0496108_0229129 Ga0496108_0229129_722_1570 278
4 3300050511 nmdc:mga08y16_567799_c1 nmdc:mga08y16_567799_c1_38_886 278
5 3300009147 Ga0114129_10468521 Ga0114129_104685212 288
6 3300025907 Ga0207645_10233683 Ga0207645_102336832 291
7 3300009094 Ga0111539_10062238 Ga0111539_100622384 299
8 3300035398 Ga0316574_0257632 Ga0316574_0257632_44_1075 303
9 3300025931 Ga0207644_10289002 Ga0207644_102890022 312
10 3300026075 Ga0207708_10237008 Ga0207708_102370082 312
11 3300047444 Ga0495675_0078322 Ga0495675_0078322_20_988 319
12 3300031727 Ga0316576_10176509 Ga0316576_101765092 325
13 3300031727 Ga0316576_10238119 Ga0316576_102381191 325
14 3300031728 Ga0316578_10023814 Ga0316578_100238143 325
15 3300036712 Ga0316584_0125790 Ga0316584_0125790_422_1432 325
16 3300048915 Ga0496112_0165117 Ga0496112_0165117_498_1487 325
17 3300009177 Ga0105248_10079472 Ga0105248_100794722 326
18 3300035121 Ga0373960_0067507 Ga0373960_0067507_90_1073 326
19 3300041456 Ga0451795_1653433 Ga0451795_1653433_36_1028 326
20 3300048905 Ga0496102_0068842 Ga0496102_0068842_1404_2405 327
21 3300048907 Ga0496104_0001775 Ga0496104_0001775_4547_5548 327
22 3300048908 Ga0496105_0019059 Ga0496105_0019059_2973_3974 327
23 3300048910 Ga0496107_0072963 Ga0496107_0072963_1351_2352 327
24 3300048912 Ga0496109_0005015 Ga0496109_0005015_9995_10996 327
25 3300048916 Ga0496113_0009400 Ga0496113_0009400_4944_5945 327
26 3300005842 Ga0068858_100128251 Ga0068858_1001282512 330
27 3300025916 Ga0207663_10082005 Ga0207663_100820052 330
28 3300035112 Ga0373932_0015256 Ga0373932_0015256_371_1519 330
29 3300005618 Ga0068864_100152712 Ga0068864_1001527122 331
30 3300005841 Ga0068863_100140366 Ga0068863_1001403662 331
31 3300013307 Ga0157372_10173121 Ga0157372_101731212 331
32 3300014325 Ga0163163_10012499 Ga0163163_100124995 331
33 3300026116 Ga0207674_10059235 Ga0207674_100592352 331
34 3300031665 Ga0316575_10031507 Ga0316575_100315072 331
35 3300031728 Ga0316578_10122628 Ga0316578_101226282 331
36 3300036712 Ga0316584_0101274 Ga0316584_0101274_650_1669 331
37 3300048907 Ga0496104_0146164 Ga0496104_0146164_41_1120 331
38 3300048914 Ga0496111_0041272 Ga0496111_0041272_37_1131 331
39 3300005356 Ga0070674_100249688 Ga0070674_1002496882 332
40 3300005434 Ga0070709_10035032 Ga0070709_100350322 332
41 3300005437 Ga0070710_10007980 Ga0070710_100079804 332
42 3300005614 Ga0068856_100061143 Ga0068856_1000611433 332
43 3300005615 Ga0070702_100032016 Ga0070702_1000320162 332
44 3300006173 Ga0070716_100122611 Ga0070716_1001226112 332
45 3300013105 Ga0157369_10070048 Ga0157369_100700482 332
46 3300013306 Ga0163162_10050417 Ga0163162_100504175 332
47 3300025906 Ga0207699_10031377 Ga0207699_100313772 332
48 3300025939 Ga0207665_10134025 Ga0207665_101340252 332
49 3300026095 Ga0207676_10209801 Ga0207676_102098012 332
50 3300026121 Ga0207683_10456894 Ga0207683_104568941 332
51 3300046543 Ga0495645_0102647 Ga0495645_0102647_186_1280 332
52 3300048911 Ga0496108_0243511 Ga0496108_0243511_155_1234 332
53 3300048912 Ga0496109_0061137 Ga0496109_0061137_653_1732 332
54 3300025901 Ga0207688_10116445 Ga0207688_101164452 333
55 3300005937 Ga0081455_10069868 Ga0081455_100698683 334
56 3300005981 Ga0081538_10102674 Ga0081538_101026742 334
57 3300009094 Ga0111539_10437488 Ga0111539_104374881 334
58 3300035117 Ga0373953_0022080 Ga0373953_0022080_1246_2310 334
59 3300035410 Ga0373924_0044218 Ga0373924_0044218_180_1244 334
60 3300035692 Ga0373935_0128839 Ga0373935_0128839_525_1589 334
61 3300037068 Ga0373925_0173895 Ga0373925_0173895_452_1459 334
62 3300044694 Ga0466963_0007989 Ga0466963_0007989_4115_5128 334
63 3300044706 Ga0466964_0047398 Ga0466964_0047398_594_1619 334
64 3300046454 Ga0495592_0020557 Ga0495592_0020557_531_1595 334
65 3300046475 Ga0495639_0041957 Ga0495639_0041957_219_1283 334
66 3300046516 Ga0495628_0003319 Ga0495628_0003319_9531_10595 334
67 3300046516 Ga0495628_0141542 Ga0495628_0141542_148_1155 334
68 3300046529 Ga0495652_0074293 Ga0495652_0074293_1079_2143 334
69 3300046533 Ga0495640_0053509 Ga0495640_0053509_1131_2195 334
70 3300046536 Ga0495587_0002360 Ga0495587_0002360_1317_2381 334
71 3300046663 Ga0495635_0040551 Ga0495635_0040551_1436_2500 334
72 3300046678 Ga0495599_0001204 Ga0495599_0001204_9853_10917 334
73 3300047315 Ga0495581_0060085 Ga0495581_0060085_636_1700 334
74 3300047319 Ga0495674_0040736 Ga0495674_0040736_2424_3488 334
75 3300047319 Ga0495674_0158015 Ga0495674_0158015_566_1588 334
76 3300047322 Ga0495680_0006044 Ga0495680_0006044_723_1787 334
77 3300047471 Ga0495684_0001885 Ga0495684_0001885_9531_10595 334
78 3300048088 Ga0495602_0012883 Ga0495602_0012883_5521_6585 334
79 3300048904 Ga0496101_0036387 Ga0496101_0036387_2457_3464 334
80 3300053077 Ga0495601_0007347 Ga0495601_0007347_4912_5976 334
81 3300053084 Ga0495595_0001856 Ga0495595_0001856_4264_5328 334
82 3300006028 Ga0070717_10408504 Ga0070717_104085042 335
83 3300031727 Ga0316576_10010262 Ga0316576_100102621 335
84 3300035724 Ga0373933_0182894 Ga0373933_0182894_65_1129 335
85 3300005985 Ga0081539_10002380 Ga0081539_1000238015 336
86 3300005985 Ga0081539_10012438 Ga0081539_100124382 336
87 3300005985 Ga0081539_10015847 Ga0081539_100158475 336
88 3300005985 Ga0081539_10051188 Ga0081539_100511882 336
89 3300025944 Ga0207661_10104916 Ga0207661_101049162 336
90 3300032126 Ga0307415_100057494 Ga0307415_1000574942 336
91 3300048911 Ga0496108_0232877 Ga0496108_0232877_417_1454 336
92 3300048912 Ga0496109_0104279 Ga0496109_0104279_245_1270 336
93 3300005329 Ga0070683_100095733 Ga0070683_1000957333 337
94 3300005354 Ga0070675_100074003 Ga0070675_1000740031 337
95 3300005937 Ga0081455_10138099 Ga0081455_101380992 337
96 3300009094 Ga0111539_10002081 Ga0111539_1000208118 337
97 3300021358 Ga0213873_10035523 Ga0213873_100355232 337
98 3300021377 Ga0213874_10006597 Ga0213874_100065974 337
99 3300021384 Ga0213876_10006736 Ga0213876_100067363 337
100 3300021388 Ga0213875_10000148 Ga0213875_1000014831 337
101 3300021388 Ga0213875_10011400 Ga0213875_100114002 337
102 3300025926 Ga0207659_10092465 Ga0207659_100924651 337
103 3300025942 Ga0207689_10340119 Ga0207689_103401192 337
104 3300037853 Ga0436364_0736590 Ga0436364_0736590_14585_15625 337
105 3300037853 Ga0436364_0899784 Ga0436364_0899784_40855_41877 337
106 3300037853 Ga0436364_1105580 Ga0436364_1105580_28888_29931 337
107 3300039437 Ga0436365_1173075 Ga0436365_1173075_55_1164 337
108 3300039437 Ga0436365_1582105 Ga0436365_1582105_6864_7904 337
109 3300039450 Ga0436363_0810518 Ga0436363_0810518_2853_3893 337
110 3300039450 Ga0436363_1633984 Ga0436363_1633984_116_1156 337
111 3300039453 Ga0436362_0885787 Ga0436362_0885787_100_1209 337
112 3300045976 Ga0466967_0270189 Ga0466967_0270189_488_1516 337
113 3300046455 Ga0495603_0055016 Ga0495603_0055016_674_1711 337
114 3300046491 Ga0495584_0121248 Ga0495584_0121248_158_1198 337
115 3300046500 Ga0495596_0083235 Ga0495596_0083235_121_1161 337
116 3300046615 Ga0495656_0008948 Ga0495656_0008948_1165_2205 337
117 3300048911 Ga0496108_0094097 Ga0496108_0094097_724_1761 337
118 3300048912 Ga0496109_0049842 Ga0496109_0049842_1433_2470 337
119 3300048914 Ga0496111_0056397 Ga0496111_0056397_930_1967 337
120 3300048929 Ga0496126_0079258 Ga0496126_0079258_1797_2825 337
121 3300050511 nmdc:mga08y16_11975_c1 nmdc:mga08y16_11975_c1_704_1726 337
122 3300005458 Ga0070681_10170089 Ga0070681_101700892 338
123 3300005467 Ga0070706_100041687 Ga0070706_1000416873 338
124 3300005530 Ga0070679_100017896 Ga0070679_1000178967 338
125 3300005563 Ga0068855_100013363 Ga0068855_1000133639 338
126 3300007265 Ga0099794_10077202 Ga0099794_100772021 338
127 3300011119 Ga0105246_10015359 Ga0105246_100153592 338
128 3300025904 Ga0207647_10000879 Ga0207647_1000087924 338
129 3300025910 Ga0207684_10000253 Ga0207684_1000025370 338
130 3300025921 Ga0207652_10002441 Ga0207652_100024416 338
131 3300025949 Ga0207667_10024494 Ga0207667_100244947 338
132 3300026078 Ga0207702_10328845 Ga0207702_103288451 338
133 3300028556 Ga0265337_1004147 Ga0265337_10041472 338
134 3300028558 Ga0265326_10000783 Ga0265326_100007833 338
135 3300028563 Ga0265319_1003966 Ga0265319_10039664 338
136 3300028573 Ga0265334_10006877 Ga0265334_100068774 338
137 3300028577 Ga0265318_10033684 Ga0265318_100336843 338
138 3300028653 Ga0265323_10009561 Ga0265323_100095612 338
139 3300028666 Ga0265336_10008948 Ga0265336_100089483 338
140 3300028800 Ga0265338_10000757 Ga0265338_100007578 338
141 3300028800 Ga0265338_10024806 Ga0265338_100248069 338
142 3300028800 Ga0265338_10029061 Ga0265338_100290616 338
143 3300029957 Ga0265324_10003374 Ga0265324_100033745 338
144 3300031238 Ga0265332_10003276 Ga0265332_100032763 338
145 3300031240 Ga0265320_10011675 Ga0265320_100116754 338
146 3300031247 Ga0265340_10009819 Ga0265340_100098193 338
147 3300031249 Ga0265339_10018769 Ga0265339_100187694 338
148 3300031344 Ga0265316_10075726 Ga0265316_100757262 338
149 3300031595 Ga0265313_10033113 Ga0265313_100331132 338
150 3300031665 Ga0316575_10003459 Ga0316575_100034593 338
151 3300031665 Ga0316575_10009596 Ga0316575_100095962 338
152 3300031711 Ga0265314_10012190 Ga0265314_100121904 338
153 3300031712 Ga0265342_10020260 Ga0265342_100202603 338
154 3300031727 Ga0316576_10021225 Ga0316576_100212253 338
155 3300031728 Ga0316578_10000196 Ga0316578_100001961 338
156 3300031733 Ga0316577_10000247 Ga0316577_100002477 338
157 3300031733 Ga0316577_10007595 Ga0316577_100075956 338
158 3300031852 Ga0307410_10079657 Ga0307410_100796572 338
159 3300032133 Ga0316583_10009154 Ga0316583_100091542 338
160 3300032137 Ga0316585_10053199 Ga0316585_100531991 338
161 3300032139 Ga0316580_10000271 Ga0316580_100002712 338
162 3300035170 Ga0373943_0026142 Ga0373943_0026142_181_1215 338
163 3300035398 Ga0316574_0000335 Ga0316574_0000335_628_1686 338
164 3300035398 Ga0316574_0073321 Ga0316574_0073321_233_1375 338
165 3300036647 Ga0316582_0009778 Ga0316582_0009778_3426_4484 338
166 3300036712 Ga0316584_0012926 Ga0316584_0012926_4047_5105 338
167 3300036712 Ga0316584_0101961 Ga0316584_0101961_247_1275 338
168 3300037068 Ga0373925_0000231 Ga0373925_0000231_42483_43517 338
169 3300037588 Ga0316581_0003157 Ga0316581_0003157_266_1324 338
170 3300038443 Ga0395901_0058420 Ga0395901_0058420_895_1920 338
171 3300049571 Ga0501034_0074518 Ga0501034_0074518_1705_2739 338
172 3300049586 Ga0501070_0146245 Ga0501070_0146245_64_1092 338
173 3300049823 Ga0501044_0042118 Ga0501044_0042118_788_1822 338
174 3300053092 Ga0500583_0001451 Ga0500583_0001451_1686_2756 338
175 3300053139 Ga0500568_0008461 Ga0500568_0008461_2099_3178 338
176 3300003659 JGI25404J52841_10024711 JGI25404J52841_100247112 339
177 3300005334 Ga0068869_100167926 Ga0068869_1001679262 339
178 3300005337 Ga0070682_100028659 Ga0070682_1000286591 339
179 3300005337 Ga0070682_100098893 Ga0070682_1000988932 339
180 3300005339 Ga0070660_100079315 Ga0070660_1000793152 339
181 3300005340 Ga0070689_100062161 Ga0070689_1000621614 339
182 3300005347 Ga0070668_100054139 Ga0070668_1000541392 339
183 3300005355 Ga0070671_100066715 Ga0070671_1000667152 339
184 3300005367 Ga0070667_100263835 Ga0070667_1002638352 339
185 3300005435 Ga0070714_100017113 Ga0070714_1000171135 339
186 3300005435 Ga0070714_100058482 Ga0070714_1000584822 339
187 3300005436 Ga0070713_100120281 Ga0070713_1001202811 339
188 3300005437 Ga0070710_10056320 Ga0070710_100563202 339
189 3300005445 Ga0070708_100004332 Ga0070708_1000043322 339
190 3300005445 Ga0070708_100010622 Ga0070708_1000106226 339
191 3300005445 Ga0070708_100022016 Ga0070708_1000220161 339
192 3300005445 Ga0070708_100073307 Ga0070708_1000733072 339
193 3300005445 Ga0070708_100269466 Ga0070708_1002694662 339
194 3300005455 Ga0070663_100040425 Ga0070663_1000404252 339
195 3300005458 Ga0070681_10095741 Ga0070681_100957412 339
196 3300005459 Ga0068867_100144473 Ga0068867_1001444732 339
197 3300005466 Ga0070685_10148840 Ga0070685_101488401 339
198 3300005466 Ga0070685_10195136 Ga0070685_101951361 339
199 3300005467 Ga0070706_100003350 Ga0070706_1000033509 339
200 3300005467 Ga0070706_100007331 Ga0070706_10000733111 339
201 3300005467 Ga0070706_100008557 Ga0070706_1000085576 339
202 3300005467 Ga0070706_100011810 Ga0070706_1000118107 339
203 3300005467 Ga0070706_100045756 Ga0070706_1000457563 339
204 3300005467 Ga0070706_100058586 Ga0070706_1000585863 339
205 3300005467 Ga0070706_100231663 Ga0070706_1002316632 339
206 3300005467 Ga0070706_100232364 Ga0070706_1002323642 339
207 3300005468 Ga0070707_100001852 Ga0070707_1000018527 339
208 3300005468 Ga0070707_100014484 Ga0070707_1000144844 339
209 3300005468 Ga0070707_100017961 Ga0070707_1000179615 339
210 3300005468 Ga0070707_100025995 Ga0070707_1000259952 339
211 3300005468 Ga0070707_100041084 Ga0070707_1000410843 339
212 3300005468 Ga0070707_100213725 Ga0070707_1002137252 339
213 3300005468 Ga0070707_100229568 Ga0070707_1002295681 339
214 3300005471 Ga0070698_100001492 Ga0070698_10000149217 339
215 3300005471 Ga0070698_100002646 Ga0070698_10000264617 339
216 3300005471 Ga0070698_100004059 Ga0070698_10000405915 339
217 3300005471 Ga0070698_100004413 Ga0070698_1000044132 339
218 3300005471 Ga0070698_100052130 Ga0070698_1000521303 339
219 3300005471 Ga0070698_100056549 Ga0070698_1000565493 339
220 3300005471 Ga0070698_100060077 Ga0070698_1000600772 339
221 3300005471 Ga0070698_100091738 Ga0070698_1000917382 339
222 3300005471 Ga0070698_100100625 Ga0070698_1001006253 339
223 3300005471 Ga0070698_100109975 Ga0070698_1001099753 339
224 3300005471 Ga0070698_100250635 Ga0070698_1002506352 339
225 3300005471 Ga0070698_100274950 Ga0070698_1002749502 339
226 3300005518 Ga0070699_100001142 Ga0070699_10000114219 339
227 3300005518 Ga0070699_100006327 Ga0070699_10000632711 339
228 3300005518 Ga0070699_100048972 Ga0070699_1000489721 339
229 3300005518 Ga0070699_100105945 Ga0070699_1001059452 339
230 3300005518 Ga0070699_100115633 Ga0070699_1001156332 339
231 3300005518 Ga0070699_100197415 Ga0070699_1001974153 339
232 3300005535 Ga0070684_100024436 Ga0070684_1000244364 339
233 3300005535 Ga0070684_100028797 Ga0070684_1000287974 339
234 3300005536 Ga0070697_100001890 Ga0070697_1000018908 339
235 3300005536 Ga0070697_100010665 Ga0070697_1000106654 339
236 3300005536 Ga0070697_100017641 Ga0070697_1000176415 339
237 3300005536 Ga0070697_100026241 Ga0070697_1000262414 339
238 3300005539 Ga0068853_100270137 Ga0068853_1002701372 339
239 3300005544 Ga0070686_100081314 Ga0070686_1000813142 339
240 3300005548 Ga0070665_100093063 Ga0070665_1000930632 339
241 3300005564 Ga0070664_100309565 Ga0070664_1003095652 339
242 3300005578 Ga0068854_100201303 Ga0068854_1002013032 339
243 3300005719 Ga0068861_100007858 Ga0068861_1000078583 339
244 3300005719 Ga0068861_100116486 Ga0068861_1001164865 339
245 3300005719 Ga0068861_100178963 Ga0068861_1001789631 339
246 3300005841 Ga0068863_100057463 Ga0068863_1000574633 339
247 3300005843 Ga0068860_100171855 Ga0068860_1001718554 339
248 3300005843 Ga0068860_100261356 Ga0068860_1002613562 339
249 3300005937 Ga0081455_10037377 Ga0081455_100373772 339
250 3300005983 Ga0081540_1004475 Ga0081540_10044756 339
251 3300005983 Ga0081540_1014769 Ga0081540_10147693 339
252 3300005985 Ga0081539_10004254 Ga0081539_100042543 339
253 3300006028 Ga0070717_10011712 Ga0070717_100117126 339
254 3300006028 Ga0070717_10016411 Ga0070717_100164113 339
255 3300006028 Ga0070717_10034398 Ga0070717_100343982 339
256 3300006028 Ga0070717_10044572 Ga0070717_100445723 339
257 3300006028 Ga0070717_10112880 Ga0070717_101128801 339
258 3300006028 Ga0070717_10249911 Ga0070717_102499111 339
259 3300006163 Ga0070715_10033471 Ga0070715_100334711 339
260 3300006163 Ga0070715_10047211 Ga0070715_100472111 339
261 3300006173 Ga0070716_100078426 Ga0070716_1000784263 339
262 3300006173 Ga0070716_100081721 Ga0070716_1000817212 339
263 3300006173 Ga0070716_100113164 Ga0070716_1001131642 339
264 3300006175 Ga0070712_100023366 Ga0070712_1000233662 339
265 3300006175 Ga0070712_100283054 Ga0070712_1002830542 339
266 3300006358 Ga0068871_100080604 Ga0068871_1000806042 339
267 3300006358 Ga0068871_100285509 Ga0068871_1002855092 339
268 3300006847 Ga0075431_100261425 Ga0075431_1002614252 339
269 3300006852 Ga0075433_10058299 Ga0075433_100582992 339
270 3300006852 Ga0075433_10137835 Ga0075433_101378351 339
271 3300006871 Ga0075434_100003966 Ga0075434_10000396614 339
272 3300006871 Ga0075434_100081895 Ga0075434_1000818952 339
273 3300006871 Ga0075434_100132291 Ga0075434_1001322912 339
274 3300006914 Ga0075436_100004661 Ga0075436_1000046614 339
275 3300006914 Ga0075436_100010988 Ga0075436_1000109883 339
276 3300007076 Ga0075435_100004546 Ga0075435_1000045465 339
277 3300007076 Ga0075435_100047059 Ga0075435_1000470593 339
278 3300007076 Ga0075435_100074095 Ga0075435_1000740952 339
279 3300007076 Ga0075435_100151377 Ga0075435_1001513772 339
280 3300009011 Ga0105251_10014638 Ga0105251_100146381 339
281 3300009101 Ga0105247_10103407 Ga0105247_101034072 339
282 3300009101 Ga0105247_10147362 Ga0105247_101473621 339
283 3300009147 Ga0114129_10013858 Ga0114129_100138585 339
284 3300009148 Ga0105243_10005512 Ga0105243_100055126 339
285 3300009177 Ga0105248_10158614 Ga0105248_101586142 339
286 3300009553 Ga0105249_10137445 Ga0105249_101374452 339
287 3300013297 Ga0157378_10461414 Ga0157378_104614142 339
288 3300013306 Ga0163162_10128984 Ga0163162_101289842 339
289 3300013308 Ga0157375_10661536 Ga0157375_106615361 339
290 3300014325 Ga0163163_10098472 Ga0163163_100984722 339
291 3300014325 Ga0163163_10352754 Ga0163163_103527541 339
292 3300014326 Ga0157380_10086384 Ga0157380_100863842 339
293 3300014968 Ga0157379_10109260 Ga0157379_101092602 339
294 3300014969 Ga0157376_10122454 Ga0157376_101224542 339
295 3300014969 Ga0157376_10152166 Ga0157376_101521661 339
296 3300024225 Ga0224572_1012925 Ga0224572_10129252 339
297 3300025898 Ga0207692_10005594 Ga0207692_100055942 339
298 3300025898 Ga0207692_10029937 Ga0207692_100299372 339
299 3300025898 Ga0207692_10061454 Ga0207692_100614542 339
300 3300025900 Ga0207710_10046161 Ga0207710_100461612 339
301 3300025901 Ga0207688_10013767 Ga0207688_100137673 339
302 3300025905 Ga0207685_10000657 Ga0207685_100006577 339
303 3300025906 Ga0207699_10006768 Ga0207699_100067682 339
304 3300025906 Ga0207699_10017329 Ga0207699_100173292 339
305 3300025906 Ga0207699_10046549 Ga0207699_100465492 339
306 3300025908 Ga0207643_10012839 Ga0207643_100128394 339
307 3300025910 Ga0207684_10001497 Ga0207684_1000149712 339
308 3300025910 Ga0207684_10003148 Ga0207684_1000314813 339
309 3300025910 Ga0207684_10007382 Ga0207684_100073824 339
310 3300025910 Ga0207684_10019275 Ga0207684_100192752 339
311 3300025910 Ga0207684_10039551 Ga0207684_100395514 339
312 3300025910 Ga0207684_10039865 Ga0207684_100398658 339
313 3300025910 Ga0207684_10084566 Ga0207684_100845662 339
314 3300025910 Ga0207684_10161225 Ga0207684_101612252 339
315 3300025910 Ga0207684_10205637 Ga0207684_102056372 339
316 3300025910 Ga0207684_10221831 Ga0207684_102218312 339
317 3300025910 Ga0207684_10431869 Ga0207684_104318691 339
318 3300025915 Ga0207693_10075655 Ga0207693_100756551 339
319 3300025916 Ga0207663_10003613 Ga0207663_100036137 339
320 3300025916 Ga0207663_10016926 Ga0207663_100169262 339
321 3300025922 Ga0207646_10001473 Ga0207646_1000147326 339
322 3300025922 Ga0207646_10002713 Ga0207646_100027135 339
323 3300025922 Ga0207646_10002949 Ga0207646_100029497 339
324 3300025922 Ga0207646_10007561 Ga0207646_1000756110 339
325 3300025922 Ga0207646_10016968 Ga0207646_100169684 339
326 3300025922 Ga0207646_10039287 Ga0207646_100392872 339
327 3300025922 Ga0207646_10060949 Ga0207646_100609492 339
328 3300025922 Ga0207646_10084322 Ga0207646_100843222 339
329 3300025922 Ga0207646_10120187 Ga0207646_101201872 339
330 3300025922 Ga0207646_10320933 Ga0207646_103209332 339
331 3300025922 Ga0207646_10422108 Ga0207646_104221081 339
332 3300025927 Ga0207687_10015600 Ga0207687_100156004 339
333 3300025927 Ga0207687_10047199 Ga0207687_100471994 339
334 3300025928 Ga0207700_10002599 Ga0207700_100025993 339
335 3300025928 Ga0207700_10010060 Ga0207700_100100604 339
336 3300025928 Ga0207700_10015276 Ga0207700_100152762 339
337 3300025928 Ga0207700_10048048 Ga0207700_100480482 339
338 3300025928 Ga0207700_10062428 Ga0207700_100624282 339
339 3300025928 Ga0207700_10108935 Ga0207700_101089351 339
340 3300025928 Ga0207700_10132655 Ga0207700_101326552 339
341 3300025928 Ga0207700_10224320 Ga0207700_102243201 339
342 3300025929 Ga0207664_10030230 Ga0207664_100302302 339
343 3300025929 Ga0207664_10042027 Ga0207664_100420273 339
344 3300025929 Ga0207664_10079766 Ga0207664_100797662 339
345 3300025931 Ga0207644_10110735 Ga0207644_101107352 339
346 3300025933 Ga0207706_10303099 Ga0207706_103030992 339
347 3300025936 Ga0207670_10041944 Ga0207670_100419443 339
348 3300025939 Ga0207665_10129287 Ga0207665_101292872 339
349 3300025939 Ga0207665_10132085 Ga0207665_101320852 339
350 3300025942 Ga0207689_10005636 Ga0207689_100056362 339
351 3300025942 Ga0207689_10163691 Ga0207689_101636912 339
352 3300025945 Ga0207679_10187880 Ga0207679_101878802 339
353 3300025945 Ga0207679_10324153 Ga0207679_103241531 339
354 3300025961 Ga0207712_10039804 Ga0207712_100398045 339
355 3300025961 Ga0207712_10087859 Ga0207712_100878592 339
356 3300025972 Ga0207668_10086767 Ga0207668_100867672 339
357 3300026023 Ga0207677_10048749 Ga0207677_100487492 339
358 3300026041 Ga0207639_10254992 Ga0207639_102549923 339
359 3300026067 Ga0207678_10009825 Ga0207678_100098256 339
360 3300026067 Ga0207678_10066656 Ga0207678_100666563 339
361 3300026078 Ga0207702_10024493 Ga0207702_100244934 339
362 3300026078 Ga0207702_10084537 Ga0207702_100845372 339
363 3300026089 Ga0207648_10173445 Ga0207648_101734452 339
364 3300026095 Ga0207676_10078187 Ga0207676_100781872 339
365 3300026095 Ga0207676_10176511 Ga0207676_101765112 339
366 3300026118 Ga0207675_100024791 Ga0207675_1000247914 339
367 3300026118 Ga0207675_100070897 Ga0207675_1000708972 339
368 3300026118 Ga0207675_100110851 Ga0207675_1001108511 339
369 3300026118 Ga0207675_100194670 Ga0207675_1001946704 339
370 3300026121 Ga0207683_10001205 Ga0207683_100012055 339
371 3300026121 Ga0207683_10200222 Ga0207683_102002222 339
372 3300028380 Ga0268265_10437206 Ga0268265_104372061 339
373 3300028800 Ga0265338_10007876 Ga0265338_1000787610 339
374 3300031456 Ga0307513_10000126 Ga0307513_1000012650 339
375 3300031995 Ga0307409_100224880 Ga0307409_1002248802 339
376 3300034818 Ga0373950_0003976 Ga0373950_0003976_996_2033 339
377 3300034820 Ga0373959_0017991 Ga0373959_0017991_149_1186 339
378 3300035086 Ga0373934_0004401 Ga0373934_0004401_1356_2390 339
379 3300035086 Ga0373934_0006948 Ga0373934_0006948_2976_3998 339
380 3300035088 Ga0373940_0038640 Ga0373940_0038640_195_1232 339
381 3300035089 Ga0373944_0001319 Ga0373944_0001319_1938_2960 339
382 3300035092 Ga0373952_0003338 Ga0373952_0003338_420_1442 339
383 3300035111 Ga0373923_0000311 Ga0373923_0000311_5809_6852 339
384 3300035111 Ga0373923_0001290 Ga0373923_0001290_819_1853 339
385 3300035112 Ga0373932_0012708 Ga0373932_0012708_574_1611 339
386 3300035116 Ga0373945_0003956 Ga0373945_0003956_490_1512 339
387 3300035117 Ga0373953_0003403 Ga0373953_0003403_3597_4631 339
388 3300035117 Ga0373953_0003923 Ga0373953_0003923_103_1125 339
389 3300035118 Ga0373954_0031087 Ga0373954_0031087_932_1954 339
390 3300035118 Ga0373954_0033057 Ga0373954_0033057_317_1354 339
391 3300035119 Ga0373956_0000076 Ga0373956_0000076_1546_2580 339
392 3300035120 Ga0373957_0000009 Ga0373957_0000009_6529_7563 339
393 3300035120 Ga0373957_0001254 Ga0373957_0001254_4609_5646 339
394 3300035170 Ga0373943_0004905 Ga0373943_0004905_2098_3120 339
395 3300035171 Ga0373946_0035440 Ga0373946_0035440_354_1391 339
396 3300035172 Ga0373955_0000014 Ga0373955_0000014_15751_16785 339
397 3300035410 Ga0373924_0000396 Ga0373924_0000396_1294_2328 339
398 3300035692 Ga0373935_0123129 Ga0373935_0123129_599_1636 339
399 3300035695 Ga0373927_0025613 Ga0373927_0025613_1862_2884 339
400 3300035724 Ga0373933_0000115 Ga0373933_0000115_41153_42187 339
401 3300035724 Ga0373933_0000337 Ga0373933_0000337_24635_25672 339
402 3300035724 Ga0373933_0048187 Ga0373933_0048187_1236_2258 339
403 3300036401 Ga0373937_0000032 Ga0373937_0000032_106567_107601 339
404 3300036401 Ga0373937_0069764 Ga0373937_0069764_2150_3172 339
405 3300037068 Ga0373925_0061247 Ga0373925_0061247_1080_2108 339
406 3300037418 Ga0395900_0207821 Ga0395900_0207821_229_1269 339
407 3300037853 Ga0436364_1197580 Ga0436364_1197580_671_1693 339
408 3300037853 Ga0436364_1394990 Ga0436364_1394990_243_1283 339
409 3300038443 Ga0395901_0172510 Ga0395901_0172510_730_1770 339
410 3300039437 Ga0436365_1659451 Ga0436365_1659451_7321_8388 339
411 3300039450 Ga0436363_1432344 Ga0436363_1432344_915_1937 339
412 3300041441 Ga0451787_756802 Ga0451787_756802_74_1117 339
413 3300041451 Ga0451791_1384070 Ga0451791_1384070_46_1089 339
414 3300041452 Ga0451793_1156241 Ga0451793_1156241_842_1885 339
415 3300041496 Ga0451839_0764437 Ga0451839_0764437_129_1181 339
416 3300041496 Ga0451839_1508461 Ga0451839_1508461_464_1507 339
417 3300041512 Ga0451853_0309492 Ga0451853_0309492_1872_2915 339
418 3300044694 Ga0466963_0116411 Ga0466963_0116411_217_1260 339
419 3300044694 Ga0466963_0120340 Ga0466963_0120340_467_1504 339
420 3300044901 Ga0466960_0042449 Ga0466960_0042449_329_1375 339
421 3300045049 Ga0466959_0085538 Ga0466959_0085538_112_1155 339
422 3300045976 Ga0466967_0244327 Ga0466967_0244327_445_1488 339
423 3300046454 Ga0495592_0000079 Ga0495592_0000079_41153_42187 339
424 3300046455 Ga0495603_0001329 Ga0495603_0001329_8849_9871 339
425 3300046459 Ga0495629_0004876 Ga0495629_0004876_4695_5717 339
426 3300046461 Ga0495641_0004673 Ga0495641_0004673_402_1424 339
427 3300046462 Ga0495651_0000010 Ga0495651_0000010_41153_42187 339
428 3300046462 Ga0495651_0003105 Ga0495651_0003105_3053_4075 339
429 3300046463 Ga0495653_0005012 Ga0495653_0005012_1078_2112 339
430 3300046463 Ga0495653_0017441 Ga0495653_0017441_1964_3001 339
431 3300046463 Ga0495653_0046822 Ga0495653_0046822_103_1125 339
432 3300046463 Ga0495653_0170123 Ga0495653_0170123_98_1141 339
433 3300046472 Ga0495580_0002884 Ga0495580_0002884_4454_5476 339
434 3300046472 Ga0495580_0135205 Ga0495580_0135205_491_1528 339
435 3300046473 Ga0495582_0215661 Ga0495582_0215661_23_1066 339
436 3300046475 Ga0495639_0001380 Ga0495639_0001380_3068_4090 339
437 3300046476 Ga0495662_0000054 Ga0495662_0000054_33822_34844 339
438 3300046476 Ga0495662_0027670 Ga0495662_0027670_1393_2430 339
439 3300046477 Ga0495664_0025168 Ga0495664_0025168_2356_3393 339
440 3300046499 Ga0495594_0003877 Ga0495594_0003877_2150_3172 339
441 3300046511 Ga0495608_0000037 Ga0495608_0000037_23761_24795 339
442 3300046511 Ga0495608_0033472 Ga0495608_0033472_932_1954 339
443 3300046514 Ga0495618_0101106 Ga0495618_0101106_751_1788 339
444 3300046516 Ga0495628_0000227 Ga0495628_0000227_17247_18281 339
445 3300046516 Ga0495628_0014366 Ga0495628_0014366_4640_5662 339
446 3300046517 Ga0495630_0016104 Ga0495630_0016104_129_1151 339
447 3300046526 Ga0495666_0000320 Ga0495666_0000320_16622_17644 339
448 3300046526 Ga0495666_0048015 Ga0495666_0048015_960_1997 339
449 3300046529 Ga0495652_0000180 Ga0495652_0000180_27122_28156 339
450 3300046529 Ga0495652_0128088 Ga0495652_0128088_253_1290 339
451 3300046531 Ga0495665_0001132 Ga0495665_0001132_7540_8562 339
452 3300046531 Ga0495665_0028454 Ga0495665_0028454_598_1635 339
453 3300046533 Ga0495640_0001333 Ga0495640_0001333_4611_5633 339
454 3300046533 Ga0495640_0169056 Ga0495640_0169056_107_1168 339
455 3300046535 Ga0495586_0003317 Ga0495586_0003317_2580_3602 339
456 3300046536 Ga0495587_0000024 Ga0495587_0000024_106566_107600 339
457 3300046536 Ga0495587_0067226 Ga0495587_0067226_747_1769 339
458 3300046543 Ga0495645_0026089 Ga0495645_0026089_2892_3914 339
459 3300046543 Ga0495645_0218584 Ga0495645_0218584_242_1264 339
460 3300046543 Ga0495645_0262903 Ga0495645_0262903_47_1084 339
461 3300046557 Ga0495622_0035469 Ga0495622_0035469_309_1331 339
462 3300046559 Ga0495667_0000024 Ga0495667_0000024_126125_127159 339
463 3300046559 Ga0495667_0016932 Ga0495667_0016932_1009_2031 339
464 3300046642 Ga0495634_0029983 Ga0495634_0029983_512_1549 339
465 3300046642 Ga0495634_0061977 Ga0495634_0061977_270_1307 339
466 3300046663 Ga0495635_0015699 Ga0495635_0015699_2898_3935 339
467 3300046663 Ga0495635_0077101 Ga0495635_0077101_274_1311 339
468 3300046674 Ga0495588_0100893 Ga0495588_0100893_222_1259 339
469 3300046675 Ga0495657_0000121 Ga0495657_0000121_41141_42175 339
470 3300046675 Ga0495657_0011263 Ga0495657_0011263_1301_2323 339
471 3300046675 Ga0495657_0022148 Ga0495657_0022148_1204_2241 339
472 3300046678 Ga0495599_0000147 Ga0495599_0000147_20802_21836 339
473 3300046678 Ga0495599_0026350 Ga0495599_0026350_2420_3457 339
474 3300046679 Ga0495623_0005725 Ga0495623_0005725_6900_7934 339
475 3300046679 Ga0495623_0071085 Ga0495623_0071085_66_1109 339
476 3300046680 Ga0495646_0017216 Ga0495646_0017216_316_1353 339
477 3300046680 Ga0495646_0047107 Ga0495646_0047107_929_1963 339
478 3300046681 Ga0495647_0084753 Ga0495647_0084753_35_1057 339
479 3300046683 Ga0495658_0023344 Ga0495658_0023344_2038_3075 339
480 3300046689 Ga0495613_0004929 Ga0495613_0004929_1347_2369 339
481 3300046690 Ga0495624_0000590 Ga0495624_0000590_21678_22700 339
482 3300046809 Ga0495600_0000969 Ga0495600_0000969_1269_2303 339
483 3300046809 Ga0495600_0003937 Ga0495600_0003937_7412_8434 339
484 3300047315 Ga0495581_0002158 Ga0495581_0002158_6904_7926 339
485 3300047315 Ga0495581_0040874 Ga0495581_0040874_68_1105 339
486 3300047317 Ga0495604_0000024 Ga0495604_0000024_106383_107417 339
487 3300047317 Ga0495604_0013137 Ga0495604_0013137_1581_2603 339
488 3300047317 Ga0495604_0038152 Ga0495604_0038152_2144_3181 339
489 3300047321 Ga0495676_0012245 Ga0495676_0012245_6476_7498 339
490 3300047321 Ga0495676_0043544 Ga0495676_0043544_326_1363 339
491 3300047321 Ga0495676_0109686 Ga0495676_0109686_304_1341 339
492 3300047322 Ga0495680_0000005 Ga0495680_0000005_41129_42163 339
493 3300047322 Ga0495680_0007072 Ga0495680_0007072_1519_2541 339
494 3300047444 Ga0495675_0003613 Ga0495675_0003613_6855_7889 339
495 3300047471 Ga0495684_0002509 Ga0495684_0002509_8823_9845 339
496 3300047471 Ga0495684_0135067 Ga0495684_0135067_620_1642 339
497 3300047673 Ga0495593_0022942 Ga0495593_0022942_301_1323 339
498 3300047673 Ga0495593_0024694 Ga0495593_0024694_1658_2695 339
499 3300048088 Ga0495602_0000198 Ga0495602_0000198_12548_13582 339
500 3300048088 Ga0495602_0196016 Ga0495602_0196016_103_1125 339
501 3300048089 Ga0495614_0010473 Ga0495614_0010473_952_1995 339
502 3300048903 Ga0496100_0275979 Ga0496100_0275979_35_1183 339
503 3300048904 Ga0496101_0011639 Ga0496101_0011639_2525_3562 339
504 3300048904 Ga0496101_0107391 Ga0496101_0107391_366_1415 339
505 3300048904 Ga0496101_0279988 Ga0496101_0279988_108_1151 339
506 3300048905 Ga0496102_0039903 Ga0496102_0039903_2901_3944 339
507 3300048905 Ga0496102_0186101 Ga0496102_0186101_567_1607 339
508 3300048905 Ga0496102_0200438 Ga0496102_0200438_256_1290 339
509 3300048906 Ga0496103_0074606 Ga0496103_0074606_313_1350 339
510 3300048906 Ga0496103_0082117 Ga0496103_0082117_45_1088 339
511 3300048907 Ga0496104_0013971 Ga0496104_0013971_5105_6139 339
512 3300048907 Ga0496104_0048802 Ga0496104_0048802_726_1874 339
513 3300048907 Ga0496104_0139080 Ga0496104_0139080_390_1427 339
514 3300048907 Ga0496104_0199404 Ga0496104_0199404_532_1575 339
515 3300048908 Ga0496105_0001663 Ga0496105_0001663_1136_2170 339
516 3300048908 Ga0496105_0007219 Ga0496105_0007219_4268_5305 339
517 3300048908 Ga0496105_0009644 Ga0496105_0009644_4461_5504 339
518 3300048909 Ga0496106_0050943 Ga0496106_0050943_595_1638 339
519 3300048909 Ga0496106_0275017 Ga0496106_0275017_43_1089 339
520 3300048910 Ga0496107_0163849 Ga0496107_0163849_541_1578 339
521 3300048911 Ga0496108_0000699 Ga0496108_0000699_608_1657 339
522 3300048911 Ga0496108_0006352 Ga0496108_0006352_5198_6232 339
523 3300048911 Ga0496108_0013794 Ga0496108_0013794_5157_6200 339
524 3300048911 Ga0496108_0131370 Ga0496108_0131370_459_1607 339
525 3300048912 Ga0496109_0002411 Ga0496109_0002411_12545_13588 339
526 3300048912 Ga0496109_0002951 Ga0496109_0002951_12619_13653 339
527 3300048912 Ga0496109_0030488 Ga0496109_0030488_1142_2290 339
528 3300048913 Ga0496110_0000964 Ga0496110_0000964_17709_18758 339
529 3300048913 Ga0496110_0036332 Ga0496110_0036332_1019_2065 339
530 3300048913 Ga0496110_0096467 Ga0496110_0096467_360_1508 339
531 3300048913 Ga0496110_0300377 Ga0496110_0300377_396_1433 339
532 3300048913 Ga0496110_0322336 Ga0496110_0322336_350_1384 339
533 3300048914 Ga0496111_0002511 Ga0496111_0002511_3073_4116 339
534 3300048914 Ga0496111_0029572 Ga0496111_0029572_1678_2826 339
535 3300048914 Ga0496111_0051776 Ga0496111_0051776_66_1115 339
536 3300048914 Ga0496111_0089630 Ga0496111_0089630_528_1562 339
537 3300048915 Ga0496112_0008446 Ga0496112_0008446_2427_3461 339
538 3300048915 Ga0496112_0156970 Ga0496112_0156970_449_1492 339
539 3300048915 Ga0496112_0328858 Ga0496112_0328858_196_1233 339
540 3300048916 Ga0496113_0037712 Ga0496113_0037712_1215_2249 339
541 3300048916 Ga0496113_0055172 Ga0496113_0055172_1371_2519 339
542 3300048916 Ga0496113_0097975 Ga0496113_0097975_953_1996 339
543 3300048917 Ga0496114_0035702 Ga0496114_0035702_375_1418 339
544 3300048917 Ga0496114_0177574 Ga0496114_0177574_434_1471 339
545 3300048918 Ga0496115_0046685 Ga0496115_0046685_670_1707 339
546 3300048918 Ga0496115_0057982 Ga0496115_0057982_1839_2873 339
547 3300050507 nmdc:mga05p37_30825_c1 nmdc:mga05p37_30825_c1_1183_2220 339
548 3300050512 nmdc:mga0n895_16547_c1 nmdc:mga0n895_16547_c1_1346_2383 339
549 3300050512 nmdc:mga0n895_30906_c1 nmdc:mga0n895_30906_c1_3921_4955 339
550 3300050513 nmdc:mga0rr50_101215_c1 nmdc:mga0rr50_101215_c1_369_1406 339
551 3300050513 nmdc:mga0rr50_3773_c1 nmdc:mga0rr50_3773_c1_4519_5553 339
552 3300050514 nmdc:mga08x19_6579_c1 nmdc:mga08x19_6579_c1_451_1485 339
553 3300050514 nmdc:mga08x19_89201_c1 nmdc:mga08x19_89201_c1_62_1096 339
554 3300050515 nmdc:mga0a205_127950_c1 nmdc:mga0a205_127950_c1_1335_2369 339
555 3300050515 nmdc:mga0a205_21165_c1 nmdc:mga0a205_21165_c1_4127_5164 339
556 3300053077 Ga0495601_0005539 Ga0495601_0005539_4826_5848 339
557 3300053084 Ga0495595_0002796 Ga0495595_0002796_5192_6226 339
558 3300053084 Ga0495595_0023996 Ga0495595_0023996_923_1945 339
559 3300053084 Ga0495595_0065463 Ga0495595_0065463_40_1077 339
560 3300053085 Ga0495619_0018349 Ga0495619_0018349_3162_4199 339
561 3300053085 Ga0495619_0046944 Ga0495619_0046944_932_1954 339
562 3300053085 Ga0495619_0168726 Ga0495619_0168726_24_1046 339
563 3300053153 Ga0500616_0000601 Ga0500616_0000601_27049_28092 339
564 3300053153 Ga0500616_0001662 Ga0500616_0001662_17973_19016 339
565 iso_pu_bacteria 2734482000 2734971295 339
566 3300005434 Ga0070709_10001054 Ga0070709_100010548 340
567 3300005435 Ga0070714_100003000 Ga0070714_1000030006 340
568 3300005436 Ga0070713_100004246 Ga0070713_1000042466 340
569 3300005437 Ga0070710_10002866 Ga0070710_100028666 340
570 3300005439 Ga0070711_100002119 Ga0070711_1000021198 340
571 3300005468 Ga0070707_100013680 Ga0070707_1000136806 340
572 3300005471 Ga0070698_100030848 Ga0070698_1000308482 340
573 3300005536 Ga0070697_100030377 Ga0070697_1000303774 340
574 3300006028 Ga0070717_10016279 Ga0070717_100162795 340
575 3300006163 Ga0070715_10079234 Ga0070715_100792342 340
576 3300006173 Ga0070716_100008672 Ga0070716_1000086725 340
577 3300006175 Ga0070712_100007917 Ga0070712_1000079174 340
578 3300025898 Ga0207692_10002566 Ga0207692_100025665 340
579 3300025905 Ga0207685_10006692 Ga0207685_100066922 340
580 3300025906 Ga0207699_10000629 Ga0207699_1000062911 340
581 3300025915 Ga0207693_10009218 Ga0207693_100092184 340
582 3300025916 Ga0207663_10089920 Ga0207663_100899202 340
583 3300025922 Ga0207646_10121481 Ga0207646_101214812 340
584 3300025928 Ga0207700_10001515 Ga0207700_100015157 340
585 3300025929 Ga0207664_10000725 Ga0207664_100007256 340
586 3300025939 Ga0207665_10014440 Ga0207665_100144405 340
587 3300003659 JGI25404J52841_10005468 JGI25404J52841_100054682 342
588 3300005337 Ga0070682_100096773 Ga0070682_1000967732 342
589 3300005338 Ga0068868_100068682 Ga0068868_1000686822 342
590 3300005366 Ga0070659_100102539 Ga0070659_1001025392 342
591 3300005436 Ga0070713_100205290 Ga0070713_1002052902 342
592 3300005444 Ga0070694_100139907 Ga0070694_1001399071 342
593 3300005530 Ga0070679_100154814 Ga0070679_1001548142 342
594 3300005546 Ga0070696_100150923 Ga0070696_1001509232 342
595 3300005577 Ga0068857_100060392 Ga0068857_1000603922 342
596 3300005615 Ga0070702_100030189 Ga0070702_1000301893 342
597 3300005616 Ga0068852_100197413 Ga0068852_1001974132 342
598 3300005834 Ga0068851_10087552 Ga0068851_100875522 342
599 3300005983 Ga0081540_1000251 Ga0081540_100025153 342
600 3300006237 Ga0097621_100038113 Ga0097621_1000381132 342
601 3300009036 Ga0105244_10055981 Ga0105244_100559811 342
602 3300011119 Ga0105246_10059406 Ga0105246_100594062 342
603 3300013102 Ga0157371_10043493 Ga0157371_100434932 342
604 3300013308 Ga0157375_10128142 Ga0157375_101281422 342
605 3300025904 Ga0207647_10040693 Ga0207647_100406932 342
606 3300025906 Ga0207699_10084631 Ga0207699_100846312 342
607 3300025908 Ga0207643_10011015 Ga0207643_100110156 342
608 3300025919 Ga0207657_10059413 Ga0207657_100594131 342
609 3300025929 Ga0207664_10031034 Ga0207664_100310342 342
610 3300025939 Ga0207665_10109103 Ga0207665_101091032 342
611 3300025981 Ga0207640_10029853 Ga0207640_100298532 342
612 3300026116 Ga0207674_10028952 Ga0207674_100289523 342
613 3300035207 Ga0373942_0036599 Ga0373942_0036599_182_1234 342
614 3300048906 Ga0496103_0017956 Ga0496103_0017956_2092_3249 342
615 3300048909 Ga0496106_0101693 Ga0496106_0101693_1132_2193 342
616 3300048910 Ga0496107_0016058 Ga0496107_0016058_2997_4154 342
617 3300048918 Ga0496115_0112255 Ga0496115_0112255_458_1615 342
618 3300048929 Ga0496126_0335961 Ga0496126_0335961_146_1207 342

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02574

S-methyl_trans

Homocysteine S-methyltransferase

62

349

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1q8a-assembly2.cif.gz_B cobalamin-dependent methionine synthase (1-566) from thermotoga maritima (cd2+:l-hcy complex, se-met) 0.913 15 311
1q8j-assembly2.cif.gz_B cobalamin-dependent methionine synthase (1-566) from thermotoga maritima (cd2+, hcy, methyltetrahydrofolate complex) 0.9067 15 311
3bol-assembly1.cif.gz_B cobalamin-dependent methionine synthase (1-566) from thermotoga maritima complexed with zn2+ 0.8952 14 312
1q85-assembly2.cif.gz_B cobalamin-dependent methionine synthase (1-566) from thermotoga maritima (cd2+ complex, se-met) 0.8906 15 311
8d45-assembly1.cif.gz_C cryo-em structure of human kidney betaine-homocysteine methyltransferase 0.8904 1 336
ID Description Score Start End Superfamily
1q85B01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Homocysteine-binding-like domain 0.8879 15 311 3.20.20.330
1lt7B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Homocysteine-binding-like domain 0.8699 3 335 3.20.20.330
af_Q2G121_2_294_3.20.20.330 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Homocysteine-binding-like domain 0.8686 15 310 3.20.20.330
4m3pA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Homocysteine-binding-like domain 0.843 3 335 3.20.20.330
5dmnB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Homocysteine-binding-like domain 0.8326 8 306 3.20.20.330
ID Description Score Start End GO Terms
AF-A0A8B6F4G1-F1-model_v4 Hcy-binding domain-containing protein 0.9715 17 254 GO:0008168
GO:0008270
GO:0009086
GO:0032259
AF-A0A7V9BEQ1-F1-model_v4 Homocysteine S-methyltransferase family protein 0.97 2 234 GO:0008168
GO:0008270
GO:0009086
GO:0032259
AF-A0A534CAH7-F1-model_v4 Homocysteine S-methyltransferase family protein 0.9692 59 340 GO:0008168
GO:0008270
GO:0009086
GO:0032259
AF-A0A2K2VXC3-F1-model_v4 Homocysteine methyltransferase 0.9689 5 341 GO:0008168
GO:0008270
GO:0009086
GO:0032259
AF-N4WPN7-F1-model_v4 Homocysteine S-methyltransferase 0.9669 28 340 GO:0008168
GO:0008270
GO:0009086
GO:0032259

Feature Viewer

pLDDT pTM Quality
92.26 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map