F469725
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 618 | 285 | 617 | 347 |
Family's Representative Sequence
| Representative Sequence | 3300009036|Ga0105244_10055981|Ga0105244_100559811 |
| Length | 385 |
| Sequence | VGRVLAQLALQQGTVYDIGRFTSARFGGVAERVGFVSELEGRVSSSIVDRLADQGSGPVLGAEGYVFELERRGYIKAGPFVPEVVLDYPDAVRELHREFLRAGADVMVALTYYAHREKLRDVGREGDLEAMNRQAVRLAREVASEGDALVAGNVCNTWAYDPDDPATGQTVRAMYTEQLGWAVEEGVDFVISETNDYLGEALIAVEVIRDLGLPAMVTLAPTQPDQTRDGYGYAEACRILAAEGAQVVGLNCDRGPLTMLPLVADIRQAVDCAVAVQPVPYRTDAAAPTMETLRSADGDRAFPIALDSFTCTRFEMAQFAAQARELGVDYVGICCGAGPHHVRAMAEALGREVPASKYSPSMDLHPMFRADVAAKDAAFLHSWSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2734482000 | Kineosporia rhizophila JCM 9960 | Isolate | Unclassified |
| 2 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 25 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 46 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 51 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 52 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 53 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 54 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 61 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 62 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 63 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 64 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 65 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 66 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 86 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 87 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 88 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 89 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 90 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 131 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 132 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 133 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 134 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 135 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 136 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 137 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 138 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 139 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 140 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 141 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 142 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 143 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 144 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 145 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 146 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 147 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 148 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 149 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 150 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 151 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 152 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 153 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 154 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 155 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 156 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 157 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 158 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 159 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 160 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 161 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 162 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 163 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 164 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 165 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 166 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 167 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 168 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 169 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 170 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 171 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 172 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 173 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 174 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 175 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 176 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 177 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 178 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 179 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 180 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 181 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 183 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 184 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 185 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 186 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 187 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 188 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 189 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 190 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 191 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 192 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 193 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 194 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 195 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 196 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 197 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 198 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 199 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 200 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 201 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 202 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 203 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 204 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 257 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 258 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 259 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 260 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 261 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 262 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 265 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 266 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 267 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 268 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 269 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 270 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 271 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 284 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 285 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.84 |
| Metatranscriptomes | 0 |
| Isolates | 0.16 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.65 |
| Nodule | 0 |
| Rhizoplane | 11.65 |
| Rhizosphere | 84.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25404J52841_10005468 | 3300003659 | Bacteria | 2625 |
| 2 | JGI25404J52841_10024711 | 3300003659 | Bacteria | 1294 |
| 3 | Ga0070683_100095733 | 3300005329 | Bacteria | 2792 |
| 4 | Ga0068869_100167926 | 3300005334 | Bacteria | 1712 |
| 5 | Ga0070682_100028659 | 3300005337 | Bacteria | 3350 |
| 6 | Ga0070682_100096773 | 3300005337 | Bacteria | 1941 |
| 7 | Ga0070682_100098893 | 3300005337 | Bacteria | 1923 |
| 8 | Ga0068868_100068682 | 3300005338 | Bacteria | 2822 |
| 9 | Ga0070660_100079315 | 3300005339 | Bacteria | 2576 |
| 10 | Ga0070689_100062161 | 3300005340 | Bacteria | 2905 |
| 11 | Ga0070668_100054139 | 3300005347 | Bacteria | 3095 |
| 12 | Ga0070675_100074003 | 3300005354 | Unclassified | 2829 |
| 13 | Ga0070671_100066715 | 3300005355 | Unclassified | 2999 |
| 14 | Ga0070674_100249688 | 3300005356 | Bacteria | 1393 |
| 15 | Ga0070659_100102539 | 3300005366 | Bacteria | 2304 |
| 16 | Ga0070667_100263835 | 3300005367 | Unclassified | 1543 |
| 17 | Ga0070709_10001054 | 3300005434 | Bacteria | 15212 |
| 18 | Ga0070709_10035032 | 3300005434 | Bacteria | 3048 |
| 19 | Ga0070714_100003000 | 3300005435 | Bacteria | 12514 |
| 20 | Ga0070714_100017113 | 3300005435 | Bacteria | 5869 |
| 21 | Ga0070714_100058482 | 3300005435 | Bacteria | 3303 |
| 22 | Ga0070713_100004246 | 3300005436 | Bacteria | 9579 |
| 23 | Ga0070713_100120281 | 3300005436 | Bacteria | 2302 |
| 24 | Ga0070713_100205290 | 3300005436 | Bacteria | 1781 |
| 25 | Ga0070710_10002866 | 3300005437 | Bacteria | 8210 |
| 26 | Ga0070710_10007980 | 3300005437 | Bacteria | 5148 |
| 27 | Ga0070710_10056320 | 3300005437 | Bacteria | 2224 |
| 28 | Ga0070711_100002119 | 3300005439 | Bacteria | 11234 |
| 29 | Ga0070694_100139907 | 3300005444 | Unclassified | 1757 |
| 30 | Ga0070708_100004332 | 3300005445 | Bacteria | 11147 |
| 31 | Ga0070708_100010622 | 3300005445 | Bacteria | 7464 |
| 32 | Ga0070708_100022016 | 3300005445 | Bacteria | 5402 |
| 33 | Ga0070708_100073307 | 3300005445 | Bacteria | 3085 |
| 34 | Ga0070708_100269466 | 3300005445 | Bacteria | 1601 |
| 35 | Ga0070663_100040425 | 3300005455 | Bacteria | 3264 |
| 36 | Ga0070681_10095741 | 3300005458 | Bacteria | 2917 |
| 37 | Ga0070681_10170089 | 3300005458 | Bacteria | 2101 |
| 38 | Ga0068867_100144473 | 3300005459 | Bacteria | 1863 |
| 39 | Ga0070685_10148840 | 3300005466 | Unclassified | 1482 |
| 40 | Ga0070685_10195136 | 3300005466 | Bacteria | 1313 |
| 41 | Ga0070706_100003350 | 3300005467 | Bacteria | 15807 |
| 42 | Ga0070706_100007331 | 3300005467 | Bacteria | 10347 |
| 43 | Ga0070706_100008557 | 3300005467 | Bacteria | 9536 |
| 44 | Ga0070706_100011810 | 3300005467 | Bacteria | 8108 |
| 45 | Ga0070706_100041687 | 3300005467 | Bacteria | 4239 |
| 46 | Ga0070706_100045756 | 3300005467 | Bacteria | 4041 |
| 47 | Ga0070706_100058586 | 3300005467 | Bacteria | 3554 |
| 48 | Ga0070706_100231663 | 3300005467 | Bacteria | 1724 |
| 49 | Ga0070706_100232364 | 3300005467 | Bacteria | 1721 |
| 50 | Ga0070707_100001852 | 3300005468 | Bacteria | 20316 |
| 51 | Ga0070707_100013680 | 3300005468 | Bacteria | 7597 |
| 52 | Ga0070707_100014484 | 3300005468 | Bacteria | 7390 |
| 53 | Ga0070707_100017961 | 3300005468 | Bacteria | 6651 |
| 54 | Ga0070707_100025995 | 3300005468 | Bacteria | 5556 |
| 55 | Ga0070707_100041084 | 3300005468 | Unclassified | 4426 |
| 56 | Ga0070707_100213725 | 3300005468 | Unclassified | 1879 |
| 57 | Ga0070707_100229568 | 3300005468 | Bacteria | 1807 |
| 58 | Ga0070698_100001492 | 3300005471 | Bacteria | 25989 |
| 59 | Ga0070698_100002646 | 3300005471 | Bacteria | 19744 |
| 60 | Ga0070698_100004059 | 3300005471 | Bacteria | 16101 |
| 61 | Ga0070698_100004413 | 3300005471 | Bacteria | 15458 |
| 62 | Ga0070698_100030848 | 3300005471 | Bacteria | 5558 |
| 63 | Ga0070698_100052130 | 3300005471 | Unclassified | 4164 |
| 64 | Ga0070698_100056549 | 3300005471 | Bacteria | 3975 |
| 65 | Ga0070698_100060077 | 3300005471 | Bacteria | 3836 |
| 66 | Ga0070698_100091738 | 3300005471 | Bacteria | 3020 |
| 67 | Ga0070698_100100625 | 3300005471 | Unclassified | 2863 |
| 68 | Ga0070698_100109975 | 3300005471 | Bacteria | 2722 |
| 69 | Ga0070698_100250635 | 3300005471 | Bacteria | 1703 |
| 70 | Ga0070698_100274950 | 3300005471 | Bacteria | 1616 |
| 71 | Ga0070699_100001142 | 3300005518 | Bacteria | 24670 |
| 72 | Ga0070699_100006327 | 3300005518 | Bacteria | 10325 |
| 73 | Ga0070699_100048972 | 3300005518 | Unclassified | 3657 |
| 74 | Ga0070699_100105945 | 3300005518 | Bacteria | 2466 |
| 75 | Ga0070699_100115633 | 3300005518 | Bacteria | 2357 |
| 76 | Ga0070699_100197415 | 3300005518 | Unclassified | 1789 |
| 77 | Ga0070679_100017896 | 3300005530 | Bacteria | 6864 |
| 78 | Ga0070679_100154814 | 3300005530 | Bacteria | 2267 |
| 79 | Ga0070684_100024436 | 3300005535 | Bacteria | 5070 |
| 80 | Ga0070684_100028797 | 3300005535 | Bacteria | 4700 |
| 81 | Ga0070697_100001890 | 3300005536 | Bacteria | 16009 |
| 82 | Ga0070697_100010665 | 3300005536 | Bacteria | 7172 |
| 83 | Ga0070697_100017641 | 3300005536 | Bacteria | 5622 |
| 84 | Ga0070697_100026241 | 3300005536 | Bacteria | 4652 |
| 85 | Ga0070697_100030377 | 3300005536 | Bacteria | 4340 |
| 86 | Ga0068853_100270137 | 3300005539 | Bacteria | 1566 |
| 87 | Ga0070686_100081314 | 3300005544 | Bacteria | 2146 |
| 88 | Ga0070696_100150923 | 3300005546 | Bacteria | 1705 |
| 89 | Ga0070665_100093063 | 3300005548 | Bacteria | 3019 |
| 90 | Ga0068855_100013363 | 3300005563 | Bacteria | 9903 |
| 91 | Ga0070664_100309565 | 3300005564 | Bacteria | 1429 |
| 92 | Ga0068857_100060392 | 3300005577 | Bacteria | 3367 |
| 93 | Ga0068854_100201303 | 3300005578 | Bacteria | 1565 |
| 94 | Ga0068856_100061143 | 3300005614 | Bacteria | 3721 |
| 95 | Ga0070702_100030189 | 3300005615 | Bacteria | 2953 |
| 96 | Ga0070702_100032016 | 3300005615 | Bacteria | 2883 |
| 97 | Ga0068852_100197413 | 3300005616 | Bacteria | 1902 |
| 98 | Ga0068864_100152712 | 3300005618 | Bacteria | 2093 |
| 99 | Ga0068861_100007858 | 3300005719 | Bacteria | 7336 |
| 100 | Ga0068861_100116486 | 3300005719 | Bacteria | 2149 |
| 101 | Ga0068861_100178963 | 3300005719 | Bacteria | 1763 |
| 102 | Ga0068851_10087552 | 3300005834 | Bacteria | 1635 |
| 103 | Ga0068863_100057463 | 3300005841 | Bacteria | 3682 |
| 104 | Ga0068863_100140366 | 3300005841 | Bacteria | 2309 |
| 105 | Ga0068858_100128251 | 3300005842 | Bacteria | 2377 |
| 106 | Ga0068860_100171855 | 3300005843 | Bacteria | 2093 |
| 107 | Ga0068860_100261356 | 3300005843 | Bacteria | 1687 |
| 108 | Ga0081455_10037377 | 3300005937 | Bacteria | 4313 |
| 109 | Ga0081455_10069868 | 3300005937 | Bacteria | 2918 |
| 110 | Ga0081455_10138099 | 3300005937 | Bacteria | 1896 |
| 111 | Ga0081538_10102674 | 3300005981 | Bacteria | 1433 |
| 112 | Ga0081540_1000251 | 3300005983 | Bacteria | 56572 |
| 113 | Ga0081540_1004475 | 3300005983 | Bacteria | 10637 |
| 114 | Ga0081540_1014769 | 3300005983 | Bacteria | 4979 |
| 115 | Ga0081539_10002380 | 3300005985 | Bacteria | 26874 |
| 116 | Ga0081539_10004254 | 3300005985 | Bacteria | 16066 |
| 117 | Ga0081539_10012438 | 3300005985 | Bacteria | 6561 |
| 118 | Ga0081539_10015847 | 3300005985 | Bacteria | 5438 |
| 119 | Ga0081539_10051188 | 3300005985 | Bacteria | 2330 |
| 120 | Ga0070717_10011712 | 3300006028 | Bacteria | 6671 |
| 121 | Ga0070717_10016279 | 3300006028 | Bacteria | 5763 |
| 122 | Ga0070717_10016411 | 3300006028 | Bacteria | 5739 |
| 123 | Ga0070717_10034398 | 3300006028 | Unclassified | 4096 |
| 124 | Ga0070717_10044572 | 3300006028 | Bacteria | 3623 |
| 125 | Ga0070717_10112880 | 3300006028 | Unclassified | 2320 |
| 126 | Ga0070717_10249911 | 3300006028 | Bacteria | 1566 |
| 127 | Ga0070717_10408504 | 3300006028 | Unclassified | 1220 |
| 128 | Ga0070715_10033471 | 3300006163 | Bacteria | 2100 |
| 129 | Ga0070715_10047211 | 3300006163 | Bacteria | 1834 |
| 130 | Ga0070715_10079234 | 3300006163 | Bacteria | 1487 |
| 131 | Ga0070716_100008672 | 3300006173 | Bacteria | 5050 |
| 132 | Ga0070716_100078426 | 3300006173 | Unclassified | 1964 |
| 133 | Ga0070716_100081721 | 3300006173 | Bacteria | 1930 |
| 134 | Ga0070716_100113164 | 3300006173 | Bacteria | 1685 |
| 135 | Ga0070716_100122611 | 3300006173 | Bacteria | 1630 |
| 136 | Ga0070712_100007917 | 3300006175 | Bacteria | 6662 |
| 137 | Ga0070712_100023366 | 3300006175 | Bacteria | 4083 |
| 138 | Ga0070712_100283054 | 3300006175 | Bacteria | 1336 |
| 139 | Ga0097621_100038113 | 3300006237 | Bacteria | 3856 |
| 140 | Ga0068871_100080604 | 3300006358 | Bacteria | 2695 |
| 141 | Ga0068871_100285509 | 3300006358 | Bacteria | 1445 |
| 142 | Ga0075431_100261425 | 3300006847 | Bacteria | 1756 |
| 143 | Ga0075433_10058299 | 3300006852 | Bacteria | 3377 |
| 144 | Ga0075433_10137835 | 3300006852 | Bacteria | 2169 |
| 145 | Ga0075434_100003966 | 3300006871 | Bacteria | 13258 |
| 146 | Ga0075434_100081895 | 3300006871 | Bacteria | 3224 |
| 147 | Ga0075434_100132291 | 3300006871 | Bacteria | 2514 |
| 148 | Ga0075436_100004661 | 3300006914 | Bacteria | 9395 |
| 149 | Ga0075436_100010988 | 3300006914 | Bacteria | 6216 |
| 150 | Ga0075435_100004546 | 3300007076 | Bacteria | 9541 |
| 151 | Ga0075435_100047059 | 3300007076 | Bacteria | 3462 |
| 152 | Ga0075435_100074095 | 3300007076 | Bacteria | 2784 |
| 153 | Ga0075435_100151377 | 3300007076 | Bacteria | 1951 |
| 154 | Ga0099794_10077202 | 3300007265 | Bacteria | 1638 |
| 155 | Ga0105251_10014638 | 3300009011 | Bacteria | 4325 |
| 156 | Ga0105244_10055981 | 3300009036 | Bacteria | 1997 |
| 157 | Ga0111539_10002081 | 3300009094 | Bacteria | 26737 |
| 158 | Ga0111539_10062238 | 3300009094 | Bacteria | 4418 |
| 159 | Ga0111539_10437488 | 3300009094 | Bacteria | 1523 |
| 160 | Ga0105247_10103407 | 3300009101 | Bacteria | 1824 |
| 161 | Ga0105247_10147362 | 3300009101 | Unclassified | 1548 |
| 162 | Ga0114129_10013858 | 3300009147 | Bacteria | 11487 |
| 163 | Ga0114129_10468521 | 3300009147 | Unclassified | 1650 |
| 164 | Ga0105243_10005512 | 3300009148 | Bacteria | 9865 |
| 165 | Ga0105248_10079472 | 3300009177 | Bacteria | 3686 |
| 166 | Ga0105248_10158614 | 3300009177 | Unclassified | 2553 |
| 167 | Ga0105249_10137445 | 3300009553 | Bacteria | 2340 |
| 168 | Ga0105246_10015359 | 3300011119 | Bacteria | 4835 |
| 169 | Ga0105246_10059406 | 3300011119 | Unclassified | 2652 |
| 170 | Ga0157371_10043493 | 3300013102 | Bacteria | 3199 |
| 171 | Ga0157369_10070048 | 3300013105 | Bacteria | 3768 |
| 172 | Ga0157378_10461414 | 3300013297 | Bacteria | 1262 |
| 173 | Ga0163162_10050417 | 3300013306 | Bacteria | 4174 |
| 174 | Ga0163162_10128984 | 3300013306 | Bacteria | 2637 |
| 175 | Ga0157372_10173121 | 3300013307 | Bacteria | 2498 |
| 176 | Ga0157375_10128142 | 3300013308 | Bacteria | 2656 |
| 177 | Ga0157375_10661536 | 3300013308 | Bacteria | 1200 |
| 178 | Ga0163163_10012499 | 3300014325 | Bacteria | 7738 |
| 179 | Ga0163163_10098472 | 3300014325 | Bacteria | 2945 |
| 180 | Ga0163163_10352754 | 3300014325 | Bacteria | 1527 |
| 181 | Ga0157380_10086384 | 3300014326 | Unclassified | 2577 |
| 182 | Ga0157379_10109260 | 3300014968 | Bacteria | 2483 |
| 183 | Ga0157376_10122454 | 3300014969 | Bacteria | 2308 |
| 184 | Ga0157376_10152166 | 3300014969 | Bacteria | 2087 |
| 185 | Ga0213873_10035523 | 3300021358 | Unclassified | 1261 |
| 186 | Ga0213874_10006597 | 3300021377 | Bacteria | 2752 |
| 187 | Ga0213876_10006736 | 3300021384 | Bacteria | 6273 |
| 188 | Ga0213875_10000148 | 3300021388 | Bacteria | 74125 |
| 189 | Ga0213875_10011400 | 3300021388 | Unclassified | 4422 |
| 190 | Ga0224572_1012925 | 3300024225 | Unclassified | 1591 |
| 191 | Ga0207692_10002566 | 3300025898 | Bacteria | 6982 |
| 192 | Ga0207692_10005594 | 3300025898 | Bacteria | 5045 |
| 193 | Ga0207692_10029937 | 3300025898 | Bacteria | 2592 |
| 194 | Ga0207692_10061454 | 3300025898 | Bacteria | 1947 |
| 195 | Ga0207710_10046161 | 3300025900 | Bacteria | 1945 |
| 196 | Ga0207688_10013767 | 3300025901 | Bacteria | 4396 |
| 197 | Ga0207688_10116445 | 3300025901 | Unclassified | 1556 |
| 198 | Ga0207647_10000879 | 3300025904 | Bacteria | 23320 |
| 199 | Ga0207647_10040693 | 3300025904 | Bacteria | 2926 |
| 200 | Ga0207685_10000657 | 3300025905 | Bacteria | 6151 |
| 201 | Ga0207685_10006692 | 3300025905 | Bacteria | 3159 |
| 202 | Ga0207699_10000629 | 3300025906 | Bacteria | 17043 |
| 203 | Ga0207699_10006768 | 3300025906 | Bacteria | 5570 |
| 204 | Ga0207699_10017329 | 3300025906 | Bacteria | 3787 |
| 205 | Ga0207699_10031377 | 3300025906 | Unclassified | 2983 |
| 206 | Ga0207699_10046549 | 3300025906 | Bacteria | 2538 |
| 207 | Ga0207699_10084631 | 3300025906 | Bacteria | 1976 |
| 208 | Ga0207645_10233683 | 3300025907 | Bacteria | 1214 |
| 209 | Ga0207643_10011015 | 3300025908 | Bacteria | 4880 |
| 210 | Ga0207643_10012839 | 3300025908 | Bacteria | 4528 |
| 211 | Ga0207684_10000253 | 3300025910 | Bacteria | 79773 |
| 212 | Ga0207684_10001497 | 3300025910 | Bacteria | 25099 |
| 213 | Ga0207684_10003148 | 3300025910 | Bacteria | 16236 |
| 214 | Ga0207684_10007382 | 3300025910 | Bacteria | 9907 |
| 215 | Ga0207684_10019275 | 3300025910 | Bacteria | 5837 |
| 216 | Ga0207684_10039551 | 3300025910 | Bacteria | 3999 |
| 217 | Ga0207684_10039865 | 3300025910 | Bacteria | 3982 |
| 218 | Ga0207684_10084566 | 3300025910 | Bacteria | 2702 |
| 219 | Ga0207684_10161225 | 3300025910 | Bacteria | 1931 |
| 220 | Ga0207684_10205637 | 3300025910 | Unclassified | 1698 |
| 221 | Ga0207684_10221831 | 3300025910 | Bacteria | 1631 |
| 222 | Ga0207684_10431869 | 3300025910 | Bacteria | 1131 |
| 223 | Ga0207693_10009218 | 3300025915 | Bacteria | 8057 |
| 224 | Ga0207693_10075655 | 3300025915 | Bacteria | 2637 |
| 225 | Ga0207663_10003613 | 3300025916 | Bacteria | 7594 |
| 226 | Ga0207663_10016926 | 3300025916 | Unclassified | 4053 |
| 227 | Ga0207663_10082005 | 3300025916 | Unclassified | 2114 |
| 228 | Ga0207663_10089920 | 3300025916 | Bacteria | 2034 |
| 229 | Ga0207657_10059413 | 3300025919 | Unclassified | 3285 |
| 230 | Ga0207652_10002441 | 3300025921 | Bacteria | 15700 |
| 231 | Ga0207646_10001473 | 3300025922 | Bacteria | 29119 |
| 232 | Ga0207646_10002713 | 3300025922 | Bacteria | 20752 |
| 233 | Ga0207646_10002949 | 3300025922 | Bacteria | 19708 |
| 234 | Ga0207646_10007561 | 3300025922 | Bacteria | 11014 |
| 235 | Ga0207646_10016968 | 3300025922 | Bacteria | 6823 |
| 236 | Ga0207646_10039287 | 3300025922 | Unclassified | 4259 |
| 237 | Ga0207646_10060949 | 3300025922 | Bacteria | 3368 |
| 238 | Ga0207646_10084322 | 3300025922 | Bacteria | 2843 |
| 239 | Ga0207646_10120187 | 3300025922 | Bacteria | 2360 |
| 240 | Ga0207646_10121481 | 3300025922 | Bacteria | 2347 |
| 241 | Ga0207646_10320933 | 3300025922 | Unclassified | 1400 |
| 242 | Ga0207646_10422108 | 3300025922 | Bacteria | 1204 |
| 243 | Ga0207659_10092465 | 3300025926 | Bacteria | 2262 |
| 244 | Ga0207687_10015600 | 3300025927 | Bacteria | 4984 |
| 245 | Ga0207687_10047199 | 3300025927 | Bacteria | 2985 |
| 246 | Ga0207700_10001515 | 3300025928 | Bacteria | 13161 |
| 247 | Ga0207700_10002599 | 3300025928 | Bacteria | 10386 |
| 248 | Ga0207700_10010060 | 3300025928 | Bacteria | 5945 |
| 249 | Ga0207700_10015276 | 3300025928 | Bacteria | 5057 |
| 250 | Ga0207700_10048048 | 3300025928 | Bacteria | 3166 |
| 251 | Ga0207700_10062428 | 3300025928 | Bacteria | 2830 |
| 252 | Ga0207700_10108935 | 3300025928 | Bacteria | 2225 |
| 253 | Ga0207700_10132655 | 3300025928 | Unclassified | 2036 |
| 254 | Ga0207700_10224320 | 3300025928 | Bacteria | 1595 |
| 255 | Ga0207664_10000725 | 3300025929 | Bacteria | 22432 |
| 256 | Ga0207664_10030230 | 3300025929 | Bacteria | 4136 |
| 257 | Ga0207664_10031034 | 3300025929 | Bacteria | 4085 |
| 258 | Ga0207664_10042027 | 3300025929 | Bacteria | 3565 |
| 259 | Ga0207664_10079766 | 3300025929 | Bacteria | 2658 |
| 260 | Ga0207644_10110735 | 3300025931 | Bacteria | 2076 |
| 261 | Ga0207644_10289002 | 3300025931 | Bacteria | 1318 |
| 262 | Ga0207706_10303099 | 3300025933 | Bacteria | 1392 |
| 263 | Ga0207670_10041944 | 3300025936 | Bacteria | 3012 |
| 264 | Ga0207665_10014440 | 3300025939 | Bacteria | 5202 |
| 265 | Ga0207665_10109103 | 3300025939 | Unclassified | 1942 |
| 266 | Ga0207665_10129287 | 3300025939 | Unclassified | 1791 |
| 267 | Ga0207665_10132085 | 3300025939 | Unclassified | 1774 |
| 268 | Ga0207665_10134025 | 3300025939 | Bacteria | 1761 |
| 269 | Ga0207689_10005636 | 3300025942 | Bacteria | 11157 |
| 270 | Ga0207689_10163691 | 3300025942 | Bacteria | 1833 |
| 271 | Ga0207689_10340119 | 3300025942 | Unclassified | 1246 |
| 272 | Ga0207661_10104916 | 3300025944 | Bacteria | 2381 |
| 273 | Ga0207679_10187880 | 3300025945 | Bacteria | 1715 |
| 274 | Ga0207679_10324153 | 3300025945 | Bacteria | 1335 |
| 275 | Ga0207667_10024494 | 3300025949 | Bacteria | 6625 |
| 276 | Ga0207712_10039804 | 3300025961 | Bacteria | 3222 |
| 277 | Ga0207712_10087859 | 3300025961 | Bacteria | 2281 |
| 278 | Ga0207668_10086767 | 3300025972 | Bacteria | 2287 |
| 279 | Ga0207640_10029853 | 3300025981 | Unclassified | 3352 |
| 280 | Ga0207677_10048749 | 3300026023 | Bacteria | 2853 |
| 281 | Ga0207639_10254992 | 3300026041 | Bacteria | 1531 |
| 282 | Ga0207678_10009825 | 3300026067 | Bacteria | 8409 |
| 283 | Ga0207678_10066656 | 3300026067 | Bacteria | 3091 |
| 284 | Ga0207708_10237008 | 3300026075 | Unclassified | 1466 |
| 285 | Ga0207702_10024493 | 3300026078 | Bacteria | 5008 |
| 286 | Ga0207702_10084537 | 3300026078 | Unclassified | 2763 |
| 287 | Ga0207702_10328845 | 3300026078 | Bacteria | 1457 |
| 288 | Ga0207648_10173445 | 3300026089 | Bacteria | 1907 |
| 289 | Ga0207676_10078187 | 3300026095 | Unclassified | 2679 |
| 290 | Ga0207676_10176511 | 3300026095 | Unclassified | 1866 |
| 291 | Ga0207676_10209801 | 3300026095 | Bacteria | 1727 |
| 292 | Ga0207674_10028952 | 3300026116 | Bacteria | 5839 |
| 293 | Ga0207674_10059235 | 3300026116 | Bacteria | 3876 |
| 294 | Ga0207675_100024791 | 3300026118 | Bacteria | 5581 |
| 295 | Ga0207675_100070897 | 3300026118 | Bacteria | 3257 |
| 296 | Ga0207675_100110851 | 3300026118 | Unclassified | 2589 |
| 297 | Ga0207675_100194670 | 3300026118 | Bacteria | 1946 |
| 298 | Ga0207683_10001205 | 3300026121 | Bacteria | 23426 |
| 299 | Ga0207683_10200222 | 3300026121 | Unclassified | 1815 |
| 300 | Ga0207683_10456894 | 3300026121 | Bacteria | 1178 |
| 301 | Ga0268265_10437206 | 3300028380 | Bacteria | 1219 |
| 302 | Ga0265337_1004147 | 3300028556 | Bacteria | 6083 |
| 303 | Ga0265326_10000783 | 3300028558 | Bacteria | 11762 |
| 304 | Ga0265319_1003966 | 3300028563 | Bacteria | 7511 |
| 305 | Ga0265334_10006877 | 3300028573 | Bacteria | 4885 |
| 306 | Ga0265318_10033684 | 3300028577 | Bacteria | 1976 |
| 307 | Ga0265323_10009561 | 3300028653 | Unclassified | 3954 |
| 308 | Ga0265336_10008948 | 3300028666 | Unclassified | 3485 |
| 309 | Ga0265338_10000757 | 3300028800 | Bacteria | 55097 |
| 310 | Ga0265338_10007876 | 3300028800 | Bacteria | 13078 |
| 311 | Ga0265338_10024806 | 3300028800 | Bacteria | 6110 |
| 312 | Ga0265338_10029061 | 3300028800 | Bacteria | 5493 |
| 313 | Ga0265324_10003374 | 3300029957 | Bacteria | 7635 |
| 314 | Ga0265332_10003276 | 3300031238 | Bacteria | 7868 |
| 315 | Ga0265320_10011675 | 3300031240 | Bacteria | 5157 |
| 316 | Ga0265340_10009819 | 3300031247 | Bacteria | 5127 |
| 317 | Ga0265339_10018769 | 3300031249 | Bacteria | 4072 |
| 318 | Ga0265316_10075726 | 3300031344 | Unclassified | 2587 |
| 319 | Ga0307513_10000126 | 3300031456 | Bacteria | 107665 |
| 320 | Ga0265313_10033113 | 3300031595 | Unclassified | 2630 |
| 321 | Ga0316575_10003459 | 3300031665 | Bacteria | 5449 |
| 322 | Ga0316575_10009596 | 3300031665 | Bacteria | 3544 |
| 323 | Ga0316575_10031507 | 3300031665 | Bacteria | 2076 |
| 324 | Ga0265314_10012190 | 3300031711 | Bacteria | 7040 |
| 325 | Ga0265342_10020260 | 3300031712 | Unclassified | 4270 |
| 326 | Ga0316576_10010262 | 3300031727 | Bacteria | 6077 |
| 327 | Ga0316576_10021225 | 3300031727 | Bacteria | 4487 |
| 328 | Ga0316576_10176509 | 3300031727 | Bacteria | 1612 |
| 329 | Ga0316576_10238119 | 3300031727 | Unclassified | 1368 |
| 330 | Ga0316578_10000196 | 3300031728 | Bacteria | 17119 |
| 331 | Ga0316578_10023814 | 3300031728 | Bacteria | 3430 |
| 332 | Ga0316578_10122628 | 3300031728 | Unclassified | 1563 |
| 333 | Ga0316577_10000247 | 3300031733 | Bacteria | 18981 |
| 334 | Ga0316577_10007595 | 3300031733 | Bacteria | 5785 |
| 335 | Ga0307410_10079657 | 3300031852 | Bacteria | 2296 |
| 336 | Ga0307409_100224880 | 3300031995 | Bacteria | 1697 |
| 337 | Ga0307415_100057494 | 3300032126 | Bacteria | 2673 |
| 338 | Ga0316583_10009154 | 3300032133 | Bacteria | 3572 |
| 339 | Ga0316585_10053199 | 3300032137 | Bacteria | 1301 |
| 340 | Ga0316580_10000271 | 3300032139 | Bacteria | 11105 |
| 341 | Ga0373950_0003976 | 3300034818 | Bacteria | 2149 |
| 342 | Ga0373959_0017991 | 3300034820 | Bacteria | 1325 |
| 343 | Ga0373934_0004401 | 3300035086 | Bacteria | 5204 |
| 344 | Ga0373934_0006948 | 3300035086 | Bacteria | 4200 |
| 345 | Ga0373940_0038640 | 3300035088 | Bacteria | 1303 |
| 346 | Ga0373944_0001319 | 3300035089 | Bacteria | 6238 |
| 347 | Ga0373952_0003338 | 3300035092 | Unclassified | 2893 |
| 348 | Ga0373923_0000311 | 3300035111 | Bacteria | 10843 |
| 349 | Ga0373923_0001290 | 3300035111 | Bacteria | 7074 |
| 350 | Ga0373932_0012708 | 3300035112 | Bacteria | 2079 |
| 351 | Ga0373932_0015256 | 3300035112 | Unclassified | 1946 |
| 352 | Ga0373945_0003956 | 3300035116 | Bacteria | 4686 |
| 353 | Ga0373953_0003403 | 3300035117 | Bacteria | 4947 |
| 354 | Ga0373953_0003923 | 3300035117 | Bacteria | 4688 |
| 355 | Ga0373953_0022080 | 3300035117 | Bacteria | 2396 |
| 356 | Ga0373954_0031087 | 3300035118 | Bacteria | 2463 |
| 357 | Ga0373954_0033057 | 3300035118 | Bacteria | 2393 |
| 358 | Ga0373956_0000076 | 3300035119 | Bacteria | 32516 |
| 359 | Ga0373957_0000009 | 3300035120 | Bacteria | 50764 |
| 360 | Ga0373957_0001254 | 3300035120 | Bacteria | 6793 |
| 361 | Ga0373960_0067507 | 3300035121 | Bacteria | 1099 |
| 362 | Ga0373943_0004905 | 3300035170 | Bacteria | 6044 |
| 363 | Ga0373943_0026142 | 3300035170 | Bacteria | 2733 |
| 364 | Ga0373946_0035440 | 3300035171 | Bacteria | 2019 |
| 365 | Ga0373955_0000014 | 3300035172 | Bacteria | 72349 |
| 366 | Ga0373942_0036599 | 3300035207 | Bacteria | 1323 |
| 367 | Ga0316574_0000335 | 3300035398 | Bacteria | 18134 |
| 368 | Ga0316574_0073321 | 3300035398 | Bacteria | 2164 |
| 369 | Ga0316574_0257632 | 3300035398 | Bacteria | 1114 |
| 370 | Ga0373924_0000396 | 3300035410 | Bacteria | 13378 |
| 371 | Ga0373924_0044218 | 3300035410 | Bacteria | 1830 |
| 372 | Ga0373935_0123129 | 3300035692 | Bacteria | 1734 |
| 373 | Ga0373935_0128839 | 3300035692 | Unclassified | 1698 |
| 374 | Ga0373927_0025613 | 3300035695 | Unclassified | 3856 |
| 375 | Ga0373933_0000115 | 3300035724 | Bacteria | 51833 |
| 376 | Ga0373933_0000337 | 3300035724 | Bacteria | 30069 |
| 377 | Ga0373933_0048187 | 3300035724 | Bacteria | 2536 |
| 378 | Ga0373933_0182894 | 3300035724 | Bacteria | 1337 |
| 379 | Ga0373937_0000032 | 3300036401 | Bacteria | 120148 |
| 380 | Ga0373937_0069764 | 3300036401 | Bacteria | 3240 |
| 381 | Ga0316582_0009778 | 3300036647 | Bacteria | 5217 |
| 382 | Ga0316584_0012926 | 3300036712 | Bacteria | 5896 |
| 383 | Ga0316584_0101274 | 3300036712 | Bacteria | 2157 |
| 384 | Ga0316584_0101961 | 3300036712 | Bacteria | 2149 |
| 385 | Ga0316584_0125790 | 3300036712 | Bacteria | 1914 |
| 386 | Ga0373925_0000231 | 3300037068 | Bacteria | 59007 |
| 387 | Ga0373925_0061247 | 3300037068 | Bacteria | 2826 |
| 388 | Ga0373925_0173895 | 3300037068 | Bacteria | 1701 |
| 389 | Ga0395900_0207821 | 3300037418 | Unclassified | 1978 |
| 390 | Ga0316581_0003157 | 3300037588 | Bacteria | 4068 |
| 391 | Ga0436364_0736590 | 3300037853 | Bacteria | 15640 |
| 392 | Ga0436364_0899784 | 3300037853 | Bacteria | 68912 |
| 393 | Ga0436364_1105580 | 3300037853 | Bacteria | 94835 |
| 394 | Ga0436364_1197580 | 3300037853 | Bacteria | 3047 |
| 395 | Ga0436364_1394990 | 3300037853 | Bacteria | 3996 |
| 396 | Ga0395901_0058420 | 3300038443 | Bacteria | 4012 |
| 397 | Ga0395901_0172510 | 3300038443 | Bacteria | 2269 |
| 398 | Ga0436365_1173075 | 3300039437 | Unclassified | 1184 |
| 399 | Ga0436365_1582105 | 3300039437 | Bacteria | 8587 |
| 400 | Ga0436365_1659451 | 3300039437 | Bacteria | 13752 |
| 401 | Ga0436363_0810518 | 3300039450 | Bacteria | 6259 |
| 402 | Ga0436363_1432344 | 3300039450 | Bacteria | 2385 |
| 403 | Ga0436363_1633984 | 3300039450 | Bacteria | 7784 |
| 404 | Ga0436362_0885787 | 3300039453 | Bacteria | 2533 |
| 405 | Ga0451787_756802 | 3300041441 | Bacteria | 1150 |
| 406 | Ga0451791_1384070 | 3300041451 | Bacteria | 1462 |
| 407 | Ga0451793_1156241 | 3300041452 | Bacteria | 2981 |
| 408 | Ga0451795_1653433 | 3300041456 | Bacteria | 2381 |
| 409 | Ga0451839_0764437 | 3300041496 | Bacteria | 1331 |
| 410 | Ga0451839_1508461 | 3300041496 | Bacteria | 3167 |
| 411 | Ga0451853_0309492 | 3300041512 | Bacteria | 4146 |
| 412 | Ga0466966_0174839 | 3300044684 | Archaea | 1304 |
| 413 | Ga0466963_0007989 | 3300044694 | Bacteria | 6333 |
| 414 | Ga0466963_0116411 | 3300044694 | Unclassified | 1837 |
| 415 | Ga0466963_0120340 | 3300044694 | Bacteria | 1806 |
| 416 | Ga0466964_0047398 | 3300044706 | Bacteria | 1754 |
| 417 | Ga0466960_0042449 | 3300044901 | Bacteria | 2159 |
| 418 | Ga0466959_0085538 | 3300045049 | Bacteria | 2269 |
| 419 | Ga0466967_0244327 | 3300045976 | Bacteria | 1713 |
| 420 | Ga0466967_0270189 | 3300045976 | Bacteria | 1629 |
| 421 | Ga0495592_0000079 | 3300046454 | Bacteria | 85581 |
| 422 | Ga0495592_0020557 | 3300046454 | Bacteria | 5023 |
| 423 | Ga0495603_0001329 | 3300046455 | Bacteria | 14353 |
| 424 | Ga0495603_0055016 | 3300046455 | Bacteria | 2358 |
| 425 | Ga0495629_0004876 | 3300046459 | Bacteria | 10068 |
| 426 | Ga0495641_0004673 | 3300046461 | Bacteria | 9559 |
| 427 | Ga0495651_0000010 | 3300046462 | Bacteria | 148763 |
| 428 | Ga0495651_0003105 | 3300046462 | Bacteria | 12822 |
| 429 | Ga0495653_0005012 | 3300046463 | Bacteria | 10744 |
| 430 | Ga0495653_0017441 | 3300046463 | Bacteria | 5839 |
| 431 | Ga0495653_0046822 | 3300046463 | Bacteria | 3347 |
| 432 | Ga0495653_0170123 | 3300046463 | Bacteria | 1505 |
| 433 | Ga0495580_0002884 | 3300046472 | Bacteria | 14806 |
| 434 | Ga0495580_0135205 | 3300046472 | Bacteria | 1709 |
| 435 | Ga0495582_0215661 | 3300046473 | Unclassified | 1098 |
| 436 | Ga0495639_0001380 | 3300046475 | Bacteria | 10887 |
| 437 | Ga0495639_0041957 | 3300046475 | Bacteria | 2062 |
| 438 | Ga0495662_0000054 | 3300046476 | Bacteria | 39454 |
| 439 | Ga0495662_0027670 | 3300046476 | Bacteria | 2738 |
| 440 | Ga0495664_0025168 | 3300046477 | Bacteria | 3464 |
| 441 | Ga0495584_0121248 | 3300046491 | Bacteria | 1324 |
| 442 | Ga0495594_0003877 | 3300046499 | Bacteria | 7691 |
| 443 | Ga0495596_0083235 | 3300046500 | Bacteria | 1242 |
| 444 | Ga0495608_0000037 | 3300046511 | Bacteria | 125064 |
| 445 | Ga0495608_0033472 | 3300046511 | Unclassified | 3472 |
| 446 | Ga0495618_0101106 | 3300046514 | Bacteria | 1845 |
| 447 | Ga0495628_0000227 | 3300046516 | Bacteria | 49431 |
| 448 | Ga0495628_0003319 | 3300046516 | Bacteria | 14392 |
| 449 | Ga0495628_0014366 | 3300046516 | Bacteria | 6638 |
| 450 | Ga0495628_0141542 | 3300046516 | Bacteria | 1836 |
| 451 | Ga0495630_0016104 | 3300046517 | Bacteria | 5462 |
| 452 | Ga0495666_0000320 | 3300046526 | Bacteria | 20909 |
| 453 | Ga0495666_0048015 | 3300046526 | Bacteria | 2056 |
| 454 | Ga0495652_0000180 | 3300046529 | Bacteria | 71646 |
| 455 | Ga0495652_0074293 | 3300046529 | Bacteria | 2827 |
| 456 | Ga0495652_0128088 | 3300046529 | Bacteria | 2014 |
| 457 | Ga0495665_0001132 | 3300046531 | Bacteria | 14133 |
| 458 | Ga0495665_0028454 | 3300046531 | Bacteria | 2996 |
| 459 | Ga0495640_0001333 | 3300046533 | Bacteria | 19402 |
| 460 | Ga0495640_0053509 | 3300046533 | Bacteria | 2767 |
| 461 | Ga0495640_0169056 | 3300046533 | Bacteria | 1397 |
| 462 | Ga0495586_0003317 | 3300046535 | Bacteria | 8639 |
| 463 | Ga0495587_0000024 | 3300046536 | Bacteria | 148753 |
| 464 | Ga0495587_0002360 | 3300046536 | Bacteria | 12609 |
| 465 | Ga0495587_0067226 | 3300046536 | Bacteria | 2089 |
| 466 | Ga0495645_0026089 | 3300046543 | Bacteria | 4241 |
| 467 | Ga0495645_0102647 | 3300046543 | Bacteria | 2032 |
| 468 | Ga0495645_0218584 | 3300046543 | Bacteria | 1283 |
| 469 | Ga0495645_0262903 | 3300046543 | Bacteria | 1141 |
| 470 | Ga0495622_0035469 | 3300046557 | Bacteria | 2326 |
| 471 | Ga0495667_0000024 | 3300046559 | Bacteria | 168313 |
| 472 | Ga0495667_0016932 | 3300046559 | Bacteria | 4922 |
| 473 | Ga0495656_0008948 | 3300046615 | Bacteria | 3592 |
| 474 | Ga0495634_0029983 | 3300046642 | Bacteria | 3761 |
| 475 | Ga0495634_0061977 | 3300046642 | Bacteria | 2484 |
| 476 | Ga0495635_0015699 | 3300046663 | Bacteria | 5290 |
| 477 | Ga0495635_0040551 | 3300046663 | Bacteria | 3217 |
| 478 | Ga0495635_0077101 | 3300046663 | Bacteria | 2283 |
| 479 | Ga0495588_0100893 | 3300046674 | Bacteria | 1517 |
| 480 | Ga0495657_0000121 | 3300046675 | Bacteria | 69526 |
| 481 | Ga0495657_0011263 | 3300046675 | Bacteria | 6698 |
| 482 | Ga0495657_0022148 | 3300046675 | Bacteria | 4555 |
| 483 | Ga0495599_0000147 | 3300046678 | Bacteria | 45782 |
| 484 | Ga0495599_0001204 | 3300046678 | Bacteria | 14660 |
| 485 | Ga0495599_0026350 | 3300046678 | Bacteria | 3642 |
| 486 | Ga0495623_0005725 | 3300046679 | Bacteria | 8115 |
| 487 | Ga0495623_0071085 | 3300046679 | Bacteria | 2166 |
| 488 | Ga0495646_0017216 | 3300046680 | Bacteria | 4586 |
| 489 | Ga0495646_0047107 | 3300046680 | Bacteria | 2626 |
| 490 | Ga0495647_0084753 | 3300046681 | Bacteria | 1290 |
| 491 | Ga0495658_0023344 | 3300046683 | Bacteria | 3282 |
| 492 | Ga0495613_0004929 | 3300046689 | Bacteria | 10028 |
| 493 | Ga0495624_0000590 | 3300046690 | Bacteria | 28259 |
| 494 | Ga0495600_0000969 | 3300046809 | Bacteria | 15449 |
| 495 | Ga0495600_0003937 | 3300046809 | Bacteria | 8823 |
| 496 | Ga0495581_0002158 | 3300047315 | Bacteria | 11100 |
| 497 | Ga0495581_0040874 | 3300047315 | Unclassified | 2682 |
| 498 | Ga0495581_0060085 | 3300047315 | Bacteria | 2197 |
| 499 | Ga0495604_0000024 | 3300047317 | Bacteria | 148542 |
| 500 | Ga0495604_0013137 | 3300047317 | Bacteria | 6595 |
| 501 | Ga0495604_0038152 | 3300047317 | Bacteria | 3781 |
| 502 | Ga0495674_0040736 | 3300047319 | Bacteria | 4152 |
| 503 | Ga0495674_0158015 | 3300047319 | Bacteria | 1898 |
| 504 | Ga0495676_0012245 | 3300047321 | Bacteria | 7730 |
| 505 | Ga0495676_0043544 | 3300047321 | Bacteria | 3671 |
| 506 | Ga0495676_0109686 | 3300047321 | Bacteria | 2027 |
| 507 | Ga0495680_0000005 | 3300047322 | Bacteria | 168308 |
| 508 | Ga0495680_0006044 | 3300047322 | Bacteria | 11317 |
| 509 | Ga0495680_0007072 | 3300047322 | Bacteria | 10339 |
| 510 | Ga0495675_0003613 | 3300047444 | Bacteria | 9328 |
| 511 | Ga0495675_0078322 | 3300047444 | Bacteria | 2081 |
| 512 | Ga0495684_0001885 | 3300047471 | Bacteria | 16802 |
| 513 | Ga0495684_0002509 | 3300047471 | Bacteria | 14621 |
| 514 | Ga0495684_0135067 | 3300047471 | Bacteria | 1851 |
| 515 | Ga0495593_0022942 | 3300047673 | Bacteria | 3472 |
| 516 | Ga0495593_0024694 | 3300047673 | Bacteria | 3328 |
| 517 | Ga0495602_0000198 | 3300048088 | Bacteria | 56006 |
| 518 | Ga0495602_0012883 | 3300048088 | Bacteria | 8569 |
| 519 | Ga0495602_0196016 | 3300048088 | Unclassified | 1544 |
| 520 | Ga0495614_0010473 | 3300048089 | Unclassified | 4089 |
| 521 | Ga0496100_0275979 | 3300048903 | Bacteria | 1251 |
| 522 | Ga0496101_0011639 | 3300048904 | Bacteria | 5844 |
| 523 | Ga0496101_0036387 | 3300048904 | Unclassified | 3486 |
| 524 | Ga0496101_0107391 | 3300048904 | Bacteria | 2097 |
| 525 | Ga0496101_0279988 | 3300048904 | Unclassified | 1303 |
| 526 | Ga0496102_0039903 | 3300048905 | Unclassified | 4244 |
| 527 | Ga0496102_0068842 | 3300048905 | Bacteria | 3248 |
| 528 | Ga0496102_0186101 | 3300048905 | Bacteria | 1957 |
| 529 | Ga0496102_0200438 | 3300048905 | Unclassified | 1881 |
| 530 | Ga0496103_0017956 | 3300048906 | Bacteria | 4239 |
| 531 | Ga0496103_0074606 | 3300048906 | Bacteria | 2127 |
| 532 | Ga0496103_0082117 | 3300048906 | Unclassified | 2028 |
| 533 | Ga0496104_0001775 | 3300048907 | Bacteria | 18658 |
| 534 | Ga0496104_0013971 | 3300048907 | Bacteria | 7243 |
| 535 | Ga0496104_0048802 | 3300048907 | Unclassified | 3991 |
| 536 | Ga0496104_0139080 | 3300048907 | Bacteria | 2333 |
| 537 | Ga0496104_0146164 | 3300048907 | Unclassified | 2270 |
| 538 | Ga0496104_0199404 | 3300048907 | Unclassified | 1913 |
| 539 | Ga0496105_0001663 | 3300048908 | Bacteria | 15835 |
| 540 | Ga0496105_0007219 | 3300048908 | Bacteria | 8579 |
| 541 | Ga0496105_0009644 | 3300048908 | Bacteria | 7558 |
| 542 | Ga0496105_0019059 | 3300048908 | Bacteria | 5530 |
| 543 | Ga0496105_0318405 | 3300048908 | Unclassified | 1247 |
| 544 | Ga0496106_0050943 | 3300048909 | Bacteria | 3121 |
| 545 | Ga0496106_0101693 | 3300048909 | Bacteria | 2229 |
| 546 | Ga0496106_0275017 | 3300048909 | Bacteria | 1349 |
| 547 | Ga0496107_0016058 | 3300048910 | Bacteria | 5255 |
| 548 | Ga0496107_0072963 | 3300048910 | Bacteria | 2496 |
| 549 | Ga0496107_0163849 | 3300048910 | Bacteria | 1648 |
| 550 | Ga0496108_0000699 | 3300048911 | Bacteria | 26051 |
| 551 | Ga0496108_0006352 | 3300048911 | Bacteria | 9581 |
| 552 | Ga0496108_0013794 | 3300048911 | Bacteria | 6591 |
| 553 | Ga0496108_0094097 | 3300048911 | Bacteria | 2550 |
| 554 | Ga0496108_0131370 | 3300048911 | Bacteria | 2152 |
| 555 | Ga0496108_0229129 | 3300048911 | Bacteria | 1615 |
| 556 | Ga0496108_0232877 | 3300048911 | Bacteria | 1602 |
| 557 | Ga0496108_0243511 | 3300048911 | Unclassified | 1564 |
| 558 | Ga0496109_0002411 | 3300048912 | Bacteria | 15647 |
| 559 | Ga0496109_0002951 | 3300048912 | Bacteria | 14231 |
| 560 | Ga0496109_0005015 | 3300048912 | Bacteria | 11057 |
| 561 | Ga0496109_0030488 | 3300048912 | Unclassified | 4833 |
| 562 | Ga0496109_0049842 | 3300048912 | Bacteria | 3813 |
| 563 | Ga0496109_0061137 | 3300048912 | Bacteria | 3443 |
| 564 | Ga0496109_0104279 | 3300048912 | Bacteria | 2633 |
| 565 | Ga0496110_0000964 | 3300048913 | Bacteria | 20143 |
| 566 | Ga0496110_0036332 | 3300048913 | Unclassified | 4277 |
| 567 | Ga0496110_0096467 | 3300048913 | Bacteria | 2649 |
| 568 | Ga0496110_0300377 | 3300048913 | Bacteria | 1462 |
| 569 | Ga0496110_0322336 | 3300048913 | Bacteria | 1408 |
| 570 | Ga0496111_0002511 | 3300048914 | Bacteria | 11066 |
| 571 | Ga0496111_0029572 | 3300048914 | Unclassified | 3891 |
| 572 | Ga0496111_0041272 | 3300048914 | Bacteria | 3311 |
| 573 | Ga0496111_0051776 | 3300048914 | Bacteria | 2964 |
| 574 | Ga0496111_0056397 | 3300048914 | Bacteria | 2842 |
| 575 | Ga0496111_0089630 | 3300048914 | Unclassified | 2253 |
| 576 | Ga0496112_0008446 | 3300048915 | Bacteria | 9225 |
| 577 | Ga0496112_0156970 | 3300048915 | Unclassified | 2242 |
| 578 | Ga0496112_0165117 | 3300048915 | Bacteria | 2180 |
| 579 | Ga0496112_0328858 | 3300048915 | Bacteria | 1472 |
| 580 | Ga0496113_0009400 | 3300048916 | Bacteria | 6411 |
| 581 | Ga0496113_0037712 | 3300048916 | Bacteria | 3549 |
| 582 | Ga0496113_0055172 | 3300048916 | Unclassified | 2977 |
| 583 | Ga0496113_0097975 | 3300048916 | Unclassified | 2269 |
| 584 | Ga0496114_0035702 | 3300048917 | Bacteria | 4106 |
| 585 | Ga0496114_0177574 | 3300048917 | Unclassified | 1858 |
| 586 | Ga0496115_0046685 | 3300048918 | Bacteria | 3462 |
| 587 | Ga0496115_0057982 | 3300048918 | Bacteria | 3115 |
| 588 | Ga0496115_0112255 | 3300048918 | Bacteria | 2239 |
| 589 | Ga0496126_0079258 | 3300048929 | Bacteria | 2908 |
| 590 | Ga0496126_0335961 | 3300048929 | Unclassified | 1239 |
| 591 | Ga0501034_0074518 | 3300049571 | Bacteria | 3402 |
| 592 | Ga0501070_0146245 | 3300049586 | Unclassified | 1951 |
| 593 | Ga0501044_0042118 | 3300049823 | Bacteria | 4752 |
| 594 | nmdc:mga05p37_30825_c1 | 3300050507 | Bacteria | 6546 |
| 595 | nmdc:mga08y16_11975_c1 | 3300050511 | Bacteria | 9108 |
| 596 | nmdc:mga08y16_567799_c1 | 3300050511 | Bacteria | 1147 |
| 597 | nmdc:mga0n895_16547_c1 | 3300050512 | Bacteria | 6771 |
| 598 | nmdc:mga0n895_30906_c1 | 3300050512 | Bacteria | 5123 |
| 599 | nmdc:mga0rr50_101215_c1 | 3300050513 | Bacteria | 2265 |
| 600 | nmdc:mga0rr50_3773_c1 | 3300050513 | Bacteria | 8788 |
| 601 | nmdc:mga08x19_6579_c1 | 3300050514 | Bacteria | 6887 |
| 602 | nmdc:mga08x19_89201_c1 | 3300050514 | Bacteria | 2033 |
| 603 | nmdc:mga0a205_127950_c1 | 3300050515 | Bacteria | 2440 |
| 604 | nmdc:mga0a205_21165_c1 | 3300050515 | Bacteria | 6151 |
| 605 | Ga0495601_0005539 | 3300053077 | Bacteria | 7366 |
| 606 | Ga0495601_0007347 | 3300053077 | Bacteria | 6460 |
| 607 | Ga0495595_0001856 | 3300053084 | Bacteria | 8194 |
| 608 | Ga0495595_0002796 | 3300053084 | Bacteria | 6865 |
| 609 | Ga0495595_0023996 | 3300053084 | Bacteria | 2690 |
| 610 | Ga0495595_0065463 | 3300053084 | Bacteria | 1709 |
| 611 | Ga0495619_0018349 | 3300053085 | Bacteria | 4439 |
| 612 | Ga0495619_0046944 | 3300053085 | Unclassified | 2841 |
| 613 | Ga0495619_0168726 | 3300053085 | Bacteria | 1513 |
| 614 | Ga0500583_0001451 | 3300053092 | Bacteria | 6801 |
| 615 | Ga0500568_0008461 | 3300053139 | Bacteria | 4953 |
| 616 | Ga0500616_0000601 | 3300053153 | Bacteria | 43603 |
| 617 | Ga0500616_0001662 | 3300053153 | Bacteria | 20526 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048908 | Ga0496105_0318405 | Ga0496105_0318405_10_936 | 277 |
| 2 | 3300044684 | Ga0466966_0174839 | Ga0466966_0174839_446_1294 | 278 |
| 3 | 3300048911 | Ga0496108_0229129 | Ga0496108_0229129_722_1570 | 278 |
| 4 | 3300050511 | nmdc:mga08y16_567799_c1 | nmdc:mga08y16_567799_c1_38_886 | 278 |
| 5 | 3300009147 | Ga0114129_10468521 | Ga0114129_104685212 | 288 |
| 6 | 3300025907 | Ga0207645_10233683 | Ga0207645_102336832 | 291 |
| 7 | 3300009094 | Ga0111539_10062238 | Ga0111539_100622384 | 299 |
| 8 | 3300035398 | Ga0316574_0257632 | Ga0316574_0257632_44_1075 | 303 |
| 9 | 3300025931 | Ga0207644_10289002 | Ga0207644_102890022 | 312 |
| 10 | 3300026075 | Ga0207708_10237008 | Ga0207708_102370082 | 312 |
| 11 | 3300047444 | Ga0495675_0078322 | Ga0495675_0078322_20_988 | 319 |
| 12 | 3300031727 | Ga0316576_10176509 | Ga0316576_101765092 | 325 |
| 13 | 3300031727 | Ga0316576_10238119 | Ga0316576_102381191 | 325 |
| 14 | 3300031728 | Ga0316578_10023814 | Ga0316578_100238143 | 325 |
| 15 | 3300036712 | Ga0316584_0125790 | Ga0316584_0125790_422_1432 | 325 |
| 16 | 3300048915 | Ga0496112_0165117 | Ga0496112_0165117_498_1487 | 325 |
| 17 | 3300009177 | Ga0105248_10079472 | Ga0105248_100794722 | 326 |
| 18 | 3300035121 | Ga0373960_0067507 | Ga0373960_0067507_90_1073 | 326 |
| 19 | 3300041456 | Ga0451795_1653433 | Ga0451795_1653433_36_1028 | 326 |
| 20 | 3300048905 | Ga0496102_0068842 | Ga0496102_0068842_1404_2405 | 327 |
| 21 | 3300048907 | Ga0496104_0001775 | Ga0496104_0001775_4547_5548 | 327 |
| 22 | 3300048908 | Ga0496105_0019059 | Ga0496105_0019059_2973_3974 | 327 |
| 23 | 3300048910 | Ga0496107_0072963 | Ga0496107_0072963_1351_2352 | 327 |
| 24 | 3300048912 | Ga0496109_0005015 | Ga0496109_0005015_9995_10996 | 327 |
| 25 | 3300048916 | Ga0496113_0009400 | Ga0496113_0009400_4944_5945 | 327 |
| 26 | 3300005842 | Ga0068858_100128251 | Ga0068858_1001282512 | 330 |
| 27 | 3300025916 | Ga0207663_10082005 | Ga0207663_100820052 | 330 |
| 28 | 3300035112 | Ga0373932_0015256 | Ga0373932_0015256_371_1519 | 330 |
| 29 | 3300005618 | Ga0068864_100152712 | Ga0068864_1001527122 | 331 |
| 30 | 3300005841 | Ga0068863_100140366 | Ga0068863_1001403662 | 331 |
| 31 | 3300013307 | Ga0157372_10173121 | Ga0157372_101731212 | 331 |
| 32 | 3300014325 | Ga0163163_10012499 | Ga0163163_100124995 | 331 |
| 33 | 3300026116 | Ga0207674_10059235 | Ga0207674_100592352 | 331 |
| 34 | 3300031665 | Ga0316575_10031507 | Ga0316575_100315072 | 331 |
| 35 | 3300031728 | Ga0316578_10122628 | Ga0316578_101226282 | 331 |
| 36 | 3300036712 | Ga0316584_0101274 | Ga0316584_0101274_650_1669 | 331 |
| 37 | 3300048907 | Ga0496104_0146164 | Ga0496104_0146164_41_1120 | 331 |
| 38 | 3300048914 | Ga0496111_0041272 | Ga0496111_0041272_37_1131 | 331 |
| 39 | 3300005356 | Ga0070674_100249688 | Ga0070674_1002496882 | 332 |
| 40 | 3300005434 | Ga0070709_10035032 | Ga0070709_100350322 | 332 |
| 41 | 3300005437 | Ga0070710_10007980 | Ga0070710_100079804 | 332 |
| 42 | 3300005614 | Ga0068856_100061143 | Ga0068856_1000611433 | 332 |
| 43 | 3300005615 | Ga0070702_100032016 | Ga0070702_1000320162 | 332 |
| 44 | 3300006173 | Ga0070716_100122611 | Ga0070716_1001226112 | 332 |
| 45 | 3300013105 | Ga0157369_10070048 | Ga0157369_100700482 | 332 |
| 46 | 3300013306 | Ga0163162_10050417 | Ga0163162_100504175 | 332 |
| 47 | 3300025906 | Ga0207699_10031377 | Ga0207699_100313772 | 332 |
| 48 | 3300025939 | Ga0207665_10134025 | Ga0207665_101340252 | 332 |
| 49 | 3300026095 | Ga0207676_10209801 | Ga0207676_102098012 | 332 |
| 50 | 3300026121 | Ga0207683_10456894 | Ga0207683_104568941 | 332 |
| 51 | 3300046543 | Ga0495645_0102647 | Ga0495645_0102647_186_1280 | 332 |
| 52 | 3300048911 | Ga0496108_0243511 | Ga0496108_0243511_155_1234 | 332 |
| 53 | 3300048912 | Ga0496109_0061137 | Ga0496109_0061137_653_1732 | 332 |
| 54 | 3300025901 | Ga0207688_10116445 | Ga0207688_101164452 | 333 |
| 55 | 3300005937 | Ga0081455_10069868 | Ga0081455_100698683 | 334 |
| 56 | 3300005981 | Ga0081538_10102674 | Ga0081538_101026742 | 334 |
| 57 | 3300009094 | Ga0111539_10437488 | Ga0111539_104374881 | 334 |
| 58 | 3300035117 | Ga0373953_0022080 | Ga0373953_0022080_1246_2310 | 334 |
| 59 | 3300035410 | Ga0373924_0044218 | Ga0373924_0044218_180_1244 | 334 |
| 60 | 3300035692 | Ga0373935_0128839 | Ga0373935_0128839_525_1589 | 334 |
| 61 | 3300037068 | Ga0373925_0173895 | Ga0373925_0173895_452_1459 | 334 |
| 62 | 3300044694 | Ga0466963_0007989 | Ga0466963_0007989_4115_5128 | 334 |
| 63 | 3300044706 | Ga0466964_0047398 | Ga0466964_0047398_594_1619 | 334 |
| 64 | 3300046454 | Ga0495592_0020557 | Ga0495592_0020557_531_1595 | 334 |
| 65 | 3300046475 | Ga0495639_0041957 | Ga0495639_0041957_219_1283 | 334 |
| 66 | 3300046516 | Ga0495628_0003319 | Ga0495628_0003319_9531_10595 | 334 |
| 67 | 3300046516 | Ga0495628_0141542 | Ga0495628_0141542_148_1155 | 334 |
| 68 | 3300046529 | Ga0495652_0074293 | Ga0495652_0074293_1079_2143 | 334 |
| 69 | 3300046533 | Ga0495640_0053509 | Ga0495640_0053509_1131_2195 | 334 |
| 70 | 3300046536 | Ga0495587_0002360 | Ga0495587_0002360_1317_2381 | 334 |
| 71 | 3300046663 | Ga0495635_0040551 | Ga0495635_0040551_1436_2500 | 334 |
| 72 | 3300046678 | Ga0495599_0001204 | Ga0495599_0001204_9853_10917 | 334 |
| 73 | 3300047315 | Ga0495581_0060085 | Ga0495581_0060085_636_1700 | 334 |
| 74 | 3300047319 | Ga0495674_0040736 | Ga0495674_0040736_2424_3488 | 334 |
| 75 | 3300047319 | Ga0495674_0158015 | Ga0495674_0158015_566_1588 | 334 |
| 76 | 3300047322 | Ga0495680_0006044 | Ga0495680_0006044_723_1787 | 334 |
| 77 | 3300047471 | Ga0495684_0001885 | Ga0495684_0001885_9531_10595 | 334 |
| 78 | 3300048088 | Ga0495602_0012883 | Ga0495602_0012883_5521_6585 | 334 |
| 79 | 3300048904 | Ga0496101_0036387 | Ga0496101_0036387_2457_3464 | 334 |
| 80 | 3300053077 | Ga0495601_0007347 | Ga0495601_0007347_4912_5976 | 334 |
| 81 | 3300053084 | Ga0495595_0001856 | Ga0495595_0001856_4264_5328 | 334 |
| 82 | 3300006028 | Ga0070717_10408504 | Ga0070717_104085042 | 335 |
| 83 | 3300031727 | Ga0316576_10010262 | Ga0316576_100102621 | 335 |
| 84 | 3300035724 | Ga0373933_0182894 | Ga0373933_0182894_65_1129 | 335 |
| 85 | 3300005985 | Ga0081539_10002380 | Ga0081539_1000238015 | 336 |
| 86 | 3300005985 | Ga0081539_10012438 | Ga0081539_100124382 | 336 |
| 87 | 3300005985 | Ga0081539_10015847 | Ga0081539_100158475 | 336 |
| 88 | 3300005985 | Ga0081539_10051188 | Ga0081539_100511882 | 336 |
| 89 | 3300025944 | Ga0207661_10104916 | Ga0207661_101049162 | 336 |
| 90 | 3300032126 | Ga0307415_100057494 | Ga0307415_1000574942 | 336 |
| 91 | 3300048911 | Ga0496108_0232877 | Ga0496108_0232877_417_1454 | 336 |
| 92 | 3300048912 | Ga0496109_0104279 | Ga0496109_0104279_245_1270 | 336 |
| 93 | 3300005329 | Ga0070683_100095733 | Ga0070683_1000957333 | 337 |
| 94 | 3300005354 | Ga0070675_100074003 | Ga0070675_1000740031 | 337 |
| 95 | 3300005937 | Ga0081455_10138099 | Ga0081455_101380992 | 337 |
| 96 | 3300009094 | Ga0111539_10002081 | Ga0111539_1000208118 | 337 |
| 97 | 3300021358 | Ga0213873_10035523 | Ga0213873_100355232 | 337 |
| 98 | 3300021377 | Ga0213874_10006597 | Ga0213874_100065974 | 337 |
| 99 | 3300021384 | Ga0213876_10006736 | Ga0213876_100067363 | 337 |
| 100 | 3300021388 | Ga0213875_10000148 | Ga0213875_1000014831 | 337 |
| 101 | 3300021388 | Ga0213875_10011400 | Ga0213875_100114002 | 337 |
| 102 | 3300025926 | Ga0207659_10092465 | Ga0207659_100924651 | 337 |
| 103 | 3300025942 | Ga0207689_10340119 | Ga0207689_103401192 | 337 |
| 104 | 3300037853 | Ga0436364_0736590 | Ga0436364_0736590_14585_15625 | 337 |
| 105 | 3300037853 | Ga0436364_0899784 | Ga0436364_0899784_40855_41877 | 337 |
| 106 | 3300037853 | Ga0436364_1105580 | Ga0436364_1105580_28888_29931 | 337 |
| 107 | 3300039437 | Ga0436365_1173075 | Ga0436365_1173075_55_1164 | 337 |
| 108 | 3300039437 | Ga0436365_1582105 | Ga0436365_1582105_6864_7904 | 337 |
| 109 | 3300039450 | Ga0436363_0810518 | Ga0436363_0810518_2853_3893 | 337 |
| 110 | 3300039450 | Ga0436363_1633984 | Ga0436363_1633984_116_1156 | 337 |
| 111 | 3300039453 | Ga0436362_0885787 | Ga0436362_0885787_100_1209 | 337 |
| 112 | 3300045976 | Ga0466967_0270189 | Ga0466967_0270189_488_1516 | 337 |
| 113 | 3300046455 | Ga0495603_0055016 | Ga0495603_0055016_674_1711 | 337 |
| 114 | 3300046491 | Ga0495584_0121248 | Ga0495584_0121248_158_1198 | 337 |
| 115 | 3300046500 | Ga0495596_0083235 | Ga0495596_0083235_121_1161 | 337 |
| 116 | 3300046615 | Ga0495656_0008948 | Ga0495656_0008948_1165_2205 | 337 |
| 117 | 3300048911 | Ga0496108_0094097 | Ga0496108_0094097_724_1761 | 337 |
| 118 | 3300048912 | Ga0496109_0049842 | Ga0496109_0049842_1433_2470 | 337 |
| 119 | 3300048914 | Ga0496111_0056397 | Ga0496111_0056397_930_1967 | 337 |
| 120 | 3300048929 | Ga0496126_0079258 | Ga0496126_0079258_1797_2825 | 337 |
| 121 | 3300050511 | nmdc:mga08y16_11975_c1 | nmdc:mga08y16_11975_c1_704_1726 | 337 |
| 122 | 3300005458 | Ga0070681_10170089 | Ga0070681_101700892 | 338 |
| 123 | 3300005467 | Ga0070706_100041687 | Ga0070706_1000416873 | 338 |
| 124 | 3300005530 | Ga0070679_100017896 | Ga0070679_1000178967 | 338 |
| 125 | 3300005563 | Ga0068855_100013363 | Ga0068855_1000133639 | 338 |
| 126 | 3300007265 | Ga0099794_10077202 | Ga0099794_100772021 | 338 |
| 127 | 3300011119 | Ga0105246_10015359 | Ga0105246_100153592 | 338 |
| 128 | 3300025904 | Ga0207647_10000879 | Ga0207647_1000087924 | 338 |
| 129 | 3300025910 | Ga0207684_10000253 | Ga0207684_1000025370 | 338 |
| 130 | 3300025921 | Ga0207652_10002441 | Ga0207652_100024416 | 338 |
| 131 | 3300025949 | Ga0207667_10024494 | Ga0207667_100244947 | 338 |
| 132 | 3300026078 | Ga0207702_10328845 | Ga0207702_103288451 | 338 |
| 133 | 3300028556 | Ga0265337_1004147 | Ga0265337_10041472 | 338 |
| 134 | 3300028558 | Ga0265326_10000783 | Ga0265326_100007833 | 338 |
| 135 | 3300028563 | Ga0265319_1003966 | Ga0265319_10039664 | 338 |
| 136 | 3300028573 | Ga0265334_10006877 | Ga0265334_100068774 | 338 |
| 137 | 3300028577 | Ga0265318_10033684 | Ga0265318_100336843 | 338 |
| 138 | 3300028653 | Ga0265323_10009561 | Ga0265323_100095612 | 338 |
| 139 | 3300028666 | Ga0265336_10008948 | Ga0265336_100089483 | 338 |
| 140 | 3300028800 | Ga0265338_10000757 | Ga0265338_100007578 | 338 |
| 141 | 3300028800 | Ga0265338_10024806 | Ga0265338_100248069 | 338 |
| 142 | 3300028800 | Ga0265338_10029061 | Ga0265338_100290616 | 338 |
| 143 | 3300029957 | Ga0265324_10003374 | Ga0265324_100033745 | 338 |
| 144 | 3300031238 | Ga0265332_10003276 | Ga0265332_100032763 | 338 |
| 145 | 3300031240 | Ga0265320_10011675 | Ga0265320_100116754 | 338 |
| 146 | 3300031247 | Ga0265340_10009819 | Ga0265340_100098193 | 338 |
| 147 | 3300031249 | Ga0265339_10018769 | Ga0265339_100187694 | 338 |
| 148 | 3300031344 | Ga0265316_10075726 | Ga0265316_100757262 | 338 |
| 149 | 3300031595 | Ga0265313_10033113 | Ga0265313_100331132 | 338 |
| 150 | 3300031665 | Ga0316575_10003459 | Ga0316575_100034593 | 338 |
| 151 | 3300031665 | Ga0316575_10009596 | Ga0316575_100095962 | 338 |
| 152 | 3300031711 | Ga0265314_10012190 | Ga0265314_100121904 | 338 |
| 153 | 3300031712 | Ga0265342_10020260 | Ga0265342_100202603 | 338 |
| 154 | 3300031727 | Ga0316576_10021225 | Ga0316576_100212253 | 338 |
| 155 | 3300031728 | Ga0316578_10000196 | Ga0316578_100001961 | 338 |
| 156 | 3300031733 | Ga0316577_10000247 | Ga0316577_100002477 | 338 |
| 157 | 3300031733 | Ga0316577_10007595 | Ga0316577_100075956 | 338 |
| 158 | 3300031852 | Ga0307410_10079657 | Ga0307410_100796572 | 338 |
| 159 | 3300032133 | Ga0316583_10009154 | Ga0316583_100091542 | 338 |
| 160 | 3300032137 | Ga0316585_10053199 | Ga0316585_100531991 | 338 |
| 161 | 3300032139 | Ga0316580_10000271 | Ga0316580_100002712 | 338 |
| 162 | 3300035170 | Ga0373943_0026142 | Ga0373943_0026142_181_1215 | 338 |
| 163 | 3300035398 | Ga0316574_0000335 | Ga0316574_0000335_628_1686 | 338 |
| 164 | 3300035398 | Ga0316574_0073321 | Ga0316574_0073321_233_1375 | 338 |
| 165 | 3300036647 | Ga0316582_0009778 | Ga0316582_0009778_3426_4484 | 338 |
| 166 | 3300036712 | Ga0316584_0012926 | Ga0316584_0012926_4047_5105 | 338 |
| 167 | 3300036712 | Ga0316584_0101961 | Ga0316584_0101961_247_1275 | 338 |
| 168 | 3300037068 | Ga0373925_0000231 | Ga0373925_0000231_42483_43517 | 338 |
| 169 | 3300037588 | Ga0316581_0003157 | Ga0316581_0003157_266_1324 | 338 |
| 170 | 3300038443 | Ga0395901_0058420 | Ga0395901_0058420_895_1920 | 338 |
| 171 | 3300049571 | Ga0501034_0074518 | Ga0501034_0074518_1705_2739 | 338 |
| 172 | 3300049586 | Ga0501070_0146245 | Ga0501070_0146245_64_1092 | 338 |
| 173 | 3300049823 | Ga0501044_0042118 | Ga0501044_0042118_788_1822 | 338 |
| 174 | 3300053092 | Ga0500583_0001451 | Ga0500583_0001451_1686_2756 | 338 |
| 175 | 3300053139 | Ga0500568_0008461 | Ga0500568_0008461_2099_3178 | 338 |
| 176 | 3300003659 | JGI25404J52841_10024711 | JGI25404J52841_100247112 | 339 |
| 177 | 3300005334 | Ga0068869_100167926 | Ga0068869_1001679262 | 339 |
| 178 | 3300005337 | Ga0070682_100028659 | Ga0070682_1000286591 | 339 |
| 179 | 3300005337 | Ga0070682_100098893 | Ga0070682_1000988932 | 339 |
| 180 | 3300005339 | Ga0070660_100079315 | Ga0070660_1000793152 | 339 |
| 181 | 3300005340 | Ga0070689_100062161 | Ga0070689_1000621614 | 339 |
| 182 | 3300005347 | Ga0070668_100054139 | Ga0070668_1000541392 | 339 |
| 183 | 3300005355 | Ga0070671_100066715 | Ga0070671_1000667152 | 339 |
| 184 | 3300005367 | Ga0070667_100263835 | Ga0070667_1002638352 | 339 |
| 185 | 3300005435 | Ga0070714_100017113 | Ga0070714_1000171135 | 339 |
| 186 | 3300005435 | Ga0070714_100058482 | Ga0070714_1000584822 | 339 |
| 187 | 3300005436 | Ga0070713_100120281 | Ga0070713_1001202811 | 339 |
| 188 | 3300005437 | Ga0070710_10056320 | Ga0070710_100563202 | 339 |
| 189 | 3300005445 | Ga0070708_100004332 | Ga0070708_1000043322 | 339 |
| 190 | 3300005445 | Ga0070708_100010622 | Ga0070708_1000106226 | 339 |
| 191 | 3300005445 | Ga0070708_100022016 | Ga0070708_1000220161 | 339 |
| 192 | 3300005445 | Ga0070708_100073307 | Ga0070708_1000733072 | 339 |
| 193 | 3300005445 | Ga0070708_100269466 | Ga0070708_1002694662 | 339 |
| 194 | 3300005455 | Ga0070663_100040425 | Ga0070663_1000404252 | 339 |
| 195 | 3300005458 | Ga0070681_10095741 | Ga0070681_100957412 | 339 |
| 196 | 3300005459 | Ga0068867_100144473 | Ga0068867_1001444732 | 339 |
| 197 | 3300005466 | Ga0070685_10148840 | Ga0070685_101488401 | 339 |
| 198 | 3300005466 | Ga0070685_10195136 | Ga0070685_101951361 | 339 |
| 199 | 3300005467 | Ga0070706_100003350 | Ga0070706_1000033509 | 339 |
| 200 | 3300005467 | Ga0070706_100007331 | Ga0070706_10000733111 | 339 |
| 201 | 3300005467 | Ga0070706_100008557 | Ga0070706_1000085576 | 339 |
| 202 | 3300005467 | Ga0070706_100011810 | Ga0070706_1000118107 | 339 |
| 203 | 3300005467 | Ga0070706_100045756 | Ga0070706_1000457563 | 339 |
| 204 | 3300005467 | Ga0070706_100058586 | Ga0070706_1000585863 | 339 |
| 205 | 3300005467 | Ga0070706_100231663 | Ga0070706_1002316632 | 339 |
| 206 | 3300005467 | Ga0070706_100232364 | Ga0070706_1002323642 | 339 |
| 207 | 3300005468 | Ga0070707_100001852 | Ga0070707_1000018527 | 339 |
| 208 | 3300005468 | Ga0070707_100014484 | Ga0070707_1000144844 | 339 |
| 209 | 3300005468 | Ga0070707_100017961 | Ga0070707_1000179615 | 339 |
| 210 | 3300005468 | Ga0070707_100025995 | Ga0070707_1000259952 | 339 |
| 211 | 3300005468 | Ga0070707_100041084 | Ga0070707_1000410843 | 339 |
| 212 | 3300005468 | Ga0070707_100213725 | Ga0070707_1002137252 | 339 |
| 213 | 3300005468 | Ga0070707_100229568 | Ga0070707_1002295681 | 339 |
| 214 | 3300005471 | Ga0070698_100001492 | Ga0070698_10000149217 | 339 |
| 215 | 3300005471 | Ga0070698_100002646 | Ga0070698_10000264617 | 339 |
| 216 | 3300005471 | Ga0070698_100004059 | Ga0070698_10000405915 | 339 |
| 217 | 3300005471 | Ga0070698_100004413 | Ga0070698_1000044132 | 339 |
| 218 | 3300005471 | Ga0070698_100052130 | Ga0070698_1000521303 | 339 |
| 219 | 3300005471 | Ga0070698_100056549 | Ga0070698_1000565493 | 339 |
| 220 | 3300005471 | Ga0070698_100060077 | Ga0070698_1000600772 | 339 |
| 221 | 3300005471 | Ga0070698_100091738 | Ga0070698_1000917382 | 339 |
| 222 | 3300005471 | Ga0070698_100100625 | Ga0070698_1001006253 | 339 |
| 223 | 3300005471 | Ga0070698_100109975 | Ga0070698_1001099753 | 339 |
| 224 | 3300005471 | Ga0070698_100250635 | Ga0070698_1002506352 | 339 |
| 225 | 3300005471 | Ga0070698_100274950 | Ga0070698_1002749502 | 339 |
| 226 | 3300005518 | Ga0070699_100001142 | Ga0070699_10000114219 | 339 |
| 227 | 3300005518 | Ga0070699_100006327 | Ga0070699_10000632711 | 339 |
| 228 | 3300005518 | Ga0070699_100048972 | Ga0070699_1000489721 | 339 |
| 229 | 3300005518 | Ga0070699_100105945 | Ga0070699_1001059452 | 339 |
| 230 | 3300005518 | Ga0070699_100115633 | Ga0070699_1001156332 | 339 |
| 231 | 3300005518 | Ga0070699_100197415 | Ga0070699_1001974153 | 339 |
| 232 | 3300005535 | Ga0070684_100024436 | Ga0070684_1000244364 | 339 |
| 233 | 3300005535 | Ga0070684_100028797 | Ga0070684_1000287974 | 339 |
| 234 | 3300005536 | Ga0070697_100001890 | Ga0070697_1000018908 | 339 |
| 235 | 3300005536 | Ga0070697_100010665 | Ga0070697_1000106654 | 339 |
| 236 | 3300005536 | Ga0070697_100017641 | Ga0070697_1000176415 | 339 |
| 237 | 3300005536 | Ga0070697_100026241 | Ga0070697_1000262414 | 339 |
| 238 | 3300005539 | Ga0068853_100270137 | Ga0068853_1002701372 | 339 |
| 239 | 3300005544 | Ga0070686_100081314 | Ga0070686_1000813142 | 339 |
| 240 | 3300005548 | Ga0070665_100093063 | Ga0070665_1000930632 | 339 |
| 241 | 3300005564 | Ga0070664_100309565 | Ga0070664_1003095652 | 339 |
| 242 | 3300005578 | Ga0068854_100201303 | Ga0068854_1002013032 | 339 |
| 243 | 3300005719 | Ga0068861_100007858 | Ga0068861_1000078583 | 339 |
| 244 | 3300005719 | Ga0068861_100116486 | Ga0068861_1001164865 | 339 |
| 245 | 3300005719 | Ga0068861_100178963 | Ga0068861_1001789631 | 339 |
| 246 | 3300005841 | Ga0068863_100057463 | Ga0068863_1000574633 | 339 |
| 247 | 3300005843 | Ga0068860_100171855 | Ga0068860_1001718554 | 339 |
| 248 | 3300005843 | Ga0068860_100261356 | Ga0068860_1002613562 | 339 |
| 249 | 3300005937 | Ga0081455_10037377 | Ga0081455_100373772 | 339 |
| 250 | 3300005983 | Ga0081540_1004475 | Ga0081540_10044756 | 339 |
| 251 | 3300005983 | Ga0081540_1014769 | Ga0081540_10147693 | 339 |
| 252 | 3300005985 | Ga0081539_10004254 | Ga0081539_100042543 | 339 |
| 253 | 3300006028 | Ga0070717_10011712 | Ga0070717_100117126 | 339 |
| 254 | 3300006028 | Ga0070717_10016411 | Ga0070717_100164113 | 339 |
| 255 | 3300006028 | Ga0070717_10034398 | Ga0070717_100343982 | 339 |
| 256 | 3300006028 | Ga0070717_10044572 | Ga0070717_100445723 | 339 |
| 257 | 3300006028 | Ga0070717_10112880 | Ga0070717_101128801 | 339 |
| 258 | 3300006028 | Ga0070717_10249911 | Ga0070717_102499111 | 339 |
| 259 | 3300006163 | Ga0070715_10033471 | Ga0070715_100334711 | 339 |
| 260 | 3300006163 | Ga0070715_10047211 | Ga0070715_100472111 | 339 |
| 261 | 3300006173 | Ga0070716_100078426 | Ga0070716_1000784263 | 339 |
| 262 | 3300006173 | Ga0070716_100081721 | Ga0070716_1000817212 | 339 |
| 263 | 3300006173 | Ga0070716_100113164 | Ga0070716_1001131642 | 339 |
| 264 | 3300006175 | Ga0070712_100023366 | Ga0070712_1000233662 | 339 |
| 265 | 3300006175 | Ga0070712_100283054 | Ga0070712_1002830542 | 339 |
| 266 | 3300006358 | Ga0068871_100080604 | Ga0068871_1000806042 | 339 |
| 267 | 3300006358 | Ga0068871_100285509 | Ga0068871_1002855092 | 339 |
| 268 | 3300006847 | Ga0075431_100261425 | Ga0075431_1002614252 | 339 |
| 269 | 3300006852 | Ga0075433_10058299 | Ga0075433_100582992 | 339 |
| 270 | 3300006852 | Ga0075433_10137835 | Ga0075433_101378351 | 339 |
| 271 | 3300006871 | Ga0075434_100003966 | Ga0075434_10000396614 | 339 |
| 272 | 3300006871 | Ga0075434_100081895 | Ga0075434_1000818952 | 339 |
| 273 | 3300006871 | Ga0075434_100132291 | Ga0075434_1001322912 | 339 |
| 274 | 3300006914 | Ga0075436_100004661 | Ga0075436_1000046614 | 339 |
| 275 | 3300006914 | Ga0075436_100010988 | Ga0075436_1000109883 | 339 |
| 276 | 3300007076 | Ga0075435_100004546 | Ga0075435_1000045465 | 339 |
| 277 | 3300007076 | Ga0075435_100047059 | Ga0075435_1000470593 | 339 |
| 278 | 3300007076 | Ga0075435_100074095 | Ga0075435_1000740952 | 339 |
| 279 | 3300007076 | Ga0075435_100151377 | Ga0075435_1001513772 | 339 |
| 280 | 3300009011 | Ga0105251_10014638 | Ga0105251_100146381 | 339 |
| 281 | 3300009101 | Ga0105247_10103407 | Ga0105247_101034072 | 339 |
| 282 | 3300009101 | Ga0105247_10147362 | Ga0105247_101473621 | 339 |
| 283 | 3300009147 | Ga0114129_10013858 | Ga0114129_100138585 | 339 |
| 284 | 3300009148 | Ga0105243_10005512 | Ga0105243_100055126 | 339 |
| 285 | 3300009177 | Ga0105248_10158614 | Ga0105248_101586142 | 339 |
| 286 | 3300009553 | Ga0105249_10137445 | Ga0105249_101374452 | 339 |
| 287 | 3300013297 | Ga0157378_10461414 | Ga0157378_104614142 | 339 |
| 288 | 3300013306 | Ga0163162_10128984 | Ga0163162_101289842 | 339 |
| 289 | 3300013308 | Ga0157375_10661536 | Ga0157375_106615361 | 339 |
| 290 | 3300014325 | Ga0163163_10098472 | Ga0163163_100984722 | 339 |
| 291 | 3300014325 | Ga0163163_10352754 | Ga0163163_103527541 | 339 |
| 292 | 3300014326 | Ga0157380_10086384 | Ga0157380_100863842 | 339 |
| 293 | 3300014968 | Ga0157379_10109260 | Ga0157379_101092602 | 339 |
| 294 | 3300014969 | Ga0157376_10122454 | Ga0157376_101224542 | 339 |
| 295 | 3300014969 | Ga0157376_10152166 | Ga0157376_101521661 | 339 |
| 296 | 3300024225 | Ga0224572_1012925 | Ga0224572_10129252 | 339 |
| 297 | 3300025898 | Ga0207692_10005594 | Ga0207692_100055942 | 339 |
| 298 | 3300025898 | Ga0207692_10029937 | Ga0207692_100299372 | 339 |
| 299 | 3300025898 | Ga0207692_10061454 | Ga0207692_100614542 | 339 |
| 300 | 3300025900 | Ga0207710_10046161 | Ga0207710_100461612 | 339 |
| 301 | 3300025901 | Ga0207688_10013767 | Ga0207688_100137673 | 339 |
| 302 | 3300025905 | Ga0207685_10000657 | Ga0207685_100006577 | 339 |
| 303 | 3300025906 | Ga0207699_10006768 | Ga0207699_100067682 | 339 |
| 304 | 3300025906 | Ga0207699_10017329 | Ga0207699_100173292 | 339 |
| 305 | 3300025906 | Ga0207699_10046549 | Ga0207699_100465492 | 339 |
| 306 | 3300025908 | Ga0207643_10012839 | Ga0207643_100128394 | 339 |
| 307 | 3300025910 | Ga0207684_10001497 | Ga0207684_1000149712 | 339 |
| 308 | 3300025910 | Ga0207684_10003148 | Ga0207684_1000314813 | 339 |
| 309 | 3300025910 | Ga0207684_10007382 | Ga0207684_100073824 | 339 |
| 310 | 3300025910 | Ga0207684_10019275 | Ga0207684_100192752 | 339 |
| 311 | 3300025910 | Ga0207684_10039551 | Ga0207684_100395514 | 339 |
| 312 | 3300025910 | Ga0207684_10039865 | Ga0207684_100398658 | 339 |
| 313 | 3300025910 | Ga0207684_10084566 | Ga0207684_100845662 | 339 |
| 314 | 3300025910 | Ga0207684_10161225 | Ga0207684_101612252 | 339 |
| 315 | 3300025910 | Ga0207684_10205637 | Ga0207684_102056372 | 339 |
| 316 | 3300025910 | Ga0207684_10221831 | Ga0207684_102218312 | 339 |
| 317 | 3300025910 | Ga0207684_10431869 | Ga0207684_104318691 | 339 |
| 318 | 3300025915 | Ga0207693_10075655 | Ga0207693_100756551 | 339 |
| 319 | 3300025916 | Ga0207663_10003613 | Ga0207663_100036137 | 339 |
| 320 | 3300025916 | Ga0207663_10016926 | Ga0207663_100169262 | 339 |
| 321 | 3300025922 | Ga0207646_10001473 | Ga0207646_1000147326 | 339 |
| 322 | 3300025922 | Ga0207646_10002713 | Ga0207646_100027135 | 339 |
| 323 | 3300025922 | Ga0207646_10002949 | Ga0207646_100029497 | 339 |
| 324 | 3300025922 | Ga0207646_10007561 | Ga0207646_1000756110 | 339 |
| 325 | 3300025922 | Ga0207646_10016968 | Ga0207646_100169684 | 339 |
| 326 | 3300025922 | Ga0207646_10039287 | Ga0207646_100392872 | 339 |
| 327 | 3300025922 | Ga0207646_10060949 | Ga0207646_100609492 | 339 |
| 328 | 3300025922 | Ga0207646_10084322 | Ga0207646_100843222 | 339 |
| 329 | 3300025922 | Ga0207646_10120187 | Ga0207646_101201872 | 339 |
| 330 | 3300025922 | Ga0207646_10320933 | Ga0207646_103209332 | 339 |
| 331 | 3300025922 | Ga0207646_10422108 | Ga0207646_104221081 | 339 |
| 332 | 3300025927 | Ga0207687_10015600 | Ga0207687_100156004 | 339 |
| 333 | 3300025927 | Ga0207687_10047199 | Ga0207687_100471994 | 339 |
| 334 | 3300025928 | Ga0207700_10002599 | Ga0207700_100025993 | 339 |
| 335 | 3300025928 | Ga0207700_10010060 | Ga0207700_100100604 | 339 |
| 336 | 3300025928 | Ga0207700_10015276 | Ga0207700_100152762 | 339 |
| 337 | 3300025928 | Ga0207700_10048048 | Ga0207700_100480482 | 339 |
| 338 | 3300025928 | Ga0207700_10062428 | Ga0207700_100624282 | 339 |
| 339 | 3300025928 | Ga0207700_10108935 | Ga0207700_101089351 | 339 |
| 340 | 3300025928 | Ga0207700_10132655 | Ga0207700_101326552 | 339 |
| 341 | 3300025928 | Ga0207700_10224320 | Ga0207700_102243201 | 339 |
| 342 | 3300025929 | Ga0207664_10030230 | Ga0207664_100302302 | 339 |
| 343 | 3300025929 | Ga0207664_10042027 | Ga0207664_100420273 | 339 |
| 344 | 3300025929 | Ga0207664_10079766 | Ga0207664_100797662 | 339 |
| 345 | 3300025931 | Ga0207644_10110735 | Ga0207644_101107352 | 339 |
| 346 | 3300025933 | Ga0207706_10303099 | Ga0207706_103030992 | 339 |
| 347 | 3300025936 | Ga0207670_10041944 | Ga0207670_100419443 | 339 |
| 348 | 3300025939 | Ga0207665_10129287 | Ga0207665_101292872 | 339 |
| 349 | 3300025939 | Ga0207665_10132085 | Ga0207665_101320852 | 339 |
| 350 | 3300025942 | Ga0207689_10005636 | Ga0207689_100056362 | 339 |
| 351 | 3300025942 | Ga0207689_10163691 | Ga0207689_101636912 | 339 |
| 352 | 3300025945 | Ga0207679_10187880 | Ga0207679_101878802 | 339 |
| 353 | 3300025945 | Ga0207679_10324153 | Ga0207679_103241531 | 339 |
| 354 | 3300025961 | Ga0207712_10039804 | Ga0207712_100398045 | 339 |
| 355 | 3300025961 | Ga0207712_10087859 | Ga0207712_100878592 | 339 |
| 356 | 3300025972 | Ga0207668_10086767 | Ga0207668_100867672 | 339 |
| 357 | 3300026023 | Ga0207677_10048749 | Ga0207677_100487492 | 339 |
| 358 | 3300026041 | Ga0207639_10254992 | Ga0207639_102549923 | 339 |
| 359 | 3300026067 | Ga0207678_10009825 | Ga0207678_100098256 | 339 |
| 360 | 3300026067 | Ga0207678_10066656 | Ga0207678_100666563 | 339 |
| 361 | 3300026078 | Ga0207702_10024493 | Ga0207702_100244934 | 339 |
| 362 | 3300026078 | Ga0207702_10084537 | Ga0207702_100845372 | 339 |
| 363 | 3300026089 | Ga0207648_10173445 | Ga0207648_101734452 | 339 |
| 364 | 3300026095 | Ga0207676_10078187 | Ga0207676_100781872 | 339 |
| 365 | 3300026095 | Ga0207676_10176511 | Ga0207676_101765112 | 339 |
| 366 | 3300026118 | Ga0207675_100024791 | Ga0207675_1000247914 | 339 |
| 367 | 3300026118 | Ga0207675_100070897 | Ga0207675_1000708972 | 339 |
| 368 | 3300026118 | Ga0207675_100110851 | Ga0207675_1001108511 | 339 |
| 369 | 3300026118 | Ga0207675_100194670 | Ga0207675_1001946704 | 339 |
| 370 | 3300026121 | Ga0207683_10001205 | Ga0207683_100012055 | 339 |
| 371 | 3300026121 | Ga0207683_10200222 | Ga0207683_102002222 | 339 |
| 372 | 3300028380 | Ga0268265_10437206 | Ga0268265_104372061 | 339 |
| 373 | 3300028800 | Ga0265338_10007876 | Ga0265338_1000787610 | 339 |
| 374 | 3300031456 | Ga0307513_10000126 | Ga0307513_1000012650 | 339 |
| 375 | 3300031995 | Ga0307409_100224880 | Ga0307409_1002248802 | 339 |
| 376 | 3300034818 | Ga0373950_0003976 | Ga0373950_0003976_996_2033 | 339 |
| 377 | 3300034820 | Ga0373959_0017991 | Ga0373959_0017991_149_1186 | 339 |
| 378 | 3300035086 | Ga0373934_0004401 | Ga0373934_0004401_1356_2390 | 339 |
| 379 | 3300035086 | Ga0373934_0006948 | Ga0373934_0006948_2976_3998 | 339 |
| 380 | 3300035088 | Ga0373940_0038640 | Ga0373940_0038640_195_1232 | 339 |
| 381 | 3300035089 | Ga0373944_0001319 | Ga0373944_0001319_1938_2960 | 339 |
| 382 | 3300035092 | Ga0373952_0003338 | Ga0373952_0003338_420_1442 | 339 |
| 383 | 3300035111 | Ga0373923_0000311 | Ga0373923_0000311_5809_6852 | 339 |
| 384 | 3300035111 | Ga0373923_0001290 | Ga0373923_0001290_819_1853 | 339 |
| 385 | 3300035112 | Ga0373932_0012708 | Ga0373932_0012708_574_1611 | 339 |
| 386 | 3300035116 | Ga0373945_0003956 | Ga0373945_0003956_490_1512 | 339 |
| 387 | 3300035117 | Ga0373953_0003403 | Ga0373953_0003403_3597_4631 | 339 |
| 388 | 3300035117 | Ga0373953_0003923 | Ga0373953_0003923_103_1125 | 339 |
| 389 | 3300035118 | Ga0373954_0031087 | Ga0373954_0031087_932_1954 | 339 |
| 390 | 3300035118 | Ga0373954_0033057 | Ga0373954_0033057_317_1354 | 339 |
| 391 | 3300035119 | Ga0373956_0000076 | Ga0373956_0000076_1546_2580 | 339 |
| 392 | 3300035120 | Ga0373957_0000009 | Ga0373957_0000009_6529_7563 | 339 |
| 393 | 3300035120 | Ga0373957_0001254 | Ga0373957_0001254_4609_5646 | 339 |
| 394 | 3300035170 | Ga0373943_0004905 | Ga0373943_0004905_2098_3120 | 339 |
| 395 | 3300035171 | Ga0373946_0035440 | Ga0373946_0035440_354_1391 | 339 |
| 396 | 3300035172 | Ga0373955_0000014 | Ga0373955_0000014_15751_16785 | 339 |
| 397 | 3300035410 | Ga0373924_0000396 | Ga0373924_0000396_1294_2328 | 339 |
| 398 | 3300035692 | Ga0373935_0123129 | Ga0373935_0123129_599_1636 | 339 |
| 399 | 3300035695 | Ga0373927_0025613 | Ga0373927_0025613_1862_2884 | 339 |
| 400 | 3300035724 | Ga0373933_0000115 | Ga0373933_0000115_41153_42187 | 339 |
| 401 | 3300035724 | Ga0373933_0000337 | Ga0373933_0000337_24635_25672 | 339 |
| 402 | 3300035724 | Ga0373933_0048187 | Ga0373933_0048187_1236_2258 | 339 |
| 403 | 3300036401 | Ga0373937_0000032 | Ga0373937_0000032_106567_107601 | 339 |
| 404 | 3300036401 | Ga0373937_0069764 | Ga0373937_0069764_2150_3172 | 339 |
| 405 | 3300037068 | Ga0373925_0061247 | Ga0373925_0061247_1080_2108 | 339 |
| 406 | 3300037418 | Ga0395900_0207821 | Ga0395900_0207821_229_1269 | 339 |
| 407 | 3300037853 | Ga0436364_1197580 | Ga0436364_1197580_671_1693 | 339 |
| 408 | 3300037853 | Ga0436364_1394990 | Ga0436364_1394990_243_1283 | 339 |
| 409 | 3300038443 | Ga0395901_0172510 | Ga0395901_0172510_730_1770 | 339 |
| 410 | 3300039437 | Ga0436365_1659451 | Ga0436365_1659451_7321_8388 | 339 |
| 411 | 3300039450 | Ga0436363_1432344 | Ga0436363_1432344_915_1937 | 339 |
| 412 | 3300041441 | Ga0451787_756802 | Ga0451787_756802_74_1117 | 339 |
| 413 | 3300041451 | Ga0451791_1384070 | Ga0451791_1384070_46_1089 | 339 |
| 414 | 3300041452 | Ga0451793_1156241 | Ga0451793_1156241_842_1885 | 339 |
| 415 | 3300041496 | Ga0451839_0764437 | Ga0451839_0764437_129_1181 | 339 |
| 416 | 3300041496 | Ga0451839_1508461 | Ga0451839_1508461_464_1507 | 339 |
| 417 | 3300041512 | Ga0451853_0309492 | Ga0451853_0309492_1872_2915 | 339 |
| 418 | 3300044694 | Ga0466963_0116411 | Ga0466963_0116411_217_1260 | 339 |
| 419 | 3300044694 | Ga0466963_0120340 | Ga0466963_0120340_467_1504 | 339 |
| 420 | 3300044901 | Ga0466960_0042449 | Ga0466960_0042449_329_1375 | 339 |
| 421 | 3300045049 | Ga0466959_0085538 | Ga0466959_0085538_112_1155 | 339 |
| 422 | 3300045976 | Ga0466967_0244327 | Ga0466967_0244327_445_1488 | 339 |
| 423 | 3300046454 | Ga0495592_0000079 | Ga0495592_0000079_41153_42187 | 339 |
| 424 | 3300046455 | Ga0495603_0001329 | Ga0495603_0001329_8849_9871 | 339 |
| 425 | 3300046459 | Ga0495629_0004876 | Ga0495629_0004876_4695_5717 | 339 |
| 426 | 3300046461 | Ga0495641_0004673 | Ga0495641_0004673_402_1424 | 339 |
| 427 | 3300046462 | Ga0495651_0000010 | Ga0495651_0000010_41153_42187 | 339 |
| 428 | 3300046462 | Ga0495651_0003105 | Ga0495651_0003105_3053_4075 | 339 |
| 429 | 3300046463 | Ga0495653_0005012 | Ga0495653_0005012_1078_2112 | 339 |
| 430 | 3300046463 | Ga0495653_0017441 | Ga0495653_0017441_1964_3001 | 339 |
| 431 | 3300046463 | Ga0495653_0046822 | Ga0495653_0046822_103_1125 | 339 |
| 432 | 3300046463 | Ga0495653_0170123 | Ga0495653_0170123_98_1141 | 339 |
| 433 | 3300046472 | Ga0495580_0002884 | Ga0495580_0002884_4454_5476 | 339 |
| 434 | 3300046472 | Ga0495580_0135205 | Ga0495580_0135205_491_1528 | 339 |
| 435 | 3300046473 | Ga0495582_0215661 | Ga0495582_0215661_23_1066 | 339 |
| 436 | 3300046475 | Ga0495639_0001380 | Ga0495639_0001380_3068_4090 | 339 |
| 437 | 3300046476 | Ga0495662_0000054 | Ga0495662_0000054_33822_34844 | 339 |
| 438 | 3300046476 | Ga0495662_0027670 | Ga0495662_0027670_1393_2430 | 339 |
| 439 | 3300046477 | Ga0495664_0025168 | Ga0495664_0025168_2356_3393 | 339 |
| 440 | 3300046499 | Ga0495594_0003877 | Ga0495594_0003877_2150_3172 | 339 |
| 441 | 3300046511 | Ga0495608_0000037 | Ga0495608_0000037_23761_24795 | 339 |
| 442 | 3300046511 | Ga0495608_0033472 | Ga0495608_0033472_932_1954 | 339 |
| 443 | 3300046514 | Ga0495618_0101106 | Ga0495618_0101106_751_1788 | 339 |
| 444 | 3300046516 | Ga0495628_0000227 | Ga0495628_0000227_17247_18281 | 339 |
| 445 | 3300046516 | Ga0495628_0014366 | Ga0495628_0014366_4640_5662 | 339 |
| 446 | 3300046517 | Ga0495630_0016104 | Ga0495630_0016104_129_1151 | 339 |
| 447 | 3300046526 | Ga0495666_0000320 | Ga0495666_0000320_16622_17644 | 339 |
| 448 | 3300046526 | Ga0495666_0048015 | Ga0495666_0048015_960_1997 | 339 |
| 449 | 3300046529 | Ga0495652_0000180 | Ga0495652_0000180_27122_28156 | 339 |
| 450 | 3300046529 | Ga0495652_0128088 | Ga0495652_0128088_253_1290 | 339 |
| 451 | 3300046531 | Ga0495665_0001132 | Ga0495665_0001132_7540_8562 | 339 |
| 452 | 3300046531 | Ga0495665_0028454 | Ga0495665_0028454_598_1635 | 339 |
| 453 | 3300046533 | Ga0495640_0001333 | Ga0495640_0001333_4611_5633 | 339 |
| 454 | 3300046533 | Ga0495640_0169056 | Ga0495640_0169056_107_1168 | 339 |
| 455 | 3300046535 | Ga0495586_0003317 | Ga0495586_0003317_2580_3602 | 339 |
| 456 | 3300046536 | Ga0495587_0000024 | Ga0495587_0000024_106566_107600 | 339 |
| 457 | 3300046536 | Ga0495587_0067226 | Ga0495587_0067226_747_1769 | 339 |
| 458 | 3300046543 | Ga0495645_0026089 | Ga0495645_0026089_2892_3914 | 339 |
| 459 | 3300046543 | Ga0495645_0218584 | Ga0495645_0218584_242_1264 | 339 |
| 460 | 3300046543 | Ga0495645_0262903 | Ga0495645_0262903_47_1084 | 339 |
| 461 | 3300046557 | Ga0495622_0035469 | Ga0495622_0035469_309_1331 | 339 |
| 462 | 3300046559 | Ga0495667_0000024 | Ga0495667_0000024_126125_127159 | 339 |
| 463 | 3300046559 | Ga0495667_0016932 | Ga0495667_0016932_1009_2031 | 339 |
| 464 | 3300046642 | Ga0495634_0029983 | Ga0495634_0029983_512_1549 | 339 |
| 465 | 3300046642 | Ga0495634_0061977 | Ga0495634_0061977_270_1307 | 339 |
| 466 | 3300046663 | Ga0495635_0015699 | Ga0495635_0015699_2898_3935 | 339 |
| 467 | 3300046663 | Ga0495635_0077101 | Ga0495635_0077101_274_1311 | 339 |
| 468 | 3300046674 | Ga0495588_0100893 | Ga0495588_0100893_222_1259 | 339 |
| 469 | 3300046675 | Ga0495657_0000121 | Ga0495657_0000121_41141_42175 | 339 |
| 470 | 3300046675 | Ga0495657_0011263 | Ga0495657_0011263_1301_2323 | 339 |
| 471 | 3300046675 | Ga0495657_0022148 | Ga0495657_0022148_1204_2241 | 339 |
| 472 | 3300046678 | Ga0495599_0000147 | Ga0495599_0000147_20802_21836 | 339 |
| 473 | 3300046678 | Ga0495599_0026350 | Ga0495599_0026350_2420_3457 | 339 |
| 474 | 3300046679 | Ga0495623_0005725 | Ga0495623_0005725_6900_7934 | 339 |
| 475 | 3300046679 | Ga0495623_0071085 | Ga0495623_0071085_66_1109 | 339 |
| 476 | 3300046680 | Ga0495646_0017216 | Ga0495646_0017216_316_1353 | 339 |
| 477 | 3300046680 | Ga0495646_0047107 | Ga0495646_0047107_929_1963 | 339 |
| 478 | 3300046681 | Ga0495647_0084753 | Ga0495647_0084753_35_1057 | 339 |
| 479 | 3300046683 | Ga0495658_0023344 | Ga0495658_0023344_2038_3075 | 339 |
| 480 | 3300046689 | Ga0495613_0004929 | Ga0495613_0004929_1347_2369 | 339 |
| 481 | 3300046690 | Ga0495624_0000590 | Ga0495624_0000590_21678_22700 | 339 |
| 482 | 3300046809 | Ga0495600_0000969 | Ga0495600_0000969_1269_2303 | 339 |
| 483 | 3300046809 | Ga0495600_0003937 | Ga0495600_0003937_7412_8434 | 339 |
| 484 | 3300047315 | Ga0495581_0002158 | Ga0495581_0002158_6904_7926 | 339 |
| 485 | 3300047315 | Ga0495581_0040874 | Ga0495581_0040874_68_1105 | 339 |
| 486 | 3300047317 | Ga0495604_0000024 | Ga0495604_0000024_106383_107417 | 339 |
| 487 | 3300047317 | Ga0495604_0013137 | Ga0495604_0013137_1581_2603 | 339 |
| 488 | 3300047317 | Ga0495604_0038152 | Ga0495604_0038152_2144_3181 | 339 |
| 489 | 3300047321 | Ga0495676_0012245 | Ga0495676_0012245_6476_7498 | 339 |
| 490 | 3300047321 | Ga0495676_0043544 | Ga0495676_0043544_326_1363 | 339 |
| 491 | 3300047321 | Ga0495676_0109686 | Ga0495676_0109686_304_1341 | 339 |
| 492 | 3300047322 | Ga0495680_0000005 | Ga0495680_0000005_41129_42163 | 339 |
| 493 | 3300047322 | Ga0495680_0007072 | Ga0495680_0007072_1519_2541 | 339 |
| 494 | 3300047444 | Ga0495675_0003613 | Ga0495675_0003613_6855_7889 | 339 |
| 495 | 3300047471 | Ga0495684_0002509 | Ga0495684_0002509_8823_9845 | 339 |
| 496 | 3300047471 | Ga0495684_0135067 | Ga0495684_0135067_620_1642 | 339 |
| 497 | 3300047673 | Ga0495593_0022942 | Ga0495593_0022942_301_1323 | 339 |
| 498 | 3300047673 | Ga0495593_0024694 | Ga0495593_0024694_1658_2695 | 339 |
| 499 | 3300048088 | Ga0495602_0000198 | Ga0495602_0000198_12548_13582 | 339 |
| 500 | 3300048088 | Ga0495602_0196016 | Ga0495602_0196016_103_1125 | 339 |
| 501 | 3300048089 | Ga0495614_0010473 | Ga0495614_0010473_952_1995 | 339 |
| 502 | 3300048903 | Ga0496100_0275979 | Ga0496100_0275979_35_1183 | 339 |
| 503 | 3300048904 | Ga0496101_0011639 | Ga0496101_0011639_2525_3562 | 339 |
| 504 | 3300048904 | Ga0496101_0107391 | Ga0496101_0107391_366_1415 | 339 |
| 505 | 3300048904 | Ga0496101_0279988 | Ga0496101_0279988_108_1151 | 339 |
| 506 | 3300048905 | Ga0496102_0039903 | Ga0496102_0039903_2901_3944 | 339 |
| 507 | 3300048905 | Ga0496102_0186101 | Ga0496102_0186101_567_1607 | 339 |
| 508 | 3300048905 | Ga0496102_0200438 | Ga0496102_0200438_256_1290 | 339 |
| 509 | 3300048906 | Ga0496103_0074606 | Ga0496103_0074606_313_1350 | 339 |
| 510 | 3300048906 | Ga0496103_0082117 | Ga0496103_0082117_45_1088 | 339 |
| 511 | 3300048907 | Ga0496104_0013971 | Ga0496104_0013971_5105_6139 | 339 |
| 512 | 3300048907 | Ga0496104_0048802 | Ga0496104_0048802_726_1874 | 339 |
| 513 | 3300048907 | Ga0496104_0139080 | Ga0496104_0139080_390_1427 | 339 |
| 514 | 3300048907 | Ga0496104_0199404 | Ga0496104_0199404_532_1575 | 339 |
| 515 | 3300048908 | Ga0496105_0001663 | Ga0496105_0001663_1136_2170 | 339 |
| 516 | 3300048908 | Ga0496105_0007219 | Ga0496105_0007219_4268_5305 | 339 |
| 517 | 3300048908 | Ga0496105_0009644 | Ga0496105_0009644_4461_5504 | 339 |
| 518 | 3300048909 | Ga0496106_0050943 | Ga0496106_0050943_595_1638 | 339 |
| 519 | 3300048909 | Ga0496106_0275017 | Ga0496106_0275017_43_1089 | 339 |
| 520 | 3300048910 | Ga0496107_0163849 | Ga0496107_0163849_541_1578 | 339 |
| 521 | 3300048911 | Ga0496108_0000699 | Ga0496108_0000699_608_1657 | 339 |
| 522 | 3300048911 | Ga0496108_0006352 | Ga0496108_0006352_5198_6232 | 339 |
| 523 | 3300048911 | Ga0496108_0013794 | Ga0496108_0013794_5157_6200 | 339 |
| 524 | 3300048911 | Ga0496108_0131370 | Ga0496108_0131370_459_1607 | 339 |
| 525 | 3300048912 | Ga0496109_0002411 | Ga0496109_0002411_12545_13588 | 339 |
| 526 | 3300048912 | Ga0496109_0002951 | Ga0496109_0002951_12619_13653 | 339 |
| 527 | 3300048912 | Ga0496109_0030488 | Ga0496109_0030488_1142_2290 | 339 |
| 528 | 3300048913 | Ga0496110_0000964 | Ga0496110_0000964_17709_18758 | 339 |
| 529 | 3300048913 | Ga0496110_0036332 | Ga0496110_0036332_1019_2065 | 339 |
| 530 | 3300048913 | Ga0496110_0096467 | Ga0496110_0096467_360_1508 | 339 |
| 531 | 3300048913 | Ga0496110_0300377 | Ga0496110_0300377_396_1433 | 339 |
| 532 | 3300048913 | Ga0496110_0322336 | Ga0496110_0322336_350_1384 | 339 |
| 533 | 3300048914 | Ga0496111_0002511 | Ga0496111_0002511_3073_4116 | 339 |
| 534 | 3300048914 | Ga0496111_0029572 | Ga0496111_0029572_1678_2826 | 339 |
| 535 | 3300048914 | Ga0496111_0051776 | Ga0496111_0051776_66_1115 | 339 |
| 536 | 3300048914 | Ga0496111_0089630 | Ga0496111_0089630_528_1562 | 339 |
| 537 | 3300048915 | Ga0496112_0008446 | Ga0496112_0008446_2427_3461 | 339 |
| 538 | 3300048915 | Ga0496112_0156970 | Ga0496112_0156970_449_1492 | 339 |
| 539 | 3300048915 | Ga0496112_0328858 | Ga0496112_0328858_196_1233 | 339 |
| 540 | 3300048916 | Ga0496113_0037712 | Ga0496113_0037712_1215_2249 | 339 |
| 541 | 3300048916 | Ga0496113_0055172 | Ga0496113_0055172_1371_2519 | 339 |
| 542 | 3300048916 | Ga0496113_0097975 | Ga0496113_0097975_953_1996 | 339 |
| 543 | 3300048917 | Ga0496114_0035702 | Ga0496114_0035702_375_1418 | 339 |
| 544 | 3300048917 | Ga0496114_0177574 | Ga0496114_0177574_434_1471 | 339 |
| 545 | 3300048918 | Ga0496115_0046685 | Ga0496115_0046685_670_1707 | 339 |
| 546 | 3300048918 | Ga0496115_0057982 | Ga0496115_0057982_1839_2873 | 339 |
| 547 | 3300050507 | nmdc:mga05p37_30825_c1 | nmdc:mga05p37_30825_c1_1183_2220 | 339 |
| 548 | 3300050512 | nmdc:mga0n895_16547_c1 | nmdc:mga0n895_16547_c1_1346_2383 | 339 |
| 549 | 3300050512 | nmdc:mga0n895_30906_c1 | nmdc:mga0n895_30906_c1_3921_4955 | 339 |
| 550 | 3300050513 | nmdc:mga0rr50_101215_c1 | nmdc:mga0rr50_101215_c1_369_1406 | 339 |
| 551 | 3300050513 | nmdc:mga0rr50_3773_c1 | nmdc:mga0rr50_3773_c1_4519_5553 | 339 |
| 552 | 3300050514 | nmdc:mga08x19_6579_c1 | nmdc:mga08x19_6579_c1_451_1485 | 339 |
| 553 | 3300050514 | nmdc:mga08x19_89201_c1 | nmdc:mga08x19_89201_c1_62_1096 | 339 |
| 554 | 3300050515 | nmdc:mga0a205_127950_c1 | nmdc:mga0a205_127950_c1_1335_2369 | 339 |
| 555 | 3300050515 | nmdc:mga0a205_21165_c1 | nmdc:mga0a205_21165_c1_4127_5164 | 339 |
| 556 | 3300053077 | Ga0495601_0005539 | Ga0495601_0005539_4826_5848 | 339 |
| 557 | 3300053084 | Ga0495595_0002796 | Ga0495595_0002796_5192_6226 | 339 |
| 558 | 3300053084 | Ga0495595_0023996 | Ga0495595_0023996_923_1945 | 339 |
| 559 | 3300053084 | Ga0495595_0065463 | Ga0495595_0065463_40_1077 | 339 |
| 560 | 3300053085 | Ga0495619_0018349 | Ga0495619_0018349_3162_4199 | 339 |
| 561 | 3300053085 | Ga0495619_0046944 | Ga0495619_0046944_932_1954 | 339 |
| 562 | 3300053085 | Ga0495619_0168726 | Ga0495619_0168726_24_1046 | 339 |
| 563 | 3300053153 | Ga0500616_0000601 | Ga0500616_0000601_27049_28092 | 339 |
| 564 | 3300053153 | Ga0500616_0001662 | Ga0500616_0001662_17973_19016 | 339 |
| 565 | iso_pu_bacteria | 2734482000 | 2734971295 | 339 |
| 566 | 3300005434 | Ga0070709_10001054 | Ga0070709_100010548 | 340 |
| 567 | 3300005435 | Ga0070714_100003000 | Ga0070714_1000030006 | 340 |
| 568 | 3300005436 | Ga0070713_100004246 | Ga0070713_1000042466 | 340 |
| 569 | 3300005437 | Ga0070710_10002866 | Ga0070710_100028666 | 340 |
| 570 | 3300005439 | Ga0070711_100002119 | Ga0070711_1000021198 | 340 |
| 571 | 3300005468 | Ga0070707_100013680 | Ga0070707_1000136806 | 340 |
| 572 | 3300005471 | Ga0070698_100030848 | Ga0070698_1000308482 | 340 |
| 573 | 3300005536 | Ga0070697_100030377 | Ga0070697_1000303774 | 340 |
| 574 | 3300006028 | Ga0070717_10016279 | Ga0070717_100162795 | 340 |
| 575 | 3300006163 | Ga0070715_10079234 | Ga0070715_100792342 | 340 |
| 576 | 3300006173 | Ga0070716_100008672 | Ga0070716_1000086725 | 340 |
| 577 | 3300006175 | Ga0070712_100007917 | Ga0070712_1000079174 | 340 |
| 578 | 3300025898 | Ga0207692_10002566 | Ga0207692_100025665 | 340 |
| 579 | 3300025905 | Ga0207685_10006692 | Ga0207685_100066922 | 340 |
| 580 | 3300025906 | Ga0207699_10000629 | Ga0207699_1000062911 | 340 |
| 581 | 3300025915 | Ga0207693_10009218 | Ga0207693_100092184 | 340 |
| 582 | 3300025916 | Ga0207663_10089920 | Ga0207663_100899202 | 340 |
| 583 | 3300025922 | Ga0207646_10121481 | Ga0207646_101214812 | 340 |
| 584 | 3300025928 | Ga0207700_10001515 | Ga0207700_100015157 | 340 |
| 585 | 3300025929 | Ga0207664_10000725 | Ga0207664_100007256 | 340 |
| 586 | 3300025939 | Ga0207665_10014440 | Ga0207665_100144405 | 340 |
| 587 | 3300003659 | JGI25404J52841_10005468 | JGI25404J52841_100054682 | 342 |
| 588 | 3300005337 | Ga0070682_100096773 | Ga0070682_1000967732 | 342 |
| 589 | 3300005338 | Ga0068868_100068682 | Ga0068868_1000686822 | 342 |
| 590 | 3300005366 | Ga0070659_100102539 | Ga0070659_1001025392 | 342 |
| 591 | 3300005436 | Ga0070713_100205290 | Ga0070713_1002052902 | 342 |
| 592 | 3300005444 | Ga0070694_100139907 | Ga0070694_1001399071 | 342 |
| 593 | 3300005530 | Ga0070679_100154814 | Ga0070679_1001548142 | 342 |
| 594 | 3300005546 | Ga0070696_100150923 | Ga0070696_1001509232 | 342 |
| 595 | 3300005577 | Ga0068857_100060392 | Ga0068857_1000603922 | 342 |
| 596 | 3300005615 | Ga0070702_100030189 | Ga0070702_1000301893 | 342 |
| 597 | 3300005616 | Ga0068852_100197413 | Ga0068852_1001974132 | 342 |
| 598 | 3300005834 | Ga0068851_10087552 | Ga0068851_100875522 | 342 |
| 599 | 3300005983 | Ga0081540_1000251 | Ga0081540_100025153 | 342 |
| 600 | 3300006237 | Ga0097621_100038113 | Ga0097621_1000381132 | 342 |
| 601 | 3300009036 | Ga0105244_10055981 | Ga0105244_100559811 | 342 |
| 602 | 3300011119 | Ga0105246_10059406 | Ga0105246_100594062 | 342 |
| 603 | 3300013102 | Ga0157371_10043493 | Ga0157371_100434932 | 342 |
| 604 | 3300013308 | Ga0157375_10128142 | Ga0157375_101281422 | 342 |
| 605 | 3300025904 | Ga0207647_10040693 | Ga0207647_100406932 | 342 |
| 606 | 3300025906 | Ga0207699_10084631 | Ga0207699_100846312 | 342 |
| 607 | 3300025908 | Ga0207643_10011015 | Ga0207643_100110156 | 342 |
| 608 | 3300025919 | Ga0207657_10059413 | Ga0207657_100594131 | 342 |
| 609 | 3300025929 | Ga0207664_10031034 | Ga0207664_100310342 | 342 |
| 610 | 3300025939 | Ga0207665_10109103 | Ga0207665_101091032 | 342 |
| 611 | 3300025981 | Ga0207640_10029853 | Ga0207640_100298532 | 342 |
| 612 | 3300026116 | Ga0207674_10028952 | Ga0207674_100289523 | 342 |
| 613 | 3300035207 | Ga0373942_0036599 | Ga0373942_0036599_182_1234 | 342 |
| 614 | 3300048906 | Ga0496103_0017956 | Ga0496103_0017956_2092_3249 | 342 |
| 615 | 3300048909 | Ga0496106_0101693 | Ga0496106_0101693_1132_2193 | 342 |
| 616 | 3300048910 | Ga0496107_0016058 | Ga0496107_0016058_2997_4154 | 342 |
| 617 | 3300048918 | Ga0496115_0112255 | Ga0496115_0112255_458_1615 | 342 |
| 618 | 3300048929 | Ga0496126_0335961 | Ga0496126_0335961_146_1207 | 342 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1q8a-assembly2.cif.gz_B | cobalamin-dependent methionine synthase (1-566) from thermotoga maritima (cd2+:l-hcy complex, se-met) | 0.913 | 15 | 311 |
| 1q8j-assembly2.cif.gz_B | cobalamin-dependent methionine synthase (1-566) from thermotoga maritima (cd2+, hcy, methyltetrahydrofolate complex) | 0.9067 | 15 | 311 |
| 3bol-assembly1.cif.gz_B | cobalamin-dependent methionine synthase (1-566) from thermotoga maritima complexed with zn2+ | 0.8952 | 14 | 312 |
| 1q85-assembly2.cif.gz_B | cobalamin-dependent methionine synthase (1-566) from thermotoga maritima (cd2+ complex, se-met) | 0.8906 | 15 | 311 |
| 8d45-assembly1.cif.gz_C | cryo-em structure of human kidney betaine-homocysteine methyltransferase | 0.8904 | 1 | 336 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1q85B01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Homocysteine-binding-like domain | 0.8879 | 15 | 311 | 3.20.20.330 |
| 1lt7B00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Homocysteine-binding-like domain | 0.8699 | 3 | 335 | 3.20.20.330 |
| af_Q2G121_2_294_3.20.20.330 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Homocysteine-binding-like domain | 0.8686 | 15 | 310 | 3.20.20.330 |
| 4m3pA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Homocysteine-binding-like domain | 0.843 | 3 | 335 | 3.20.20.330 |
| 5dmnB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Homocysteine-binding-like domain | 0.8326 | 8 | 306 | 3.20.20.330 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A8B6F4G1-F1-model_v4 | Hcy-binding domain-containing protein | 0.9715 | 17 | 254 |
GO:0008168
GO:0008270 GO:0009086 GO:0032259 |
| AF-A0A7V9BEQ1-F1-model_v4 | Homocysteine S-methyltransferase family protein | 0.97 | 2 | 234 |
GO:0008168
GO:0008270 GO:0009086 GO:0032259 |
| AF-A0A534CAH7-F1-model_v4 | Homocysteine S-methyltransferase family protein | 0.9692 | 59 | 340 |
GO:0008168
GO:0008270 GO:0009086 GO:0032259 |
| AF-A0A2K2VXC3-F1-model_v4 | Homocysteine methyltransferase | 0.9689 | 5 | 341 |
GO:0008168
GO:0008270 GO:0009086 GO:0032259 |
| AF-N4WPN7-F1-model_v4 | Homocysteine S-methyltransferase | 0.9669 | 28 | 340 |
GO:0008168
GO:0008270 GO:0009086 GO:0032259 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar