F469715

General Info

Members Datasets Scaffolds Average Seq Length
618 279 1236 161

Family's Representative Sequence

Representative Sequence 3300005455|Ga0070663_100108654|Ga0070663_1001086543
Length 184
Sequence MVSTMLAPGRLSQPGSGLWSTMPKLSAGLLLYRETDGLLEVLIGHPGGPFWAHRDEGAWSVPKGEYVEGEDPWAVAQREFTEEIGKPPPAGSRIDLTPVRQPSGKVITAFAVRGNLDLQGTFSNTFTLEWPKGSGNLREYPEIDRVAWLAVAAARSKLVTGQRPLLDQLEDVLGHGGPSASRLH

Samples

Sample ID Description Type Environment
1 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
6 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
10 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
11 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
172 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
177 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
180 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
181 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
182 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
183 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
186 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
187 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
188 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
189 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
190 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
191 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
192 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
193 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
194 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
195 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
196 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
197 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
198 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
199 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
200 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
201 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
202 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
203 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
204 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
205 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
206 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
207 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
208 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
209 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
210 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
211 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
212 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
213 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
214 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
215 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
216 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
217 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
218 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
219 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
220 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
221 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
222 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
223 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
224 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
225 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
226 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
227 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
228 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
229 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
230 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
231 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
232 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
233 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
234 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
235 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
236 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
237 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
238 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
239 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
240 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
241 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
242 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
243 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
244 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
245 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
246 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
247 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
251 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
252 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
253 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
255 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
256 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
257 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
258 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
259 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
260 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
261 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
262 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
263 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
266 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
267 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
268 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
269 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
270 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
271 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
272 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
273 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
274 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
275 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
276 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
277 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
278 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
279 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.87
Metatranscriptomes 0
Isolates 1.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.4
Nodule 0.16
Rhizoplane 11.97
Rhizosphere 71.36
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070663_100108654 3300005455 Bacteria 2081
2 JGI24746J21847_1001214 3300001977 Bacteria 4088
3 JGI24737J22298_10009598 3300001990 Bacteria 3211
4 JGI24743J22301_10032915 3300001991 Bacteria 1025
5 JGI24750J21931_1006543 3300002070 Bacteria 1452
6 JGI24745J21846_1001416 3300002073 Bacteria 2325
7 JGI24738J21930_10007022 3300002075 Bacteria 2616
8 JGI24744J21845_10000298 3300002077 Bacteria 8323
9 JGI24034J26672_10000901 3300002239 Bacteria 3864
10 JGI24742J22300_10001104 3300002244 Bacteria 4180
11 JGI24751J29686_10030174 3300002459 Bacteria 1125
12 Ga0070676_10002844 3300005328 Bacteria 8940
13 Ga0070683_100136261 3300005329 Bacteria 2325
14 Ga0070683_100239435 3300005329 Bacteria 1726
15 Ga0070690_100027305 3300005330 Bacteria 3528
16 Ga0070670_100071587 3300005331 Bacteria 2977
17 Ga0068869_100040221 3300005334 Bacteria 3343
18 Ga0070666_10019831 3300005335 Bacteria 4343
19 Ga0070682_100031437 3300005337 Bacteria 3211
20 Ga0070682_100065580 3300005337 Bacteria 2308
21 Ga0070682_100118676 3300005337 Bacteria 1773
22 Ga0070682_100367877 3300005337 Bacteria 1077
23 Ga0070682_100584807 3300005337 Bacteria 879
24 Ga0068868_100001869 3300005338 Bacteria 14460
25 Ga0068868_100070578 3300005338 Bacteria 2785
26 Ga0068868_100234528 3300005338 Bacteria 1540
27 Ga0070660_100375737 3300005339 Bacteria 1173
28 Ga0070689_100031298 3300005340 Bacteria 4043
29 Ga0070691_10000393 3300005341 Bacteria 15867
30 Ga0070687_100028048 3300005343 Bacteria 2727
31 Ga0070692_10178933 3300005345 Bacteria 1228
32 Ga0070692_10571023 3300005345 Bacteria 744
33 Ga0070668_100001504 3300005347 Bacteria 16848
34 Ga0070668_100008649 3300005347 Bacteria 7560
35 Ga0070668_100096087 3300005347 Bacteria 2341
36 Ga0070668_100396293 3300005347 Bacteria 1178
37 Ga0070668_100551074 3300005347 Bacteria 1004
38 Ga0070668_101032636 3300005347 Bacteria 740
39 Ga0070669_100007786 3300005353 Bacteria 7653
40 Ga0070669_100772538 3300005353 Bacteria 815
41 Ga0070675_100238424 3300005354 Bacteria 1588
42 Ga0070671_100010560 3300005355 Bacteria 7414
43 Ga0070671_100033434 3300005355 Bacteria 4253
44 Ga0070671_100045650 3300005355 Bacteria 3643
45 Ga0070671_101718909 3300005355 Bacteria 557
46 Ga0070674_100005402 3300005356 Bacteria 7376
47 Ga0070674_100078782 3300005356 Bacteria 2349
48 Ga0070673_100264297 3300005364 Bacteria 1504
49 Ga0070688_100017443 3300005365 Bacteria 4120
50 Ga0070688_100054006 3300005365 Bacteria 2515
51 Ga0070688_100162065 3300005365 Bacteria 1537
52 Ga0070688_100443498 3300005365 Bacteria 969
53 Ga0070659_100049021 3300005366 Bacteria 3320
54 Ga0070659_100428222 3300005366 Bacteria 1120
55 Ga0070659_100485993 3300005366 Bacteria 1051
56 Ga0070667_100000768 3300005367 Bacteria 30544
57 Ga0070667_100019646 3300005367 Bacteria 5604
58 Ga0070667_100587167 3300005367 Bacteria 1026
59 Ga0070703_10021166 3300005406 Bacteria 1899
60 Ga0070709_10046446 3300005434 Bacteria 2700
61 Ga0070709_10068271 3300005434 Bacteria 2286
62 Ga0070709_10219526 3300005434 Bacteria 1355
63 Ga0070713_100040921 3300005436 Bacteria 3772
64 Ga0070713_100420506 3300005436 Bacteria 1251
65 Ga0070710_10002246 3300005437 Bacteria 9142
66 Ga0070710_10016812 3300005437 Bacteria 3731
67 Ga0070701_10000956 3300005438 Bacteria 10470
68 Ga0070701_10235844 3300005438 Bacteria 1098
69 Ga0070711_100000419 3300005439 Bacteria 22017
70 Ga0070711_100162236 3300005439 Bacteria 1695
71 Ga0070711_100447489 3300005439 Bacteria 1057
72 Ga0070705_100016354 3300005440 Bacteria 3854
73 Ga0070700_100002346 3300005441 Bacteria 9636
74 Ga0070700_100037952 3300005441 Bacteria 2933
75 Ga0070700_100293383 3300005441 Bacteria 1184
76 Ga0070694_100125560 3300005444 Bacteria 1847
77 Ga0070663_100052810 3300005455 Bacteria 2900
78 Ga0070663_100077338 3300005455 Bacteria 2436
79 Ga0070663_100103531 3300005455 Bacteria 2128
80 Ga0070678_100016383 3300005456 Bacteria 4741
81 Ga0070678_100057370 3300005456 Bacteria 2852
82 Ga0070678_100074909 3300005456 Bacteria 2545
83 Ga0070678_100131182 3300005456 Bacteria 1991
84 Ga0070678_100786365 3300005456 Bacteria 863
85 Ga0070662_100044555 3300005457 Bacteria 3178
86 Ga0070662_101440409 3300005457 Bacteria 594
87 Ga0068867_100000571 3300005459 Bacteria 24434
88 Ga0070685_10424591 3300005466 Bacteria 926
89 Ga0070684_100444630 3300005535 Bacteria 1198
90 Ga0068853_100044114 3300005539 Bacteria 3817
91 Ga0068853_100173701 3300005539 Bacteria 1951
92 Ga0068853_100693699 3300005539 Bacteria 971
93 Ga0070695_100002476 3300005545 Bacteria 10629
94 Ga0070696_100119303 3300005546 Bacteria 1907
95 Ga0070696_100281717 3300005546 Bacteria 1267
96 Ga0070696_100713675 3300005546 Bacteria 818
97 Ga0070693_100735174 3300005547 Bacteria 726
98 Ga0070665_100031675 3300005548 Bacteria 5321
99 Ga0070665_100060040 3300005548 Bacteria 3812
100 Ga0070665_100128395 3300005548 Bacteria 2538
101 Ga0070665_100224564 3300005548 Bacteria 1878
102 Ga0070665_100424712 3300005548 Bacteria 1338
103 Ga0070704_100000452 3300005549 Bacteria 19343
104 Ga0070704_100184799 3300005549 Bacteria 1670
105 Ga0070704_100515903 3300005549 Bacteria 1039
106 Ga0068855_100098252 3300005563 Bacteria 3373
107 Ga0068854_100001292 3300005578 Bacteria 15079
108 Ga0068854_100149008 3300005578 Bacteria 1802
109 Ga0070702_100033385 3300005615 Bacteria 2829
110 Ga0070702_100036872 3300005615 Bacteria 2712
111 Ga0070702_100137908 3300005615 Bacteria 1550
112 Ga0068852_100052566 3300005616 Bacteria 3502
113 Ga0068852_100059885 3300005616 Bacteria 3304
114 Ga0068852_100076819 3300005616 Bacteria 2950
115 Ga0068852_101847384 3300005616 Bacteria 626
116 Ga0068859_100006020 3300005617 Bacteria 12321
117 Ga0068859_100189164 3300005617 Bacteria 2143
118 Ga0068864_100582410 3300005618 Bacteria 1084
119 Ga0068864_101166672 3300005618 Bacteria 768
120 Ga0068866_10000247 3300005718 Bacteria 25524
121 Ga0068866_10133369 3300005718 Bacteria 1416
122 Ga0068866_10921299 3300005718 Bacteria 616
123 Ga0068861_100000589 3300005719 Bacteria 21515
124 Ga0068861_100232674 3300005719 Bacteria 1564
125 Ga0068870_10329536 3300005840 Bacteria 973
126 Ga0068863_100002906 3300005841 Bacteria 16981
127 Ga0068863_100120419 3300005841 Bacteria 2502
128 Ga0068858_100008281 3300005842 Bacteria 9997
129 Ga0068858_100017798 3300005842 Bacteria 6653
130 Ga0068858_100518409 3300005842 Bacteria 1153
131 Ga0068860_100006280 3300005843 Bacteria 11934
132 Ga0068860_100100699 3300005843 Bacteria 2757
133 Ga0068860_100129372 3300005843 Bacteria 2422
134 Ga0068862_100034022 3300005844 Bacteria 4309
135 Ga0068862_100116012 3300005844 Bacteria 2355
136 Ga0068862_101057789 3300005844 Bacteria 805
137 Ga0068862_101574323 3300005844 Bacteria 664
138 Ga0081455_10024191 3300005937 Bacteria 5632
139 Ga0081540_1037336 3300005983 Bacteria 2577
140 Ga0075365_10001410 3300006038 Bacteria 10856
141 Ga0075365_10002424 3300006038 Bacteria 9142
142 Ga0075365_10099313 3300006038 Bacteria 1992
143 Ga0075365_10217510 3300006038 Bacteria 1340
144 Ga0075365_10415650 3300006038 Bacteria 949
145 Ga0075368_10005147 3300006042 Bacteria 4483
146 Ga0075363_100001097 3300006048 Bacteria 9820
147 Ga0075363_100004610 3300006048 Bacteria 6053
148 Ga0075363_100017101 3300006048 Bacteria 3591
149 Ga0075363_100026483 3300006048 Bacteria 2967
150 Ga0075363_100038516 3300006048 Bacteria 2515
151 Ga0075363_100048735 3300006048 Bacteria 2254
152 Ga0075363_100050784 3300006048 Bacteria 2210
153 Ga0075363_100115244 3300006048 Bacteria 1496
154 Ga0075363_100121512 3300006048 Bacteria 1459
155 Ga0075363_100170415 3300006048 Bacteria 1236
156 Ga0075363_100181463 3300006048 Bacteria 1198
157 Ga0075363_100193310 3300006048 Bacteria 1161
158 Ga0075364_10000809 3300006051 Bacteria 16496
159 Ga0075364_10000837 3300006051 Bacteria 16210
160 Ga0075364_10002423 3300006051 Bacteria 10448
161 Ga0075364_10084884 3300006051 Bacteria 2096
162 Ga0075364_10140195 3300006051 Bacteria 1626
163 Ga0075364_10260392 3300006051 Bacteria 1179
164 Ga0070715_10016937 3300006163 Bacteria 2749
165 Ga0070716_100002748 3300006173 Bacteria 8164
166 Ga0070716_100049937 3300006173 Bacteria 2372
167 Ga0070712_100000143 3300006175 Bacteria 37372
168 Ga0070712_100006856 3300006175 Bacteria 7096
169 Ga0070712_100148727 3300006175 Bacteria 1796
170 Ga0070712_100159183 3300006175 Bacteria 1742
171 Ga0075362_10017157 3300006177 Bacteria 2979
172 Ga0075362_10042519 3300006177 Bacteria 2009
173 Ga0075362_10080354 3300006177 Bacteria 1502
174 Ga0075367_10016599 3300006178 Bacteria 4022
175 Ga0075367_10041277 3300006178 Bacteria 2697
176 Ga0075367_10044505 3300006178 Bacteria 2603
177 Ga0075367_10942009 3300006178 Bacteria 551
178 Ga0075369_10000909 3300006186 Bacteria 9815
179 Ga0075369_10001804 3300006186 Bacteria 7455
180 Ga0075369_10004773 3300006186 Bacteria 5037
181 Ga0075369_10060157 3300006186 Bacteria 1656
182 Ga0075369_10070887 3300006186 Bacteria 1534
183 Ga0075369_10072885 3300006186 Bacteria 1514
184 Ga0097621_100048057 3300006237 Bacteria 3460
185 Ga0097621_100538170 3300006237 Bacteria 1062
186 Ga0097621_101032214 3300006237 Bacteria 770
187 Ga0075370_10005666 3300006353 Bacteria 6233
188 Ga0075370_10020478 3300006353 Bacteria 3617
189 Ga0075370_10028006 3300006353 Bacteria 3130
190 Ga0075370_10034616 3300006353 Bacteria 2831
191 Ga0075370_10089790 3300006353 Bacteria 1772
192 Ga0075370_10202249 3300006353 Bacteria 1172
193 Ga0075370_10511499 3300006353 Bacteria 725
194 Ga0075431_100094097 3300006847 Bacteria 3092
195 Ga0075433_10010868 3300006852 Bacteria 7319
196 Ga0075433_10929430 3300006852 Bacteria 758
197 Ga0075434_100191225 3300006871 Bacteria 2067
198 Ga0075429_100339383 3300006880 Bacteria 1315
199 Ga0068865_100001722 3300006881 Bacteria 12837
200 Ga0068865_100080173 3300006881 Bacteria 2340
201 Ga0075436_100017966 3300006914 Bacteria 4842
202 Ga0097620_100006020 3300006931 Bacteria 12321
203 Ga0097620_100189153 3300006931 Bacteria 2143
204 Ga0075435_100570350 3300007076 Bacteria 981
205 Ga0105250_10036360 3300009092 Bacteria 1976
206 Ga0105240_10422376 3300009093 Bacteria 1497
207 Ga0105240_11185855 3300009093 Bacteria 809
208 Ga0111539_10387839 3300009094 Bacteria 1626
209 Ga0105245_10001387 3300009098 Bacteria 21932
210 Ga0105245_10505107 3300009098 Bacteria 1226
211 Ga0105245_10526750 3300009098 Bacteria 1201
212 Ga0105247_10000675 3300009101 Bacteria 26909
213 Ga0114129_10056987 3300009147 Bacteria 5470
214 Ga0105243_10006874 3300009148 Bacteria 8770
215 Ga0105243_10405887 3300009148 Bacteria 1267
216 Ga0105241_10044610 3300009174 Bacteria 3360
217 Ga0105241_10599633 3300009174 Bacteria 995
218 Ga0105242_10001007 3300009176 Bacteria 22102
219 Ga0105242_10081286 3300009176 Bacteria 2710
220 Ga0105242_10675005 3300009176 Bacteria 1008
221 Ga0105248_10011900 3300009177 Bacteria 9600
222 Ga0105237_10035678 3300009545 Bacteria 5031
223 Ga0105237_10091171 3300009545 Bacteria 3037
224 Ga0105238_11608799 3300009551 Bacteria 680
225 Ga0105249_10001549 3300009553 Bacteria 20175
226 Ga0105249_10002197 3300009553 Bacteria 16905
227 Ga0105249_10022232 3300009553 Bacteria 5680
228 Ga0105249_10097640 3300009553 Bacteria 2758
229 Ga0105239_10013238 3300010375 Bacteria 9168
230 Ga0105239_10108634 3300010375 Bacteria 3073
231 Ga0105239_10110328 3300010375 Bacteria 3050
232 Ga0105239_10867672 3300010375 Bacteria 1035
233 Ga0157342_1024934 3300012507 Bacteria 719
234 Ga0157369_10269763 3300013105 Bacteria 1773
235 Ga0157369_10324219 3300013105 Bacteria 1601
236 Ga0157374_10073757 3300013296 Bacteria 3221
237 Ga0157374_10422923 3300013296 Bacteria 1331
238 Ga0157378_10000796 3300013297 Bacteria 29352
239 Ga0157378_12278120 3300013297 Bacteria 593
240 Ga0163162_10008163 3300013306 Bacteria 10218
241 Ga0163162_10014574 3300013306 Bacteria 7683
242 Ga0163162_10191530 3300013306 Bacteria 2173
243 Ga0163162_10755632 3300013306 Bacteria 1091
244 Ga0163162_10861336 3300013306 Bacteria 1021
245 Ga0163162_11430004 3300013306 Bacteria 787
246 Ga0157372_10004408 3300013307 Bacteria 15011
247 Ga0157372_10558102 3300013307 Bacteria 1335
248 Ga0157372_11147464 3300013307 Bacteria 898
249 Ga0157375_10001335 3300013308 Bacteria 21261
250 Ga0157375_10016969 3300013308 Bacteria 6560
251 Ga0157375_10264591 3300013308 Bacteria 1881
252 Ga0163163_10014205 3300014325 Bacteria 7315
253 Ga0157380_10001464 3300014326 Bacteria 15457
254 Ga0157380_10049070 3300014326 Bacteria 3327
255 Ga0157380_11091698 3300014326 Bacteria 836
256 Ga0157377_10011518 3300014745 Bacteria 4417
257 Ga0157377_10541677 3300014745 Bacteria 821
258 Ga0157379_10010020 3300014968 Bacteria 8257
259 Ga0157379_11373147 3300014968 Bacteria 684
260 Ga0157376_10563098 3300014969 Bacteria 1129
261 Ga0157376_11614983 3300014969 Bacteria 683
262 Ga0163161_10011925 3300017792 Bacteria 6030
263 Ga0163161_10084084 3300017792 Bacteria 2346
264 Ga0163161_10199578 3300017792 Bacteria 1541
265 Ga0163161_10358909 3300017792 Bacteria 1160
266 Ga0207426_1047762 3300025302 Bacteria 1289
267 Ga0207656_10052994 3300025321 Bacteria 1759
268 Ga0207682_10206124 3300025893 Bacteria 905
269 Ga0207692_10001272 3300025898 Bacteria 9364
270 Ga0207692_10015873 3300025898 Bacteria 3322
271 Ga0207692_10345205 3300025898 Bacteria 916
272 Ga0207642_10001678 3300025899 Bacteria 6836
273 Ga0207642_10038291 3300025899 Bacteria 2074
274 Ga0207710_10047885 3300025900 Bacteria 1912
275 Ga0207688_10014871 3300025901 Bacteria 4224
276 Ga0207688_10025914 3300025901 Bacteria 3223
277 Ga0207688_10257999 3300025901 Bacteria 1057
278 Ga0207688_10359011 3300025901 Bacteria 899
279 Ga0207680_10019809 3300025903 Bacteria 3607
280 Ga0207647_10032564 3300025904 Bacteria 3347
281 Ga0207685_10021661 3300025905 Bacteria 2158
282 Ga0207699_10013202 3300025906 Bacteria 4221
283 Ga0207699_10053972 3300025906 Bacteria 2385
284 Ga0207645_10083245 3300025907 Bacteria 2052
285 Ga0207645_10292531 3300025907 Bacteria 1083
286 Ga0207654_10024853 3300025911 Bacteria 3225
287 Ga0207654_10599012 3300025911 Bacteria 786
288 Ga0207671_10009208 3300025914 Bacteria 8282
289 Ga0207671_10059301 3300025914 Bacteria 2838
290 Ga0207693_10001399 3300025915 Bacteria 21384
291 Ga0207693_10006867 3300025915 Bacteria 9398
292 Ga0207693_10088830 3300025915 Bacteria 2422
293 Ga0207693_10240563 3300025915 Bacteria 1421
294 Ga0207693_10275311 3300025915 Bacteria 1319
295 Ga0207663_10001784 3300025916 Bacteria 10143
296 Ga0207663_10012188 3300025916 Bacteria 4640
297 Ga0207663_10616873 3300025916 Bacteria 854
298 Ga0207662_10014298 3300025918 Bacteria 4451
299 Ga0207657_10277634 3300025919 Bacteria 1331
300 Ga0207681_10015235 3300025923 Bacteria 4794
301 Ga0207681_10519367 3300025923 Bacteria 977
302 Ga0207650_10279354 3300025925 Bacteria 1359
303 Ga0207650_10903636 3300025925 Bacteria 750
304 Ga0207659_10430622 3300025926 Bacteria 1108
305 Ga0207687_10006779 3300025927 Bacteria 7548
306 Ga0207687_10431344 3300025927 Bacteria 1090
307 Ga0207700_10078454 3300025928 Bacteria 2569
308 Ga0207700_10366312 3300025928 Bacteria 1257
309 Ga0207664_10040636 3300025929 Bacteria 3619
310 Ga0207664_10220718 3300025929 Bacteria 1644
311 Ga0207644_10007368 3300025931 Bacteria 7166
312 Ga0207644_10029629 3300025931 Bacteria 3799
313 Ga0207644_10109347 3300025931 Bacteria 2088
314 Ga0207644_10393927 3300025931 Bacteria 1131
315 Ga0207690_10032205 3300025932 Bacteria 3361
316 Ga0207690_10716557 3300025932 Bacteria 823
317 Ga0207706_10019751 3300025933 Bacteria 6060
318 Ga0207706_10041247 3300025933 Bacteria 4092
319 Ga0207706_10057048 3300025933 Bacteria 3441
320 Ga0207706_10064649 3300025933 Bacteria 3221
321 Ga0207686_10009104 3300025934 Bacteria 5381
322 Ga0207686_10201869 3300025934 Bacteria 1424
323 Ga0207686_10740379 3300025934 Bacteria 784
324 Ga0207709_10006750 3300025935 Bacteria 6426
325 Ga0207709_11169588 3300025935 Bacteria 633
326 Ga0207670_10020687 3300025936 Bacteria 4048
327 Ga0207669_10000986 3300025937 Bacteria 12096
328 Ga0207669_10111120 3300025937 Bacteria 1837
329 Ga0207704_10000241 3300025938 Bacteria 27067
330 Ga0207704_11298072 3300025938 Bacteria 622
331 Ga0207665_10004221 3300025939 Bacteria 9560
332 Ga0207665_10088662 3300025939 Bacteria 2141
333 Ga0207665_10977986 3300025939 Bacteria 673
334 Ga0207691_10136962 3300025940 Bacteria 2159
335 Ga0207711_10050965 3300025941 Bacteria 3544
336 Ga0207689_10017852 3300025942 Bacteria 5994
337 Ga0207661_10101447 3300025944 Bacteria 2418
338 Ga0207679_10150779 3300025945 Bacteria 1892
339 Ga0207667_10033458 3300025949 Bacteria 5526
340 Ga0207667_10432159 3300025949 Bacteria 1339
341 Ga0207651_10866869 3300025960 Bacteria 803
342 Ga0207712_10008084 3300025961 Bacteria 6654
343 Ga0207712_10017479 3300025961 Bacteria 4659
344 Ga0207712_10175919 3300025961 Bacteria 1677
345 Ga0207712_10779294 3300025961 Bacteria 839
346 Ga0207668_10005335 3300025972 Bacteria 7561
347 Ga0207668_10007199 3300025972 Bacteria 6608
348 Ga0207668_10123670 3300025972 Bacteria 1963
349 Ga0207668_10301210 3300025972 Bacteria 1323
350 Ga0207668_11163870 3300025972 Bacteria 692
351 Ga0207640_10016268 3300025981 Bacteria 4324
352 Ga0207640_10026852 3300025981 Bacteria 3501
353 Ga0207640_10310396 3300025981 Bacteria 1252
354 Ga0207658_10013971 3300025986 Bacteria 5495
355 Ga0207658_10031238 3300025986 Bacteria 3780
356 Ga0207658_10062185 3300025986 Bacteria 2793
357 Ga0207677_10005272 3300026023 Bacteria 7002
358 Ga0207677_10026040 3300026023 Bacteria 3661
359 Ga0207703_10007979 3300026035 Bacteria 8367
360 Ga0207703_10664986 3300026035 Bacteria 989
361 Ga0207639_10023330 3300026041 Bacteria 4467
362 Ga0207639_10252386 3300026041 Bacteria 1539
363 Ga0207639_10516501 3300026041 Bacteria 1093
364 Ga0207678_10020123 3300026067 Bacteria 5861
365 Ga0207678_10118566 3300026067 Bacteria 2258
366 Ga0207678_10150805 3300026067 Bacteria 1985
367 Ga0207678_10306408 3300026067 Bacteria 1365
368 Ga0207708_10021604 3300026075 Bacteria 4855
369 Ga0207708_10130945 3300026075 Bacteria 1961
370 Ga0207708_10155264 3300026075 Bacteria 1804
371 Ga0207641_10016291 3300026088 Bacteria 6087
372 Ga0207648_10000503 3300026089 Bacteria 43631
373 Ga0207648_10563013 3300026089 Bacteria 1048
374 Ga0207676_10154760 3300026095 Bacteria 1979
375 Ga0207676_11264105 3300026095 Bacteria 732
376 Ga0207675_100001926 3300026118 Bacteria 20704
377 Ga0207675_102109009 3300026118 Bacteria 580
378 Ga0207683_10001009 3300026121 Bacteria 25708
379 Ga0207683_10006741 3300026121 Bacteria 9827
380 Ga0207683_10114566 3300026121 Bacteria 2416
381 Ga0207683_10196362 3300026121 Bacteria 1833
382 Ga0207698_10038094 3300026142 Bacteria 3549
383 Ga0207698_10046037 3300026142 Bacteria 3291
384 Ga0207698_10100583 3300026142 Bacteria 2395
385 Ga0207698_11805681 3300026142 Bacteria 627
386 Ga0209813_10154520 3300027866 Bacteria 824
387 Ga0207428_10174166 3300027907 Bacteria 1628
388 Ga0207428_10352694 3300027907 Bacteria 1082
389 Ga0268266_10007333 3300028379 Bacteria 9965
390 Ga0268266_10059386 3300028379 Bacteria 3295
391 Ga0268266_10087367 3300028379 Bacteria 2728
392 Ga0268266_10148030 3300028379 Bacteria 2113
393 Ga0268266_10427477 3300028379 Bacteria 1256
394 Ga0268266_10908200 3300028379 Bacteria 852
395 Ga0268265_10052876 3300028380 Bacteria 3074
396 Ga0268265_10431573 3300028380 Bacteria 1226
397 Ga0268265_12318721 3300028380 Bacteria 543
398 Ga0268264_10018665 3300028381 Bacteria 5670
399 Ga0268264_10029320 3300028381 Bacteria 4505
400 Ga0268264_10176109 3300028381 Bacteria 1939
401 Ga0268264_11680735 3300028381 Bacteria 645
402 Ga0307508_10044987 3300031616 Bacteria 3945
403 Ga0307410_10176317 3300031852 Bacteria 1615
404 Ga0307415_100194679 3300032126 Bacteria 1603
405 Ga0307507_10050355 3300033179 Bacteria 4021
406 Ga0373948_0038708 3300034817 Bacteria 990
407 Ga0373928_0029673 3300035084 Bacteria 1204
408 Ga0373952_0054019 3300035092 Bacteria 965
409 Ga0373932_0020828 3300035112 Bacteria 1724
410 Ga0373931_0035618 3300035691 Bacteria 2589
411 Ga0373931_0308136 3300035691 Bacteria 980
412 Ga0439461_0003754 3300041410 Bacteria 2510
413 Ga0439466_0003759 3300041411 Bacteria 5858
414 Ga0439466_0016558 3300041411 Bacteria 2663
415 Ga0439465_0002458 3300041413 Bacteria 6054
416 Ga0439465_0002583 3300041413 Bacteria 5899
417 Ga0439431_0008448 3300041997 Bacteria 2315
418 Ga0439442_048670 3300042002 Bacteria 893
419 Ga0439445_0004975 3300042004 Bacteria 3019
420 Ga0439434_0003782 3300042435 Bacteria 4424
421 Ga0439459_0058290 3300042438 Bacteria 866
422 Ga0466972_0019898 3300044658 Bacteria 3355
423 Ga0466972_0021928 3300044658 Bacteria 3182
424 Ga0466972_0024217 3300044658 Bacteria 3013
425 Ga0466972_0058179 3300044658 Bacteria 1856
426 Ga0466972_0104774 3300044658 Bacteria 1338
427 Ga0466965_0016718 3300044683 Bacteria 3497
428 Ga0466965_0326759 3300044683 Bacteria 836
429 Ga0466966_0041461 3300044684 Bacteria 2958
430 Ga0466961_0240260 3300044693 Bacteria 1113
431 Ga0466963_0355867 3300044694 Bacteria 1031
432 Ga0466971_0114106 3300044719 Bacteria 1248
433 Ga0466968_0043499 3300044735 Bacteria 1902
434 Ga0466970_0085566 3300044765 Bacteria 1708
435 Ga0466970_0283206 3300044765 Bacteria 932
436 Ga0466970_0328561 3300044765 Bacteria 865
437 Ga0466957_0028100 3300044842 Bacteria 3348
438 Ga0466957_0047587 3300044842 Bacteria 2606
439 Ga0466960_0000012 3300044901 Bacteria 60091
440 Ga0466960_0351413 3300044901 Bacteria 841
441 Ga0466959_0039497 3300045049 Bacteria 3487
442 Ga0466958_0024857 3300045836 Bacteria 3527
443 Ga0466958_0367394 3300045836 Bacteria 927
444 Ga0466967_0019104 3300045976 Bacteria 5502
445 Ga0466967_0021463 3300045976 Bacteria 5247
446 Ga0466967_0305210 3300045976 Bacteria 1532
447 Ga0466967_0336081 3300045976 Bacteria 1460
448 Ga0495603_0073612 3300046455 Bacteria 2007
449 Ga0495629_0030618 3300046459 Bacteria 3815
450 Ga0495653_0740007 3300046463 Bacteria 595
451 Ga0495582_0087102 3300046473 Bacteria 1738
452 Ga0495639_0248543 3300046475 Bacteria 879
453 Ga0495662_0088451 3300046476 Bacteria 1509
454 Ga0495608_0237610 3300046511 Bacteria 1139
455 Ga0495630_0069117 3300046517 Bacteria 2657
456 Ga0495648_0005433 3300046524 Bacteria 10586
457 Ga0495654_0269540 3300046530 Bacteria 703
458 Ga0495668_0032383 3300046616 Bacteria 2942
459 Ga0495611_0153877 3300046648 Bacteria 1074
460 Ga0495658_0009159 3300046683 Bacteria 4922
461 Ga0495624_0210460 3300046690 Bacteria 1180
462 Ga0495649_0481724 3300046694 Bacteria 618
463 Ga0495674_0138105 3300047319 Bacteria 2050
464 Ga0495673_0006877 3300047469 Bacteria 6629
465 Ga0495593_0054520 3300047673 Bacteria 2107
466 Ga0496100_0002462 3300048903 Bacteria 9404
467 Ga0496100_0017524 3300048903 Bacteria 4230
468 Ga0496100_0022545 3300048903 Bacteria 3811
469 Ga0496100_0338014 3300048903 Bacteria 1135
470 Ga0496100_0384500 3300048903 Bacteria 1066
471 Ga0496101_0000113 3300048904 Bacteria 81197
472 Ga0496101_0004983 3300048904 Bacteria 8430
473 Ga0496101_0082986 3300048904 Bacteria 2372
474 Ga0496101_0234517 3300048904 Bacteria 1427
475 Ga0496101_0239812 3300048904 Bacteria 1411
476 Ga0496102_0000035 3300048905 Bacteria 213557
477 Ga0496102_0021160 3300048905 Bacteria 5751
478 Ga0496102_0033013 3300048905 Bacteria 4650
479 Ga0496102_0050987 3300048905 Bacteria 3770
480 Ga0496102_0056685 3300048905 Bacteria 3575
481 Ga0496102_0068986 3300048905 Bacteria 3245
482 Ga0496102_0126715 3300048905 Bacteria 2387
483 Ga0496102_0182685 3300048905 Bacteria 1976
484 Ga0496102_0559963 3300048905 Bacteria 1066
485 Ga0496102_0725034 3300048905 Bacteria 917
486 Ga0496103_0000028 3300048906 Bacteria 213660
487 Ga0496103_0014933 3300048906 Bacteria 4616
488 Ga0496103_0030783 3300048906 Bacteria 3267
489 Ga0496103_0112235 3300048906 Bacteria 1732
490 Ga0496103_0287524 3300048906 Bacteria 1057
491 Ga0496103_0945331 3300048906 Bacteria 539
492 Ga0496104_0080314 3300048907 Bacteria 3109
493 Ga0496104_0248355 3300048907 Bacteria 1692
494 Ga0496104_0274277 3300048907 Bacteria 1599
495 Ga0496104_0376420 3300048907 Bacteria 1332
496 Ga0496105_0560352 3300048908 Bacteria 891
497 Ga0496105_0689056 3300048908 Bacteria 785
498 Ga0496106_0009329 3300048909 Bacteria 7254
499 Ga0496106_0021253 3300048909 Bacteria 4818
500 Ga0496106_0037207 3300048909 Bacteria 3640
501 Ga0496106_0089010 3300048909 Bacteria 2380
502 Ga0496106_0362298 3300048909 Bacteria 1165
503 Ga0496107_0012159 3300048910 Bacteria 6004
504 Ga0496107_0067043 3300048910 Bacteria 2603
505 Ga0496107_0114422 3300048910 Bacteria 1985
506 Ga0496107_0220241 3300048910 Bacteria 1412
507 Ga0496107_0322561 3300048910 Bacteria 1149
508 Ga0496107_0361549 3300048910 Bacteria 1080
509 Ga0496108_0000268 3300048911 Bacteria 44819
510 Ga0496108_0021871 3300048911 Bacteria 5258
511 Ga0496108_0074329 3300048911 Bacteria 2869
512 Ga0496108_0213548 3300048911 Bacteria 1675
513 Ga0496108_0697311 3300048911 Bacteria 881
514 Ga0496109_0375043 3300048912 Bacteria 1344
515 Ga0496109_0418715 3300048912 Bacteria 1265
516 Ga0496109_0542550 3300048912 Bacteria 1097
517 Ga0496110_0017855 3300048913 Bacteria 5939
518 Ga0496110_0032549 3300048913 Bacteria 4504
519 Ga0496110_0085057 3300048913 Bacteria 2824
520 Ga0496110_0595379 3300048913 Bacteria 1003
521 Ga0496111_0210740 3300048914 Bacteria 1443
522 Ga0496111_0266524 3300048914 Bacteria 1271
523 Ga0496111_0418877 3300048914 Bacteria 989
524 Ga0496111_0518880 3300048914 Bacteria 876
525 Ga0496112_0006545 3300048915 Bacteria 10249
526 Ga0496112_0021400 3300048915 Bacteria 6150
527 Ga0496112_0123693 3300048915 Bacteria 2558
528 Ga0496112_0132137 3300048915 Bacteria 2467
529 Ga0496112_0163661 3300048915 Bacteria 2191
530 Ga0496112_0349241 3300048915 Bacteria 1422
531 Ga0496112_0357239 3300048915 Bacteria 1403
532 Ga0496112_0915758 3300048915 Bacteria 798
533 Ga0496113_0234316 3300048916 Bacteria 1464
534 Ga0496113_0243439 3300048916 Bacteria 1435
535 Ga0496114_0026747 3300048917 Bacteria 4725
536 Ga0496114_0249417 3300048917 Bacteria 1562
537 Ga0496114_1028086 3300048917 Bacteria 708
538 Ga0496115_0004819 3300048918 Bacteria 9791
539 Ga0496115_0140271 3300048918 Bacteria 1994
540 Ga0496116_0000090 3300048919 Bacteria 212651
541 Ga0496117_0000051 3300048920 Bacteria 285716
542 Ga0496117_0110784 3300048920 Bacteria 1710
543 Ga0496118_0000043 3300048921 Bacteria 285716
544 Ga0496118_0003906 3300048921 Bacteria 18249
545 Ga0496119_0114133 3300048922 Bacteria 1495
546 Ga0496119_0210161 3300048922 Bacteria 1001
547 Ga0496120_0031229 3300048923 Bacteria 3228
548 Ga0496121_0000080 3300048924 Bacteria 230195
549 Ga0496126_0006262 3300048929 Bacteria 13293
550 Ga0501033_0157703 3300049570 Bacteria 1635
551 Ga0501034_0103348 3300049571 Bacteria 2842
552 Ga0501047_0445874 3300049581 Bacteria 1124
553 Ga0501070_0299220 3300049586 Bacteria 1311
554 Ga0501070_0393988 3300049586 Bacteria 1121
555 Ga0501080_0279740 3300049742 Bacteria 1517
556 Ga0501080_0768809 3300049742 Bacteria 846
557 Ga0501083_0167114 3300049744 Bacteria 1438
558 Ga0501083_0749627 3300049744 Bacteria 635
559 Ga0501035_0354965 3300049822 Bacteria 1226
560 Ga0501044_0219826 3300049823 Bacteria 1851
561 nmdc:mga03683_69581_c1 3300050489 Bacteria 1502
562 nmdc:mga03n38_110440_c1 3300050490 Bacteria 1338
563 nmdc:mga03n38_13156_c1 3300050490 Bacteria 3134
564 nmdc:mga03n38_1776_c1 3300050490 Bacteria 6395
565 nmdc:mga03n38_256992_c1 3300050490 Bacteria 925
566 nmdc:mga03n38_31014_c1 3300050490 Bacteria 2252
567 nmdc:mga03n38_331148_c1 3300050490 Bacteria 824
568 nmdc:mga03n38_415558_c1 3300050490 Bacteria 743
569 nmdc:mga03n38_46010_c1 3300050490 Bacteria 1924
570 nmdc:mga03n38_630_c1 3300050490 Bacteria 9040
571 nmdc:mga03n38_67298_c1 3300050490 Bacteria 1648
572 nmdc:mga03n38_72504_c1 3300050490 Bacteria 1597
573 nmdc:mga03n38_8887_c1 3300050490 Bacteria 3627
574 nmdc:mga00v17_138142_c1 3300050491 Bacteria 1561
575 nmdc:mga00v17_160778_c1 3300050491 Bacteria 1446
576 nmdc:mga00v17_3002_c1 3300050491 Bacteria 8675
577 nmdc:mga00v17_444346_c1 3300050491 Bacteria 842
578 nmdc:mga00v17_45011_c1 3300050491 Bacteria 2081
579 nmdc:mga00v17_4805_c1 3300050491 Bacteria 7073
580 nmdc:mga00v17_64695_c1 3300050491 Bacteria 2254
581 nmdc:mga00v17_7961_c1 3300050491 Bacteria 5681
582 nmdc:mga0yw44_203549_c1 3300050492 Bacteria 1308
583 nmdc:mga0yw44_204992_c1 3300050492 Bacteria 1303
584 nmdc:mga0yw44_236148_c1 3300050492 Bacteria 1214
585 nmdc:mga0yw44_73807_c1 3300050492 Bacteria 2123
586 nmdc:mga0yw44_79236_c1 3300050492 Bacteria 2055
587 nmdc:mga06z11_14242_c1 3300050494 Bacteria 3518
588 nmdc:mga06z11_27870_c1 3300050494 Bacteria 2704
589 nmdc:mga06z11_614244_c1 3300050494 Bacteria 661
590 nmdc:mga06z11_94152_c1 3300050494 Bacteria 1632
591 nmdc:mga07m45_349996_c1 3300050496 Bacteria 858
592 nmdc:mga07m45_55175_c1 3300050496 Bacteria 2246
593 nmdc:mga07m45_69084_c1 3300050496 Bacteria 2008
594 nmdc:mga07m45_86176_c1 3300050496 Bacteria 1797
595 nmdc:mga05p37_87429_c1 3300050507 Bacteria 3841
596 nmdc:mga09592_329456_c1 3300050508 Bacteria 1322
597 nmdc:mga06r32_39354_c1 3300050510 Bacteria 4485
598 nmdc:mga0n895_8792_c1 3300050512 Bacteria 8785
599 nmdc:mga0rr50_7232_c1 3300050513 Bacteria 6826
600 nmdc:mga08x19_14986_c1 3300050514 Bacteria 4707
601 nmdc:mga0a205_15572_c1 3300050515 Bacteria 7107
602 nmdc:mga0sz30_189121_c1 3300050516 Bacteria 914
603 nmdc:mga0sz30_25662_c1 3300050516 Bacteria 2410
604 nmdc:mga0sz30_34686_c1 3300050516 Bacteria 2102
605 nmdc:mga0sz30_36050_c2 3300050516 Bacteria 1746
606 nmdc:mga0sz30_3867_c1 3300050516 Bacteria 5397
607 nmdc:mga0sz30_3956_c1 3300050516 Bacteria 5342
608 Ga0500641_0188050 3300053096 Bacteria 885
609 Ga0500652_001636 3300053131 Bacteria 6813
610 Ga0500616_0037361 3300053153 Bacteria 2630
611 Ga0466962_0047156 3300061719 Bacteria 2059
612 2729908717 2728369276 Bacteria 5610032
613 2793982131 2791355406 Bacteria 11364898
614 2795792041 2795385472 Bacteria 6627535
615 2842140391 2842134933 Bacteria 5847019
616 8047894370 8047893842 Bacteria 11723082
617 8048364682 8048356638 Bacteria 11044339
618 8048380188 8048379754 Bacteria 11877923
619 Ga0070663_100108654
620 JGI24746J21847_1001214
621 JGI24737J22298_10009598
622 JGI24743J22301_10032915
623 JGI24750J21931_1006543
624 JGI24745J21846_1001416
625 JGI24738J21930_10007022
626 JGI24744J21845_10000298
627 JGI24034J26672_10000901
628 JGI24742J22300_10001104
629 JGI24751J29686_10030174
630 Ga0070676_10002844
631 Ga0070683_100136261
632 Ga0070683_100239435
633 Ga0070690_100027305
634 Ga0070670_100071587
635 Ga0068869_100040221
636 Ga0070666_10019831
637 Ga0070682_100031437
638 Ga0070682_100065580
639 Ga0070682_100118676
640 Ga0070682_100367877
641 Ga0070682_100584807
642 Ga0068868_100001869
643 Ga0068868_100070578
644 Ga0068868_100234528
645 Ga0070660_100375737
646 Ga0070689_100031298
647 Ga0070691_10000393
648 Ga0070687_100028048
649 Ga0070692_10178933
650 Ga0070692_10571023
651 Ga0070668_100001504
652 Ga0070668_100008649
653 Ga0070668_100096087
654 Ga0070668_100396293
655 Ga0070668_100551074
656 Ga0070668_101032636
657 Ga0070669_100007786
658 Ga0070669_100772538
659 Ga0070675_100238424
660 Ga0070671_100010560
661 Ga0070671_100033434
662 Ga0070671_100045650
663 Ga0070671_101718909
664 Ga0070674_100005402
665 Ga0070674_100078782
666 Ga0070673_100264297
667 Ga0070688_100017443
668 Ga0070688_100054006
669 Ga0070688_100162065
670 Ga0070688_100443498
671 Ga0070659_100049021
672 Ga0070659_100428222
673 Ga0070659_100485993
674 Ga0070667_100000768
675 Ga0070667_100019646
676 Ga0070667_100587167
677 Ga0070703_10021166
678 Ga0070709_10046446
679 Ga0070709_10068271
680 Ga0070709_10219526
681 Ga0070713_100040921
682 Ga0070713_100420506
683 Ga0070710_10002246
684 Ga0070710_10016812
685 Ga0070701_10000956
686 Ga0070701_10235844
687 Ga0070711_100000419
688 Ga0070711_100162236
689 Ga0070711_100447489
690 Ga0070705_100016354
691 Ga0070700_100002346
692 Ga0070700_100037952
693 Ga0070700_100293383
694 Ga0070694_100125560
695 Ga0070663_100052810
696 Ga0070663_100077338
697 Ga0070663_100103531
698 Ga0070678_100016383
699 Ga0070678_100057370
700 Ga0070678_100074909
701 Ga0070678_100131182
702 Ga0070678_100786365
703 Ga0070662_100044555
704 Ga0070662_101440409
705 Ga0068867_100000571
706 Ga0070685_10424591
707 Ga0070684_100444630
708 Ga0068853_100044114
709 Ga0068853_100173701
710 Ga0068853_100693699
711 Ga0070695_100002476
712 Ga0070696_100119303
713 Ga0070696_100281717
714 Ga0070696_100713675
715 Ga0070693_100735174
716 Ga0070665_100031675
717 Ga0070665_100060040
718 Ga0070665_100128395
719 Ga0070665_100224564
720 Ga0070665_100424712
721 Ga0070704_100000452
722 Ga0070704_100184799
723 Ga0070704_100515903
724 Ga0068855_100098252
725 Ga0068854_100001292
726 Ga0068854_100149008
727 Ga0070702_100033385
728 Ga0070702_100036872
729 Ga0070702_100137908
730 Ga0068852_100052566
731 Ga0068852_100059885
732 Ga0068852_100076819
733 Ga0068852_101847384
734 Ga0068859_100006020
735 Ga0068859_100189164
736 Ga0068864_100582410
737 Ga0068864_101166672
738 Ga0068866_10000247
739 Ga0068866_10133369
740 Ga0068866_10921299
741 Ga0068861_100000589
742 Ga0068861_100232674
743 Ga0068870_10329536
744 Ga0068863_100002906
745 Ga0068863_100120419
746 Ga0068858_100008281
747 Ga0068858_100017798
748 Ga0068858_100518409
749 Ga0068860_100006280
750 Ga0068860_100100699
751 Ga0068860_100129372
752 Ga0068862_100034022
753 Ga0068862_100116012
754 Ga0068862_101057789
755 Ga0068862_101574323
756 Ga0081455_10024191
757 Ga0081540_1037336
758 Ga0075365_10001410
759 Ga0075365_10002424
760 Ga0075365_10099313
761 Ga0075365_10217510
762 Ga0075365_10415650
763 Ga0075368_10005147
764 Ga0075363_100001097
765 Ga0075363_100004610
766 Ga0075363_100017101
767 Ga0075363_100026483
768 Ga0075363_100038516
769 Ga0075363_100048735
770 Ga0075363_100050784
771 Ga0075363_100115244
772 Ga0075363_100121512
773 Ga0075363_100170415
774 Ga0075363_100181463
775 Ga0075363_100193310
776 Ga0075364_10000809
777 Ga0075364_10000837
778 Ga0075364_10002423
779 Ga0075364_10084884
780 Ga0075364_10140195
781 Ga0075364_10260392
782 Ga0070715_10016937
783 Ga0070716_100002748
784 Ga0070716_100049937
785 Ga0070712_100000143
786 Ga0070712_100006856
787 Ga0070712_100148727
788 Ga0070712_100159183
789 Ga0075362_10017157
790 Ga0075362_10042519
791 Ga0075362_10080354
792 Ga0075367_10016599
793 Ga0075367_10041277
794 Ga0075367_10044505
795 Ga0075367_10942009
796 Ga0075369_10000909
797 Ga0075369_10001804
798 Ga0075369_10004773
799 Ga0075369_10060157
800 Ga0075369_10070887
801 Ga0075369_10072885
802 Ga0097621_100048057
803 Ga0097621_100538170
804 Ga0097621_101032214
805 Ga0075370_10005666
806 Ga0075370_10020478
807 Ga0075370_10028006
808 Ga0075370_10034616
809 Ga0075370_10089790
810 Ga0075370_10202249
811 Ga0075370_10511499
812 Ga0075431_100094097
813 Ga0075433_10010868
814 Ga0075433_10929430
815 Ga0075434_100191225
816 Ga0075429_100339383
817 Ga0068865_100001722
818 Ga0068865_100080173
819 Ga0075436_100017966
820 Ga0097620_100006020
821 Ga0097620_100189153
822 Ga0075435_100570350
823 Ga0105250_10036360
824 Ga0105240_10422376
825 Ga0105240_11185855
826 Ga0111539_10387839
827 Ga0105245_10001387
828 Ga0105245_10505107
829 Ga0105245_10526750
830 Ga0105247_10000675
831 Ga0114129_10056987
832 Ga0105243_10006874
833 Ga0105243_10405887
834 Ga0105241_10044610
835 Ga0105241_10599633
836 Ga0105242_10001007
837 Ga0105242_10081286
838 Ga0105242_10675005
839 Ga0105248_10011900
840 Ga0105237_10035678
841 Ga0105237_10091171
842 Ga0105238_11608799
843 Ga0105249_10001549
844 Ga0105249_10002197
845 Ga0105249_10022232
846 Ga0105249_10097640
847 Ga0105239_10013238
848 Ga0105239_10108634
849 Ga0105239_10110328
850 Ga0105239_10867672
851 Ga0157342_1024934
852 Ga0157369_10269763
853 Ga0157369_10324219
854 Ga0157374_10073757
855 Ga0157374_10422923
856 Ga0157378_10000796
857 Ga0157378_12278120
858 Ga0163162_10008163
859 Ga0163162_10014574
860 Ga0163162_10191530
861 Ga0163162_10755632
862 Ga0163162_10861336
863 Ga0163162_11430004
864 Ga0157372_10004408
865 Ga0157372_10558102
866 Ga0157372_11147464
867 Ga0157375_10001335
868 Ga0157375_10016969
869 Ga0157375_10264591
870 Ga0163163_10014205
871 Ga0157380_10001464
872 Ga0157380_10049070
873 Ga0157380_11091698
874 Ga0157377_10011518
875 Ga0157377_10541677
876 Ga0157379_10010020
877 Ga0157379_11373147
878 Ga0157376_10563098
879 Ga0157376_11614983
880 Ga0163161_10011925
881 Ga0163161_10084084
882 Ga0163161_10199578
883 Ga0163161_10358909
884 Ga0207426_1047762
885 Ga0207656_10052994
886 Ga0207682_10206124
887 Ga0207692_10001272
888 Ga0207692_10015873
889 Ga0207692_10345205
890 Ga0207642_10001678
891 Ga0207642_10038291
892 Ga0207710_10047885
893 Ga0207688_10014871
894 Ga0207688_10025914
895 Ga0207688_10257999
896 Ga0207688_10359011
897 Ga0207680_10019809
898 Ga0207647_10032564
899 Ga0207685_10021661
900 Ga0207699_10013202
901 Ga0207699_10053972
902 Ga0207645_10083245
903 Ga0207645_10292531
904 Ga0207654_10024853
905 Ga0207654_10599012
906 Ga0207671_10009208
907 Ga0207671_10059301
908 Ga0207693_10001399
909 Ga0207693_10006867
910 Ga0207693_10088830
911 Ga0207693_10240563
912 Ga0207693_10275311
913 Ga0207663_10001784
914 Ga0207663_10012188
915 Ga0207663_10616873
916 Ga0207662_10014298
917 Ga0207657_10277634
918 Ga0207681_10015235
919 Ga0207681_10519367
920 Ga0207650_10279354
921 Ga0207650_10903636
922 Ga0207659_10430622
923 Ga0207687_10006779
924 Ga0207687_10431344
925 Ga0207700_10078454
926 Ga0207700_10366312
927 Ga0207664_10040636
928 Ga0207664_10220718
929 Ga0207644_10007368
930 Ga0207644_10029629
931 Ga0207644_10109347
932 Ga0207644_10393927
933 Ga0207690_10032205
934 Ga0207690_10716557
935 Ga0207706_10019751
936 Ga0207706_10041247
937 Ga0207706_10057048
938 Ga0207706_10064649
939 Ga0207686_10009104
940 Ga0207686_10201869
941 Ga0207686_10740379
942 Ga0207709_10006750
943 Ga0207709_11169588
944 Ga0207670_10020687
945 Ga0207669_10000986
946 Ga0207669_10111120
947 Ga0207704_10000241
948 Ga0207704_11298072
949 Ga0207665_10004221
950 Ga0207665_10088662
951 Ga0207665_10977986
952 Ga0207691_10136962
953 Ga0207711_10050965
954 Ga0207689_10017852
955 Ga0207661_10101447
956 Ga0207679_10150779
957 Ga0207667_10033458
958 Ga0207667_10432159
959 Ga0207651_10866869
960 Ga0207712_10008084
961 Ga0207712_10017479
962 Ga0207712_10175919
963 Ga0207712_10779294
964 Ga0207668_10005335
965 Ga0207668_10007199
966 Ga0207668_10123670
967 Ga0207668_10301210
968 Ga0207668_11163870
969 Ga0207640_10016268
970 Ga0207640_10026852
971 Ga0207640_10310396
972 Ga0207658_10013971
973 Ga0207658_10031238
974 Ga0207658_10062185
975 Ga0207677_10005272
976 Ga0207677_10026040
977 Ga0207703_10007979
978 Ga0207703_10664986
979 Ga0207639_10023330
980 Ga0207639_10252386
981 Ga0207639_10516501
982 Ga0207678_10020123
983 Ga0207678_10118566
984 Ga0207678_10150805
985 Ga0207678_10306408
986 Ga0207708_10021604
987 Ga0207708_10130945
988 Ga0207708_10155264
989 Ga0207641_10016291
990 Ga0207648_10000503
991 Ga0207648_10563013
992 Ga0207676_10154760
993 Ga0207676_11264105
994 Ga0207675_100001926
995 Ga0207675_102109009
996 Ga0207683_10001009
997 Ga0207683_10006741
998 Ga0207683_10114566
999 Ga0207683_10196362
1000 Ga0207698_10038094
1001 Ga0207698_10046037
1002 Ga0207698_10100583
1003 Ga0207698_11805681
1004 Ga0209813_10154520
1005 Ga0207428_10174166
1006 Ga0207428_10352694
1007 Ga0268266_10007333
1008 Ga0268266_10059386
1009 Ga0268266_10087367
1010 Ga0268266_10148030
1011 Ga0268266_10427477
1012 Ga0268266_10908200
1013 Ga0268265_10052876
1014 Ga0268265_10431573
1015 Ga0268265_12318721
1016 Ga0268264_10018665
1017 Ga0268264_10029320
1018 Ga0268264_10176109
1019 Ga0268264_11680735
1020 Ga0307508_10044987
1021 Ga0307410_10176317
1022 Ga0307415_100194679
1023 Ga0307507_10050355
1024 Ga0373948_0038708
1025 Ga0373928_0029673
1026 Ga0373952_0054019
1027 Ga0373932_0020828
1028 Ga0373931_0035618
1029 Ga0373931_0308136
1030 Ga0439461_0003754
1031 Ga0439466_0003759
1032 Ga0439466_0016558
1033 Ga0439465_0002458
1034 Ga0439465_0002583
1035 Ga0439431_0008448
1036 Ga0439442_048670
1037 Ga0439445_0004975
1038 Ga0439434_0003782
1039 Ga0439459_0058290
1040 Ga0466972_0019898
1041 Ga0466972_0021928
1042 Ga0466972_0024217
1043 Ga0466972_0058179
1044 Ga0466972_0104774
1045 Ga0466965_0016718
1046 Ga0466965_0326759
1047 Ga0466966_0041461
1048 Ga0466961_0240260
1049 Ga0466963_0355867
1050 Ga0466971_0114106
1051 Ga0466968_0043499
1052 Ga0466970_0085566
1053 Ga0466970_0283206
1054 Ga0466970_0328561
1055 Ga0466957_0028100
1056 Ga0466957_0047587
1057 Ga0466960_0000012
1058 Ga0466960_0351413
1059 Ga0466959_0039497
1060 Ga0466958_0024857
1061 Ga0466958_0367394
1062 Ga0466967_0019104
1063 Ga0466967_0021463
1064 Ga0466967_0305210
1065 Ga0466967_0336081
1066 Ga0495603_0073612
1067 Ga0495629_0030618
1068 Ga0495653_0740007
1069 Ga0495582_0087102
1070 Ga0495639_0248543
1071 Ga0495662_0088451
1072 Ga0495608_0237610
1073 Ga0495630_0069117
1074 Ga0495648_0005433
1075 Ga0495654_0269540
1076 Ga0495668_0032383
1077 Ga0495611_0153877
1078 Ga0495658_0009159
1079 Ga0495624_0210460
1080 Ga0495649_0481724
1081 Ga0495674_0138105
1082 Ga0495673_0006877
1083 Ga0495593_0054520
1084 Ga0496100_0002462
1085 Ga0496100_0017524
1086 Ga0496100_0022545
1087 Ga0496100_0338014
1088 Ga0496100_0384500
1089 Ga0496101_0000113
1090 Ga0496101_0004983
1091 Ga0496101_0082986
1092 Ga0496101_0234517
1093 Ga0496101_0239812
1094 Ga0496102_0000035
1095 Ga0496102_0021160
1096 Ga0496102_0033013
1097 Ga0496102_0050987
1098 Ga0496102_0056685
1099 Ga0496102_0068986
1100 Ga0496102_0126715
1101 Ga0496102_0182685
1102 Ga0496102_0559963
1103 Ga0496102_0725034
1104 Ga0496103_0000028
1105 Ga0496103_0014933
1106 Ga0496103_0030783
1107 Ga0496103_0112235
1108 Ga0496103_0287524
1109 Ga0496103_0945331
1110 Ga0496104_0080314
1111 Ga0496104_0248355
1112 Ga0496104_0274277
1113 Ga0496104_0376420
1114 Ga0496105_0560352
1115 Ga0496105_0689056
1116 Ga0496106_0009329
1117 Ga0496106_0021253
1118 Ga0496106_0037207
1119 Ga0496106_0089010
1120 Ga0496106_0362298
1121 Ga0496107_0012159
1122 Ga0496107_0067043
1123 Ga0496107_0114422
1124 Ga0496107_0220241
1125 Ga0496107_0322561
1126 Ga0496107_0361549
1127 Ga0496108_0000268
1128 Ga0496108_0021871
1129 Ga0496108_0074329
1130 Ga0496108_0213548
1131 Ga0496108_0697311
1132 Ga0496109_0375043
1133 Ga0496109_0418715
1134 Ga0496109_0542550
1135 Ga0496110_0017855
1136 Ga0496110_0032549
1137 Ga0496110_0085057
1138 Ga0496110_0595379
1139 Ga0496111_0210740
1140 Ga0496111_0266524
1141 Ga0496111_0418877
1142 Ga0496111_0518880
1143 Ga0496112_0006545
1144 Ga0496112_0021400
1145 Ga0496112_0123693
1146 Ga0496112_0132137
1147 Ga0496112_0163661
1148 Ga0496112_0349241
1149 Ga0496112_0357239
1150 Ga0496112_0915758
1151 Ga0496113_0234316
1152 Ga0496113_0243439
1153 Ga0496114_0026747
1154 Ga0496114_0249417
1155 Ga0496114_1028086
1156 Ga0496115_0004819
1157 Ga0496115_0140271
1158 Ga0496116_0000090
1159 Ga0496117_0000051
1160 Ga0496117_0110784
1161 Ga0496118_0000043
1162 Ga0496118_0003906
1163 Ga0496119_0114133
1164 Ga0496119_0210161
1165 Ga0496120_0031229
1166 Ga0496121_0000080
1167 Ga0496126_0006262
1168 Ga0501033_0157703
1169 Ga0501034_0103348
1170 Ga0501047_0445874
1171 Ga0501070_0299220
1172 Ga0501070_0393988
1173 Ga0501080_0279740
1174 Ga0501080_0768809
1175 Ga0501083_0167114
1176 Ga0501083_0749627
1177 Ga0501035_0354965
1178 Ga0501044_0219826
1179 nmdc:mga03683_69581_c1
1180 nmdc:mga03n38_110440_c1
1181 nmdc:mga03n38_13156_c1
1182 nmdc:mga03n38_1776_c1
1183 nmdc:mga03n38_256992_c1
1184 nmdc:mga03n38_31014_c1
1185 nmdc:mga03n38_331148_c1
1186 nmdc:mga03n38_415558_c1
1187 nmdc:mga03n38_46010_c1
1188 nmdc:mga03n38_630_c1
1189 nmdc:mga03n38_67298_c1
1190 nmdc:mga03n38_72504_c1
1191 nmdc:mga03n38_8887_c1
1192 nmdc:mga00v17_138142_c1
1193 nmdc:mga00v17_160778_c1
1194 nmdc:mga00v17_3002_c1
1195 nmdc:mga00v17_444346_c1
1196 nmdc:mga00v17_45011_c1
1197 nmdc:mga00v17_4805_c1
1198 nmdc:mga00v17_64695_c1
1199 nmdc:mga00v17_7961_c1
1200 nmdc:mga0yw44_203549_c1
1201 nmdc:mga0yw44_204992_c1
1202 nmdc:mga0yw44_236148_c1
1203 nmdc:mga0yw44_73807_c1
1204 nmdc:mga0yw44_79236_c1
1205 nmdc:mga06z11_14242_c1
1206 nmdc:mga06z11_27870_c1
1207 nmdc:mga06z11_614244_c1
1208 nmdc:mga06z11_94152_c1
1209 nmdc:mga07m45_349996_c1
1210 nmdc:mga07m45_55175_c1
1211 nmdc:mga07m45_69084_c1
1212 nmdc:mga07m45_86176_c1
1213 nmdc:mga05p37_87429_c1
1214 nmdc:mga09592_329456_c1
1215 nmdc:mga06r32_39354_c1
1216 nmdc:mga0n895_8792_c1
1217 nmdc:mga0rr50_7232_c1
1218 nmdc:mga08x19_14986_c1
1219 nmdc:mga0a205_15572_c1
1220 nmdc:mga0sz30_189121_c1
1221 nmdc:mga0sz30_25662_c1
1222 nmdc:mga0sz30_34686_c1
1223 nmdc:mga0sz30_36050_c2
1224 nmdc:mga0sz30_3867_c1
1225 nmdc:mga0sz30_3956_c1
1226 Ga0500641_0188050
1227 Ga0500652_001636
1228 Ga0500616_0037361
1229 Ga0466962_0047156
1230 2729908717
1231 2793982131
1232 2795792041
1233 2842140391
1234 8047894370
1235 8048364682
1236 8048380188

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

22

169

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
7q92-assembly1.cif.gz_B crystal structure of agrobacterium tumefaciens nadq, atp complex. 0.7773 1 92
3f13-assembly1.cif.gz_A crystal structure of putative nudix hydrolase family member from chromobacterium violaceum 0.7615 1 158
7q93-assembly1.cif.gz_B crystal structure of agrobacterium tumefaciens nadq, nad complex. 0.7606 1 92
5cfi-assembly3.cif.gz_C structural and functional attributes of malaria parasite ap4a hydrolase 0.7599 4 153
5lon-assembly1.cif.gz_A structure of /k. lactis/ dcp1-dcp2 decapping complex. 0.7517 2 103
ID Description Score Start End Superfamily
af_O69700_2_149_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9873 2 149 3.90.79.10
af_O69700_2_149_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9808 2 149 3.90.79.10
af_Q95XC4_8_150_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.7753 4 149 3.90.79.10
3f13A00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.7615 1 158 3.90.79.10
af_B4FX37_49_233_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.7566 1 132 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A1X1V558-F1-model_v4 NTP pyrophosphohydrolase 0.9925 1 150 GO:0004081
GO:0006167
GO:0006754
AF-A0A1A2Z2S4-F1-model_v4 NTP pyrophosphohydrolase 0.9879 1 150 GO:0004081
GO:0006167
GO:0006754
AF-A0A7I9YY11-F1-model_v4 NUDIX domain-containing protein 0.9862 1 150 GO:0004081
GO:0006167
GO:0006754
AF-A0A1A1WE72-F1-model_v4 NTP pyrophosphohydrolase 0.986 1 150 GO:0004081
GO:0006167
GO:0006754
AF-A0A1V4PGN7-F1-model_v4 Nudix hydrolase domain-containing protein 0.985 1 155 GO:0004081
GO:0006167
GO:0006754

Map