F469513

General Info

Members Datasets Scaffolds Average Seq Length
616 370 577 152

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100142599|Ga0068868_1001425993
Length 174
Sequence VKIGELSSRSGRSIHAIRWYEAQGLIPGVERDPGGRRVYTDLHVGWLDLMDRLRRTGMTIAQMREYTALVRKGRGTLDERHALLTAHRTRVRNTIAEWTTALELIQSKIDYYGEWLATGERPRQPRGVTPNSARKARVKFDTSPKPQSSATSTILPGASVNRAAASRSRARSTY

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
4 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
5 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
6 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
7 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
8 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
9 2643221658 Variovorax sp. Root411 Isolate Unclassified
10 2643221672 Variovorax sp. Root434 Isolate Unclassified
11 2643221683 Variovorax sp. Root473 Isolate Unclassified
12 2738543012 Acidovorax sp. CF301 Isolate Unclassified
13 2818991446 Variovorax sp. 1180 Isolate Unclassified
14 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
15 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
16 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
17 2842677519 Variovorax sp. R-72495 Isolate Unclassified
18 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
19 2885198086 Variovorax sp. 679 Isolate Unclassified
20 2885211737 Variovorax sp. 553 Isolate Unclassified
21 2899924645 Variovorax sp. 369 Isolate Unclassified
22 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
23 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
24 2904456579 Variovorax sp. 2002 Isolate Unclassified
25 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
26 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
27 2928037797 Variovorax sp. 1126 Isolate Unclassified
28 2928044640 Variovorax sp. 1128 Isolate Unclassified
29 2928051484 Variovorax sp. 1133 Isolate Unclassified
30 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
31 2928070936 Variovorax gossypii 1167 Isolate Unclassified
32 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
33 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
34 2929520902 Variovorax beijingensis 502 Isolate Unclassified
35 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
36 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
37 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
38 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
39 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
40 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
41 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
42 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
43 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
44 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
45 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
46 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
47 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
48 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
49 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
50 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
51 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
52 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
53 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
54 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
55 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
56 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
57 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
58 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
59 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
60 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
61 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
62 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
63 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
64 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
65 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
66 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
67 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
68 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
69 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
70 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
71 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
72 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
73 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
74 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
75 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
76 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
77 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
78 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
79 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
80 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
81 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
82 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
83 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
84 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
85 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
86 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
87 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
88 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
89 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
90 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
91 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
92 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
93 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
94 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
95 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
96 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
97 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
98 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
99 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
100 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
101 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
102 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
103 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
104 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
105 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
106 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
107 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
108 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
109 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
110 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
111 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
112 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
113 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
114 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
115 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
116 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
117 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
118 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
120 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
121 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
122 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
123 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
125 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
126 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
127 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
128 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
129 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
130 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
131 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
132 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
133 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
134 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
135 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
136 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
137 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
138 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
139 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
140 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
141 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
142 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
143 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
144 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
145 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
146 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
147 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
148 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
149 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
150 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
151 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
153 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
154 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
162 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
163 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
164 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
167 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
168 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
169 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
172 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
173 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
174 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
176 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
177 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
178 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
180 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
181 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
220 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
221 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
224 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
225 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
226 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
227 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
228 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
229 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
230 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
231 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
232 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
233 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
234 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
235 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
236 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
237 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
238 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
239 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
240 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
241 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
242 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
243 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
244 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
245 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
246 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
247 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
248 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
249 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
250 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
251 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
252 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
253 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
254 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
255 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
256 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
257 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
258 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
259 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
260 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
261 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
262 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
263 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
264 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
265 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
266 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
267 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
268 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
269 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
270 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
271 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
272 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
273 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
274 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
275 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
276 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
277 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
278 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
279 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
280 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
281 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
282 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
283 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
284 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
285 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
286 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
287 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
288 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
289 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
290 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
291 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
292 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
293 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
294 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
295 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
296 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
297 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
298 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
299 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
300 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
301 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
302 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
303 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
304 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
305 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
306 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
307 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
308 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
309 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
310 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
311 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
312 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
313 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
314 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
315 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
316 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
317 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
318 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
319 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
320 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
321 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
322 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
323 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
324 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
325 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
326 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
327 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
328 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
329 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
330 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
331 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
332 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
333 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
334 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
335 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
336 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
337 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
338 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
339 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
340 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
341 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
342 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
343 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
344 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
345 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
346 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
347 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
348 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
349 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
350 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
351 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
352 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
353 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
354 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
355 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
356 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
357 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
358 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
359 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
360 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
361 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
362 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
363 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
364 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
365 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
366 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
367 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
368 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
369 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
370 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.02
Metatranscriptomes 0.65
Isolates 6.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 36.85
Nodule 0.81
Rhizoplane 3.9
Rhizosphere 47.89
Stem 0
Stem Tuber 0
Unclassified 10.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000867 3300001979 Bacteria 13368
2 JGI25156J39149_1000025 3300002705 Bacteria 136287
3 JGI25154J39366_1000045 3300002738 Bacteria 136302
4 JGI25157J39369_1000034 3300002741 Bacteria 136301
5 JGI25152J39213_1005692 3300002773 Bacteria 3566
6 JGI25152J39213_1008693 3300002773 Bacteria 2492
7 JGI25150J39212_1003638 3300002774 Bacteria 3578
8 JGI25150J39212_1007481 3300002774 Bacteria 2189
9 JGI25159J45721_1011767 3300002987 Bacteria 2123
10 JGI25159J45721_1015335 3300002987 Bacteria 1684
11 JGI25159J45721_1016993 3300002987 Bacteria 1525
12 JGI25151J46595_10003810 3300003187 Bacteria 8177
13 JGI25151J46595_10004984 3300003187 Bacteria 6923
14 JGI25151J46595_10014158 3300003187 Bacteria 3566
15 JGI25151J46595_10024131 3300003187 Bacteria 2492
16 JGI25151J46595_10056192 3300003187 Bacteria 1292
17 JGI25153J46596_10012915 3300003215 Bacteria 3566
18 JGI25153J46596_10020571 3300003215 Bacteria 2492
19 rootH1_10020532 3300003316 Bacteria 9390
20 rootL2_10070810 3300003322 Bacteria 3675
21 rootL2_10216050 3300003322 Bacteria 1174
22 JGI25160J50197_1009623 3300003354 Bacteria 3566
23 JGI25160J50197_1016112 3300003354 Bacteria 2420
24 JGI25160J50197_1033700 3300003354 Bacteria 1283
25 JGI25161J50226_1007181 3300003374 Bacteria 1903
26 Ga0006562J51391_1066545 3300003578 Bacteria 1320
27 Ga0006562J51391_1068886 3300003578 Bacteria 2330
28 Ga0055538_1006381 3300003751 Bacteria 1148
29 Ga0055538_1006418 3300003751 Bacteria 1142
30 Ga0055539_1000062 3300003752 Bacteria 141171
31 Ga0055532_1000019 3300003758 Bacteria 286358
32 Ga0055525_1001977 3300003759 Bacteria 2556
33 Ga0055527_1001936 3300003760 Bacteria 3828
34 Ga0055535_1000014 3300003761 Bacteria 286358
35 Ga0055535_1000383 3300003761 Bacteria 41879
36 Ga0055542_1000268 3300003762 Bacteria 58408
37 Ga0055542_1004558 3300003762 Bacteria 3329
38 Ga0055529_1000086 3300003763 Bacteria 140681
39 Ga0055529_1000368 3300003763 Bacteria 48910
40 Ga0055526_1000306 3300003771 Bacteria 40960
41 Ga0055526_1013005 3300003771 Bacteria 3566
42 Ga0055526_1013091 3300003771 Bacteria 3545
43 Ga0055537_1000008 3300003773 Bacteria 142572
44 Ga0055537_1005152 3300003773 Bacteria 3566
45 Ga0055537_1008016 3300003773 Bacteria 2478
46 Ga0055524_1000075 3300003775 Bacteria 121897
47 Ga0055524_1007501 3300003775 Bacteria 4620
48 Ga0055524_1007592 3300003775 Bacteria 4586
49 Ga0055536_1001446 3300003781 Bacteria 14300
50 Ga0055536_1002335 3300003781 Bacteria 10735
51 Ga0055536_1006749 3300003781 Bacteria 5261
52 Ga0055536_1007454 3300003781 Bacteria 4893
53 Ga0055534_1005184 3300003784 Bacteria 3566
54 Ga0055534_1007851 3300003784 Bacteria 2486
55 Ga0055534_1007895 3300003784 Bacteria 2473
56 Ga0055528_1001296 3300003790 Bacteria 15695
57 Ga0055528_1011269 3300003790 Bacteria 3566
58 Ga0055528_1017522 3300003790 Bacteria 2478
59 Ga0055530_10000152 3300003791 Bacteria 62435
60 Ga0055530_10001009 3300003791 Bacteria 22509
61 Ga0055540_1000160 3300003792 Bacteria 66881
62 Ga0055540_1000814 3300003792 Bacteria 21128
63 Ga0055540_1003160 3300003792 Bacteria 8132
64 Ga0055540_1004863 3300003792 Bacteria 5885
65 Ga0055540_1007680 3300003792 Bacteria 4021
66 Ga0055540_1011025 3300003792 Bacteria 2952
67 Ga0055531_10000366 3300003794 Bacteria 43612
68 Ga0055531_10006028 3300003794 Bacteria 6954
69 Ga0055531_10014416 3300003794 Bacteria 3558
70 Ga0055531_10014477 3300003794 Bacteria 3546
71 Ga0055531_10065219 3300003794 Bacteria 867
72 Ga0055543_1000734 3300004625 Bacteria 16608
73 Ga0055543_1001161 3300004625 Bacteria 11225
74 Ga0065165_1003617 3300005262 Bacteria 10609
75 Ga0065165_1031273 3300005262 Bacteria 1684
76 Ga0065714_10008290 3300005288 Bacteria 7301
77 Ga0065712_10595516 3300005290 Bacteria 593
78 Ga0070670_100276236 3300005331 Archaea 1467
79 Ga0070670_100590390 3300005331 Bacteria 993
80 Ga0068869_100230951 3300005334 Unclassified 1470
81 Ga0068869_100830546 3300005334 Bacteria 796
82 Ga0070666_10810818 3300005335 Bacteria 690
83 Ga0068868_100142599 3300005338 Bacteria 1968
84 Ga0070689_100132009 3300005340 Bacteria 2003
85 Ga0070687_100520001 3300005343 Unclassified 804
86 Ga0070661_100000088 3300005344 Bacteria 73636
87 Ga0070668_100047565 3300005347 Bacteria 3298
88 Ga0070675_100389162 3300005354 Bacteria 1242
89 Ga0070688_100002411 3300005365 Bacteria 9438
90 Ga0070659_101131936 3300005366 Bacteria 691
91 Ga0070667_100146495 3300005367 Bacteria 2071
92 Ga0070663_100000010 3300005455 Bacteria 158193
93 Ga0070663_100123233 3300005455 Bacteria 1960
94 Ga0070662_100365577 3300005457 Bacteria 1185
95 Ga0070707_100757935 3300005468 Bacteria 934
96 Ga0070698_100480756 3300005471 Bacteria 1179
97 Ga0070699_100307448 3300005518 Bacteria 1423
98 Ga0070697_100317135 3300005536 Bacteria 1342
99 Ga0068853_100009092 3300005539 Bacteria 8000
100 Ga0068853_100091338 3300005539 Bacteria 2678
101 Ga0068853_101317606 3300005539 Bacteria 698
102 Ga0070665_100161660 3300005548 Bacteria 2241
103 Ga0068855_100230582 3300005563 Bacteria 2074
104 Ga0070664_100000005 3300005564 Bacteria 222746
105 Ga0070664_100368650 3300005564 Unclassified 1309
106 Ga0068857_100077103 3300005577 Bacteria 2973
107 Ga0068857_100709494 3300005577 Bacteria 956
108 Ga0068854_100000104 3300005578 Bacteria 58909
109 Ga0068854_100174713 3300005578 Bacteria 1674
110 Ga0068856_100000054 3300005614 Bacteria 104246
111 Ga0068856_101806093 3300005614 Bacteria 623
112 Ga0068852_100774216 3300005616 Bacteria 973
113 Ga0068859_100625692 3300005617 Bacteria 1169
114 Ga0068859_100770119 3300005617 Bacteria 1051
115 Ga0068851_10191010 3300005834 Bacteria 1139
116 Ga0068851_10402427 3300005834 Bacteria 806
117 Ga0068863_100569881 3300005841 Unclassified 1119
118 Ga0068858_100169772 3300005842 Bacteria 2056
119 Ga0068858_100187143 3300005842 Bacteria 1956
120 Ga0068858_100342685 3300005842 Bacteria 1431
121 Ga0068860_100198503 3300005843 Bacteria 1943
122 Ga0081455_10001755 3300005937 Bacteria 26202
123 Ga0075365_10008398 3300006038 Bacteria 5859
124 Ga0075368_10050901 3300006042 Bacteria 1646
125 Ga0075363_100067085 3300006048 Bacteria 1943
126 Ga0075363_100082586 3300006048 Bacteria 1759
127 Ga0075364_10010862 3300006051 Bacteria 5515
128 Ga0075364_10053464 3300006051 Bacteria 2640
129 Ga0075364_10632834 3300006051 Bacteria 731
130 Ga0075432_10003731 3300006058 Bacteria 5186
131 Ga0075362_10001902 3300006177 Bacteria 6853
132 Ga0075362_10003070 3300006177 Bacteria 5749
133 Ga0075362_10005583 3300006177 Bacteria 4615
134 Ga0075362_10033912 3300006177 Bacteria 2223
135 Ga0075362_10042610 3300006177 Bacteria 2007
136 Ga0075367_10026891 3300006178 Bacteria 3268
137 Ga0075367_10695906 3300006178 Bacteria 646
138 Ga0075366_10019514 3300006195 Bacteria 3924
139 Ga0075366_10062422 3300006195 Bacteria 2214
140 Ga0075370_10007301 3300006353 Bacteria 5627
141 Ga0075370_10028995 3300006353 Bacteria 3080
142 Ga0075370_10122982 3300006353 Bacteria 1512
143 Ga0075370_10232692 3300006353 Bacteria 1090
144 Ga0075370_10538808 3300006353 Bacteria 706
145 Ga0075434_100071863 3300006871 Bacteria 3452
146 Ga0075429_100161567 3300006880 Unclassified 1962
147 Ga0097620_100625692 3300006931 Bacteria 1169
148 Ga0097620_100770002 3300006931 Bacteria 1051
149 Ga0099826_10072488 3300006948 Bacteria 2180
150 Ga0105251_10154943 3300009011 Unclassified 1034
151 Ga0105244_10000502 3300009036 Bacteria 35162
152 Ga0105244_10035841 3300009036 Bacteria 2604
153 Ga0105240_10012374 3300009093 Bacteria 11782
154 Ga0105240_10355025 3300009093 Bacteria 1662
155 Ga0111539_10843243 3300009094 Bacteria 1066
156 Ga0105245_10516603 3300009098 Bacteria 1212
157 Ga0105245_11194946 3300009098 Unclassified 808
158 Ga0105247_10049784 3300009101 Bacteria 2577
159 Ga0105243_10003756 3300009148 Bacteria 12171
160 Ga0105243_10187338 3300009148 Bacteria 1804
161 Ga0105243_10219506 3300009148 Bacteria 1680
162 Ga0105241_10846207 3300009174 Bacteria 846
163 Ga0105242_10085806 3300009176 Bacteria 2641
164 Ga0105248_10008984 3300009177 Bacteria 10986
165 Ga0105248_10299497 3300009177 Bacteria 1811
166 Ga0105237_10063112 3300009545 Bacteria 3702
167 Ga0105238_10105988 3300009551 Bacteria 2793
168 Ga0105238_10199819 3300009551 Bacteria 1974
169 Ga0105249_10416810 3300009553 Bacteria 1376
170 Ga0105249_10676030 3300009553 Unclassified 1091
171 Ga0105239_10501561 3300010375 Bacteria 1380
172 Ga0105239_10524110 3300010375 Bacteria 1348
173 Ga0105239_10634025 3300010375 Bacteria 1220
174 Ga0105246_10009041 3300011119 Bacteria 6135
175 Ga0105246_10404474 3300011119 Bacteria 1134
176 Ga0105246_10589611 3300011119 Archaea 959
177 Ga0157347_1044152 3300012502 Bacteria 597
178 Ga0157373_10002976 3300013100 Bacteria 12826
179 Ga0157373_10032221 3300013100 Bacteria 3773
180 Ga0157371_10000103 3300013102 Bacteria 128611
181 Ga0157371_10846635 3300013102 Bacteria 691
182 Ga0157370_10000513 3300013104 Bacteria 48371
183 Ga0157370_10110003 3300013104 Bacteria 2576
184 Ga0157370_10465254 3300013104 Bacteria 1162
185 Ga0157369_10010547 3300013105 Bacteria 10515
186 Ga0157374_10120941 3300013296 Bacteria 2527
187 Ga0163162_11303833 3300013306 Bacteria 825
188 Ga0157372_10000461 3300013307 Bacteria 44748
189 Ga0163163_10080599 3300014325 Bacteria 3255
190 Ga0163163_10144861 3300014325 Unclassified 2419
191 Ga0182008_10002006 3300014497 Bacteria 13064
192 Ga0182008_10065777 3300014497 Bacteria 1783
193 Ga0182008_10180430 3300014497 Bacteria 1068
194 Ga0157379_10037027 3300014968 Bacteria 4350
195 Ga0157379_10091543 3300014968 Bacteria 2728
196 Ga0157376_11944773 3300014969 Bacteria 625
197 Ga0182006_1006704 3300015261 Bacteria 5324
198 Ga0182006_1056913 3300015261 Bacteria 1488
199 Ga0182007_10000238 3300015262 Bacteria 37140
200 Ga0182007_10079934 3300015262 Bacteria 1072
201 Ga0163161_10189527 3300017792 Bacteria 1580
202 Ga0206351_10043555 3300020077 Bacteria 3163
203 Ga0154015_1157234 3300020610 Bacteria 8841
204 Ga0209435_100001 3300025206 Bacteria 1424171
205 Ga0209436_107788 3300025208 Bacteria 2199
206 Ga0209784_100003 3300025224 Bacteria 1379451
207 Ga0209566_100002 3300025225 Bacteria 2614868
208 Ga0209566_100785 3300025225 Bacteria 16803
209 Ga0209674_100094 3300025226 Bacteria 169506
210 Ga0209674_102222 3300025226 Bacteria 4307
211 Ga0209672_100408 3300025228 Bacteria 25493
212 Ga0209672_101080 3300025228 Bacteria 11613
213 Ga0209147_100002 3300025229 Bacteria 2158988
214 Ga0209147_102883 3300025229 Bacteria 3783
215 Ga0209563_100004 3300025230 Bacteria 1814108
216 Ga0209258_100002 3300025242 Bacteria 2158988
217 Ga0209258_100009 3300025242 Bacteria 996276
218 Ga0207425_1000266 3300025245 Bacteria 38532
219 Ga0207425_1001945 3300025245 Bacteria 7777
220 Ga0207425_1015793 3300025245 Bacteria 1687
221 Ga0209646_1000001 3300025246 Bacteria 3092932
222 Ga0209026_1000003 3300025250 Bacteria 1060571
223 Ga0209026_1026886 3300025250 Bacteria 863
224 Ga0209677_100009 3300025253 Bacteria 749530
225 Ga0209148_1000007 3300025254 Bacteria 1592273
226 Ga0209148_1000493 3300025254 Bacteria 40546
227 Ga0209148_1003163 3300025254 Bacteria 4744
228 Ga0209759_1000001 3300025256 Bacteria 2799452
229 Ga0209759_1002059 3300025256 Bacteria 9429
230 Ga0209759_1002381 3300025256 Bacteria 8347
231 Ga0209129_1000013 3300025258 Bacteria 524874
232 Ga0209129_1003830 3300025258 Bacteria 6281
233 Ga0209129_1012411 3300025258 Bacteria 1956
234 Ga0209233_1032562 3300025261 Bacteria 1204
235 Ga0209565_1000004 3300025263 Bacteria 983150
236 Ga0209565_1000228 3300025263 Bacteria 61687
237 Ga0209565_1005477 3300025263 Bacteria 3688
238 Ga0209455_1000076 3300025272 Bacteria 284092
239 Ga0209455_1002659 3300025272 Bacteria 6735
240 Ga0209455_1049890 3300025272 Bacteria 591
241 Ga0209673_1000275 3300025273 Bacteria 96728
242 Ga0209673_1000309 3300025273 Bacteria 90058
243 Ga0209673_1000329 3300025273 Bacteria 87170
244 Ga0209673_1003191 3300025273 Bacteria 9956
245 Ga0209130_1000284 3300025284 Bacteria 62277
246 Ga0209130_1000368 3300025284 Bacteria 51152
247 Ga0209130_1000429 3300025284 Bacteria 45047
248 Ga0209130_1001662 3300025284 Bacteria 13593
249 Ga0209675_1000044 3300025291 Bacteria 230392
250 Ga0209675_1000238 3300025291 Bacteria 54807
251 Ga0209675_1000791 3300025291 Bacteria 20977
252 Ga0209676_1000004 3300025292 Bacteria 1138360
253 Ga0209676_1000029 3300025292 Bacteria 520536
254 Ga0209676_1000162 3300025292 Bacteria 159931
255 Ga0209676_1000206 3300025292 Bacteria 132202
256 Ga0209676_1003498 3300025292 Bacteria 9614
257 Ga0209025_1000133 3300025294 Bacteria 195885
258 Ga0209025_1000155 3300025294 Bacteria 169116
259 Ga0209025_1000393 3300025294 Bacteria 90571
260 Ga0209025_1018473 3300025294 Bacteria 3946
261 Ga0209025_1039050 3300025294 Bacteria 2077
262 Ga0209564_1000222 3300025295 Bacteria 129405
263 Ga0209564_1000356 3300025295 Bacteria 85562
264 Ga0209564_1001526 3300025295 Bacteria 23009
265 Ga0209758_1000134 3300025297 Bacteria 178294
266 Ga0209758_1004956 3300025297 Bacteria 10666
267 Ga0209758_1062221 3300025297 Bacteria 1223
268 Ga0209758_1142133 3300025297 Bacteria 621
269 Ga0209050_1000002 3300025298 Bacteria 1792849
270 Ga0209050_1000003 3300025298 Bacteria 1609245
271 Ga0209050_1000512 3300025298 Bacteria 65551
272 Ga0209050_1000659 3300025298 Bacteria 53383
273 Ga0209256_1000001 3300025299 Bacteria 2166974
274 Ga0209256_1000060 3300025299 Bacteria 262342
275 Ga0209256_1000472 3300025299 Bacteria 60473
276 Ga0207426_1000095 3300025302 Bacteria 274234
277 Ga0207426_1000100 3300025302 Bacteria 262342
278 Ga0207426_1005625 3300025302 Bacteria 5671
279 Ga0209051_1000002 3300025303 Bacteria 1631846
280 Ga0209051_1000003 3300025303 Bacteria 1609245
281 Ga0209051_1000113 3300025303 Bacteria 152417
282 Ga0209051_1000274 3300025303 Bacteria 84662
283 Ga0209051_1000311 3300025303 Bacteria 76050
284 Ga0209051_1012141 3300025303 Bacteria 4185
285 Ga0209051_1014263 3300025303 Bacteria 3718
286 Ga0209257_1000002 3300025304 Bacteria 1767052
287 Ga0209257_1000018 3300025304 Bacteria 836016
288 Ga0209257_1000286 3300025304 Bacteria 111738
289 Ga0209257_1000432 3300025304 Bacteria 80643
290 Ga0209257_1001890 3300025304 Bacteria 22644
291 Ga0209257_1006446 3300025304 Bacteria 7556
292 Ga0209257_1024838 3300025304 Bacteria 2063
293 Ga0207656_10057494 3300025321 Bacteria 1697
294 Ga0207656_10680318 3300025321 Bacteria 527
295 Ga0207710_10036683 3300025900 Bacteria 2162
296 Ga0207710_10119223 3300025900 Bacteria 1259
297 Ga0207680_10077211 3300025903 Bacteria 2082
298 Ga0207647_10004348 3300025904 Bacteria 10505
299 Ga0207684_10178937 3300025910 Bacteria 1828
300 Ga0207654_10091551 3300025911 Bacteria 1855
301 Ga0207695_10002145 3300025913 Bacteria 29897
302 Ga0207695_10392204 3300025913 Bacteria 1273
303 Ga0207671_10194143 3300025914 Bacteria 1584
304 Ga0207649_10000098 3300025920 Bacteria 71539
305 Ga0207646_10703918 3300025922 Bacteria 903
306 Ga0207694_10395154 3300025924 Bacteria 1149
307 Ga0207650_10644841 3300025925 Bacteria 892
308 Ga0207650_10849219 3300025925 Bacteria 775
309 Ga0207687_10827051 3300025927 Unclassified 791
310 Ga0207706_10001106 3300025933 Bacteria 27447
311 Ga0207706_10899213 3300025933 Bacteria 748
312 Ga0207709_10000765 3300025935 Bacteria 25358
313 Ga0207709_10101503 3300025935 Bacteria 1903
314 Ga0207670_10103440 3300025936 Bacteria 2038
315 Ga0207704_10151467 3300025938 Bacteria 1637
316 Ga0207711_10175989 3300025941 Bacteria 1944
317 Ga0207711_10225164 3300025941 Bacteria 1716
318 Ga0207689_10235825 3300025942 Unclassified 1512
319 Ga0207689_11366632 3300025942 Bacteria 594
320 Ga0207679_10000020 3300025945 Bacteria 225727
321 Ga0207679_10118159 3300025945 Bacteria 2105
322 Ga0207712_10233276 3300025961 Bacteria 1478
323 Ga0207668_10052736 3300025972 Bacteria 2815
324 Ga0207668_10610967 3300025972 Bacteria 951
325 Ga0207640_10000092 3300025981 Bacteria 71354
326 Ga0207640_10500830 3300025981 Bacteria 1011
327 Ga0207658_10152390 3300025986 Bacteria 1885
328 Ga0207677_10171696 3300026023 Bacteria 1696
329 Ga0207703_10126484 3300026035 Bacteria 2201
330 Ga0207703_10278829 3300026035 Bacteria 1517
331 Ga0207703_10392983 3300026035 Bacteria 1285
332 Ga0207639_10016199 3300026041 Bacteria 5268
333 Ga0207639_10817116 3300026041 Bacteria 869
334 Ga0207678_10000181 3300026067 Bacteria 53999
335 Ga0207678_10054736 3300026067 Bacteria 3436
336 Ga0207708_10706978 3300026075 Bacteria 862
337 Ga0207702_10000017 3300026078 Bacteria 222964
338 Ga0207702_10619387 3300026078 Bacteria 1063
339 Ga0207641_10214951 3300026088 Bacteria 1780
340 Ga0207641_10261285 3300026088 Bacteria 1621
341 Ga0207641_10372977 3300026088 Archaea 1365
342 Ga0207648_10344594 3300026089 Bacteria 1342
343 Ga0207676_10120781 3300026095 Unclassified 2209
344 Ga0207676_10156399 3300026095 Bacteria 1970
345 Ga0207674_10137420 3300026116 Bacteria 2405
346 Ga0207674_10450443 3300026116 Bacteria 1244
347 Ga0207674_10738823 3300026116 Bacteria 950
348 Ga0207683_12030149 3300026121 Bacteria 523
349 Ga0207698_10087597 3300026142 Bacteria 2536
350 Ga0209282_1067696 3300027666 Bacteria 1959
351 Ga0207428_10273130 3300027907 Bacteria 1256
352 Ga0268266_10150702 3300028379 Bacteria 2096
353 Ga0268264_10155303 3300028381 Bacteria 2056
354 Ga0268264_10710004 3300028381 Bacteria 999
355 Ga0307515_10003072 3300028794 Bacteria 35359
356 Ga0316177_1063076 3300030731 Bacteria 2716
357 Ga0314311_1027081 3300030733 Bacteria 14353
358 Ga0316178_1129918 3300030735 Bacteria 2727
359 Ga0316180_1028766 3300030736 Bacteria 5000
360 Ga0316183_1073027 3300030742 Bacteria 8781
361 Ga0316181_1276434 3300030744 Bacteria 1471
362 Ga0316182_1019128 3300030745 Bacteria 2145
363 Ga0307408_100003238 3300031548 Bacteria 11195
364 Ga0307408_100121256 3300031548 Bacteria 2026
365 Ga0307408_100186826 3300031548 Bacteria 1666
366 Ga0307408_100242316 3300031548 Bacteria 1482
367 Ga0307508_10000740 3300031616 Bacteria 38713
368 Ga0307514_10007518 3300031649 Bacteria 9389
369 Ga0307514_10141616 3300031649 Bacteria 1633
370 Ga0307516_10154435 3300031730 Bacteria 2052
371 Ga0307405_10070917 3300031731 Bacteria 2240
372 Ga0307405_10074261 3300031731 Bacteria 2198
373 Ga0307405_10419751 3300031731 Bacteria 1052
374 Ga0307413_10486727 3300031824 Bacteria 987
375 Ga0307406_10004177 3300031901 Bacteria 7864
376 Ga0307406_10347585 3300031901 Bacteria 1157
377 Ga0307406_11327876 3300031901 Bacteria 628
378 Ga0307412_10001515 3300031911 Bacteria 12884
379 Ga0307412_10083720 3300031911 Bacteria 2212
380 Ga0307412_10150105 3300031911 Bacteria 1718
381 Ga0307412_10356873 3300031911 Bacteria 1176
382 Ga0307416_100124799 3300032002 Bacteria 2304
383 Ga0307416_100305808 3300032002 Bacteria 1583
384 Ga0307416_100376140 3300032002 Bacteria 1448
385 Ga0307416_100457423 3300032002 Bacteria 1330
386 Ga0307414_10420514 3300032004 Bacteria 1165
387 Ga0307411_10145911 3300032005 Bacteria 1751
388 Ga0395900_0031258 3300037418 Bacteria 5468
389 Ga0439436_0001553 3300041404 Bacteria 6689
390 Ga0439436_0022471 3300041404 Bacteria 1868
391 Ga0439438_120254 3300041405 Bacteria 632
392 Ga0439439_0017818 3300041406 Bacteria 1750
393 Ga0439447_014433 3300041407 Bacteria 2217
394 Ga0439453_0176427 3300041408 Bacteria 519
395 Ga0439461_0017902 3300041410 Bacteria 1381
396 Ga0439466_0022338 3300041411 Bacteria 2234
397 Ga0439466_0023241 3300041411 Bacteria 2182
398 Ga0439465_0000742 3300041413 Bacteria 10100
399 Ga0439465_0113659 3300041413 Bacteria 944
400 Ga0451797_0442460 3300041453 Bacteria 637
401 Ga0451802_0199705 3300041460 Bacteria 1179
402 Ga0451807_0059783 3300041486 Bacteria 1088
403 Ga0451855_0662111 3300041511 Bacteria 555
404 Ga0451853_0435475 3300041512 Bacteria 983
405 Ga0439431_0000629 3300041997 Bacteria 7487
406 Ga0439431_0095947 3300041997 Unclassified 811
407 Ga0439433_0008566 3300041999 Bacteria 2220
408 Ga0439433_0009010 3300041999 Bacteria 2173
409 Ga0439442_001238 3300042002 Bacteria 5075
410 Ga0439442_005571 3300042002 Bacteria 2518
411 Ga0439442_060905 3300042002 Bacteria 800
412 Ga0439442_072879 3300042002 Bacteria 732
413 Ga0439445_0004954 3300042004 Bacteria 3025
414 Ga0439432_004193 3300042006 Bacteria 5272
415 Ga0439432_004226 3300042006 Bacteria 5251
416 Ga0439449_0000525 3300042007 Bacteria 14260
417 Ga0439449_0003387 3300042007 Bacteria 6214
418 Ga0439449_0007761 3300042007 Bacteria 4074
419 Ga0439449_0166328 3300042007 Bacteria 824
420 Ga0439452_003292 3300042010 Bacteria 5691
421 Ga0439457_006836 3300042014 Bacteria 2763
422 Ga0439457_102484 3300042014 Bacteria 668
423 Ga0439462_0005683 3300042015 Bacteria 3079
424 Ga0439462_0017364 3300042015 Bacteria 1863
425 Ga0450919_010907 3300042121 Bacteria 1034
426 Ga0450890_019320 3300042127 Bacteria 917
427 Ga0450897_031878 3300042128 Bacteria 599
428 Ga0450892_019542 3300042130 Bacteria 657
429 Ga0450894_004279 3300042131 Bacteria 1859
430 Ga0450898_035011 3300042134 Unclassified 934
431 Ga0450898_050433 3300042134 Bacteria 803
432 Ga0450898_118575 3300042134 Unclassified 564
433 Ga0450899_033330 3300042135 Bacteria 631
434 Ga0450906_013444 3300042145 Bacteria 1508
435 Ga0450906_028018 3300042145 Bacteria 998
436 Ga0450907_016921 3300042146 Bacteria 1216
437 Ga0439446_0004804 3300042156 Bacteria 3444
438 Ga0439446_0030157 3300042156 Bacteria 1567
439 Ga0450908_001834 3300042184 Bacteria 4153
440 Ga0450909_048036 3300042185 Bacteria 663
441 Ga0439434_0001149 3300042435 Bacteria 7661
442 Ga0439434_0025836 3300042435 Bacteria 1773
443 Ga0450918_013312 3300042531 Bacteria 1431
444 Ga0466972_0003409 3300044658 Bacteria 7883
445 Ga0466965_0050591 3300044683 Bacteria 2060
446 Ga0466961_0472460 3300044693 Bacteria 758
447 Ga0466963_0027230 3300044694 Bacteria 3659
448 Ga0466971_0201867 3300044719 Bacteria 939
449 Ga0466957_0234298 3300044842 Bacteria 1216
450 Ga0466960_0066357 3300044901 Bacteria 1784
451 Ga0451576_0953373 3300045051 Unclassified 900
452 Ga0466967_0046517 3300045976 Bacteria 3778
453 Ga0495638_0004688 3300046460 Bacteria 10335
454 Ga0495606_0234284 3300046507 Bacteria 1027
455 Ga0495606_0536996 3300046507 Bacteria 584
456 Ga0495616_0142443 3300046513 Bacteria 1090
457 Ga0495620_0049238 3300046515 Bacteria 1804
458 Ga0495631_0000213 3300046518 Bacteria 39910
459 Ga0495637_0015117 3300046520 Bacteria 3626
460 Ga0495654_0025029 3300046530 Bacteria 3078
461 Ga0495621_0021481 3300046539 Bacteria 2128
462 Ga0495597_0020813 3300046542 Bacteria 3052
463 Ga0495668_0125394 3300046616 Bacteria 1405
464 Ga0495668_0294062 3300046616 Bacteria 890
465 Ga0495625_0000057 3300046660 Bacteria 181623
466 Ga0495588_0034286 3300046674 Bacteria 2568
467 Ga0495588_0073008 3300046674 Bacteria 1786
468 Ga0495670_0017565 3300046691 Bacteria 3522
469 Ga0495671_0019710 3300046692 Bacteria 3561
470 Ga0495660_0136534 3300046810 Bacteria 1225
471 Ga0495676_0003920 3300047321 Bacteria 13532
472 Ga0495683_0017198 3300047323 Bacteria 3750
473 Ga0495687_008900 3300047443 Bacteria 5684
474 Ga0495593_0016801 3300047673 Bacteria 4121
475 Ga0495602_0102266 3300048088 Bacteria 2349
476 Ga0495614_0006647 3300048089 Bacteria 5179
477 Ga0496100_0247658 3300048903 Bacteria 1317
478 Ga0496101_0580548 3300048904 Bacteria 886
479 Ga0496102_0678418 3300048905 Bacteria 953
480 Ga0496103_0014633 3300048906 Bacteria 4662
481 Ga0496103_0655902 3300048906 Bacteria 666
482 Ga0496104_0206865 3300048907 Bacteria 1874
483 Ga0496104_0425156 3300048907 Unclassified 1240
484 Ga0496105_0268157 3300048908 Bacteria 1379
485 Ga0496106_0227256 3300048909 Bacteria 1489
486 Ga0496107_0318247 3300048910 Bacteria 1158
487 Ga0496108_0496976 3300048911 Unclassified 1065
488 Ga0496109_0200017 3300048912 Bacteria 1878
489 Ga0496109_0680481 3300048912 Archaea 966
490 Ga0496110_0081368 3300048913 Bacteria 2887
491 Ga0496112_0006563 3300048915 Bacteria 10238
492 Ga0496112_0087400 3300048915 Bacteria 3084
493 Ga0496113_0071700 3300048916 Bacteria 2635
494 Ga0496116_0016032 3300048919 Bacteria 5889
495 Ga0496116_0171276 3300048919 Bacteria 1176
496 Ga0496117_0040130 3300048920 Bacteria 3448
497 Ga0496117_0097036 3300048920 Bacteria 1878
498 Ga0496117_0285045 3300048920 Bacteria 882
499 Ga0496118_0026578 3300048921 Bacteria 4925
500 Ga0496118_0031323 3300048921 Bacteria 4411
501 Ga0496118_0031565 3300048921 Bacteria 4388
502 Ga0496119_0062975 3300048922 Bacteria 2208
503 Ga0496121_0093851 3300048924 Bacteria 2335
504 Ga0496121_0281954 3300048924 Bacteria 1136
505 Ga0496121_0537772 3300048924 Bacteria 733
506 Ga0496122_0012141 3300048925 Bacteria 8623
507 Ga0496122_0175360 3300048925 Bacteria 1286
508 Ga0496122_0216818 3300048925 Bacteria 1102
509 Ga0496122_0285567 3300048925 Bacteria 899
510 Ga0496123_0040310 3300048926 Bacteria 3255
511 Ga0496123_0282932 3300048926 Bacteria 800
512 Ga0496124_0062766 3300048927 Bacteria 3108
513 Ga0496124_0195238 3300048927 Bacteria 1545
514 Ga0496125_0021624 3300048928 Bacteria 5995
515 Ga0496125_0045744 3300048928 Bacteria 3679
516 Ga0496125_0136555 3300048928 Bacteria 1714
517 Ga0496126_0218009 3300048929 Bacteria 1604
518 Ga0501225_0005947 3300049705 Bacteria 3572
519 Ga0501262_000600 3300049759 Bacteria 4241
520 nmdc:mga03683_2343_c2 3300050489 Bacteria 4682
521 nmdc:mga03683_25557_c1 3300050489 Bacteria 2322
522 nmdc:mga03683_35729_c1 3300050489 Bacteria 2017
523 nmdc:mga03n38_20545_c1 3300050490 Bacteria 2644
524 nmdc:mga03n38_311727_c1 3300050490 Bacteria 848
525 nmdc:mga00v17_116241_c1 3300050491 Bacteria 1700
526 nmdc:mga00v17_17018_c1 3300050491 Bacteria 4106
527 nmdc:mga00v17_98016_c1 3300050491 Bacteria 1848
528 nmdc:mga0yw44_161827_c1 3300050492 Bacteria 1466
529 nmdc:mga0yw44_52589_c1 3300050492 Bacteria 2470
530 nmdc:mga0k408_10327_c2 3300050493 Bacteria 3719
531 nmdc:mga0k408_138126_c1 3300050493 Bacteria 1449
532 nmdc:mga0k408_138650_c1 3300050493 Bacteria 1446
533 nmdc:mga0k408_293820_c1 3300050493 Bacteria 970
534 nmdc:mga0k408_6552_c1 3300050493 Bacteria 6203
535 nmdc:mga0k408_85111_c1 3300050493 Bacteria 1856
536 nmdc:mga06z11_256770_c1 3300050494 Bacteria 1030
537 nmdc:mga06z11_423866_c1 3300050494 Bacteria 802
538 nmdc:mga04h51_78730_c1 3300050495 Bacteria 1166
539 nmdc:mga07m45_116300_c1 3300050496 Bacteria 1542
540 nmdc:mga07m45_20234_c1 3300050496 Bacteria 3615
541 nmdc:mga07m45_318123_c1 3300050496 Bacteria 905
542 nmdc:mga07m45_44155_c1 3300050496 Bacteria 2500
543 nmdc:mga08y16_1450456_c1 3300050511 Bacteria 648
544 nmdc:mga0sz30_166942_c1 3300050516 Bacteria 976
545 nmdc:mga0sz30_407319_c1 3300050516 Bacteria 609
546 Ga0500610_0008818 3300053079 Bacteria 4420
547 Ga0500610_0016274 3300053079 Bacteria 3541
548 Ga0500610_0314758 3300053079 Bacteria 682
549 Ga0500644_0001001 3300053088 Bacteria 8728
550 Ga0500651_0000189 3300053093 Bacteria 39346
551 Ga0500566_0045842 3300053094 Bacteria 2515
552 Ga0500566_0054958 3300053094 Bacteria 2269
553 Ga0500566_0157209 3300053094 Bacteria 1189
554 Ga0500650_0071854 3300053098 Bacteria 1617
555 Ga0500571_000045 3300053110 Bacteria 39238
556 Ga0500593_000850 3300053117 Bacteria 11363
557 Ga0500593_014332 3300053117 Bacteria 3399
558 Ga0500594_0003235 3300053118 Bacteria 3567
559 Ga0500597_004697 3300053120 Bacteria 4286
560 Ga0500607_002838 3300053121 Bacteria 13393
561 Ga0500608_013352 3300053122 Bacteria 3639
562 Ga0500614_009430 3300053123 Bacteria 2083
563 Ga0500628_007251 3300053129 Bacteria 1895
564 Ga0500655_001735 3300053133 Bacteria 4088
565 Ga0500658_0000288 3300053134 Bacteria 22797
566 Ga0500559_0048729 3300053136 Bacteria 1864
567 Ga0500574_000524 3300053141 Bacteria 4928
568 Ga0500577_0222936 3300053142 Bacteria 816
569 Ga0500604_0031446 3300053151 Bacteria 1558
570 Ga0500616_0027608 3300053153 Bacteria 3132
571 Ga0500619_117727 3300053154 Bacteria 905
572 Ga0500624_004701 3300053157 Bacteria 1803
573 Ga0500627_0036706 3300053158 Bacteria 2088
574 Ga0500638_068784 3300053162 Bacteria 1694
575 Ga0500636_0311274 3300053177 Bacteria 770
576 Ga0500637_0158572 3300053178 Bacteria 1305
577 Ga0500645_140665 3300053730 Bacteria 668

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005331 Ga0070670_100276236 Ga0070670_1002762361 132
2 3300005334 Ga0068869_100230951 Ga0068869_1002309512 132
3 3300005354 Ga0070675_100389162 Ga0070675_1003891622 132
4 3300025925 Ga0207650_10849219 Ga0207650_108492191 132
5 3300025942 Ga0207689_10235825 Ga0207689_102358252 132
6 3300026095 Ga0207676_10156399 Ga0207676_101563993 132
7 3300028381 Ga0268264_10155303 Ga0268264_101553033 134
8 3300041997 Ga0439431_0095947 Ga0439431_0095947_40_537 135
9 3300042130 Ga0450892_019542 Ga0450892_019542_55_543 135
10 3300005290 Ga0065712_10595516 Ga0065712_105955161 136
11 3300005564 Ga0070664_100368650 Ga0070664_1003686502 136
12 3300005842 Ga0068858_100169772 Ga0068858_1001697722 136
13 3300009011 Ga0105251_10154943 Ga0105251_101549432 136
14 3300009177 Ga0105248_10008984 Ga0105248_100089843 136
15 3300014325 Ga0163163_10144861 Ga0163163_101448612 136
16 3300014968 Ga0157379_10091543 Ga0157379_100915432 136
17 3300025900 Ga0207710_10119223 Ga0207710_101192233 136
18 3300025941 Ga0207711_10175989 Ga0207711_101759893 136
19 3300025945 Ga0207679_10118159 Ga0207679_101181593 136
20 3300026035 Ga0207703_10126484 Ga0207703_101264843 136
21 3300026088 Ga0207641_10372977 Ga0207641_103729771 136
22 3300026095 Ga0207676_10120781 Ga0207676_101207812 136
23 3300046460 Ga0495638_0004688 Ga0495638_0004688_2763_3185 136
24 3300048907 Ga0496104_0425156 Ga0496104_0425156_703_1152 136
25 3300048911 Ga0496108_0496976 Ga0496108_0496976_545_994 136
26 3300048912 Ga0496109_0680481 Ga0496109_0680481_241_690 136
27 3300048915 Ga0496112_0006563 Ga0496112_0006563_8613_9062 136
28 3300048916 Ga0496113_0071700 Ga0496113_0071700_1035_1484 136
29 3300053142 Ga0500577_0222936 Ga0500577_0222936_35_457 136
30 iso_pu_bacteria 2643221683 2644467721 137
31 3300006353 Ga0075370_10122982 Ga0075370_101229823 138
32 3300042002 Ga0439442_072879 Ga0439442_072879_114_554 138
33 3300042007 Ga0439449_0000525 Ga0439449_0000525_5585_6025 138
34 3300050496 nmdc:mga07m45_116300_c1 nmdc:mga07m45_116300_c1_165_614 138
35 3300053094 Ga0500566_0054958 Ga0500566_0054958_939_1388 138
36 3300053730 Ga0500645_140665 Ga0500645_140665_50_499 138
37 iso_pu_bacteria 2511231002 2511244234 138
38 3300005937 Ga0081455_10001755 Ga0081455_1000175524 139
39 3300044658 Ga0466972_0003409 Ga0466972_0003409_3988_4425 139
40 3300044693 Ga0466961_0472460 Ga0466961_0472460_112_549 139
41 iso_pu_bacteria 2599185214 2599622739 139
42 iso_pu_bacteria 2599185226 2599671218 139
43 iso_pu_bacteria 2599185227 2599679745 139
44 iso_pu_bacteria 2599185229 2599691761 139
45 iso_pu_bacteria 2824679649 2824682505 139
46 iso_pu_bacteria 2885192300 2885196013 139
47 iso_pu_bacteria 2885198086 2885204770 139
48 iso_pu_bacteria 2885211737 2885218543 139
49 iso_pu_bacteria 2922393267 2922395433 139
50 iso_pu_bacteria 2928070936 2928074536 139
51 iso_pu_bacteria 3005594810 3005598249 139
52 3300006871 Ga0075434_100071863 Ga0075434_1000718635 140
53 3300031548 Ga0307408_100121256 Ga0307408_1001212562 140
54 3300031649 Ga0307514_10141616 Ga0307514_101416163 140
55 3300031731 Ga0307405_10070917 Ga0307405_100709172 140
56 3300032002 Ga0307416_100124799 Ga0307416_1001247992 140
57 3300042127 Ga0450890_019320 Ga0450890_019320_92_568 140
58 3300045051 Ga0451576_0953373 Ga0451576_0953373_393_830 140
59 3300048906 Ga0496103_0655902 Ga0496103_0655902_216_653 140
60 iso_pu_bacteria 2904449895 2904452324 140
61 iso_pu_bacteria 2904456579 2904458530 140
62 3300003762 Ga0055542_1004558 Ga0055542_10045585 141
63 3300005331 Ga0070670_100590390 Ga0070670_1005903901 141
64 3300005334 Ga0068869_100830546 Ga0068869_1008305462 141
65 3300005335 Ga0070666_10810818 Ga0070666_108108181 141
66 3300005340 Ga0070689_100132009 Ga0070689_1001320092 141
67 3300005347 Ga0070668_100047565 Ga0070668_1000475655 141
68 3300005365 Ga0070688_100002411 Ga0070688_1000024117 141
69 3300005366 Ga0070659_101131936 Ga0070659_1011319362 141
70 3300005367 Ga0070667_100146495 Ga0070667_1001464951 141
71 3300005455 Ga0070663_100123233 Ga0070663_1001232335 141
72 3300005468 Ga0070707_100757935 Ga0070707_1007579352 141
73 3300005471 Ga0070698_100480756 Ga0070698_1004807562 141
74 3300005518 Ga0070699_100307448 Ga0070699_1003074482 141
75 3300005536 Ga0070697_100317135 Ga0070697_1003171352 141
76 3300005539 Ga0068853_100091338 Ga0068853_1000913382 141
77 3300005548 Ga0070665_100161660 Ga0070665_1001616605 141
78 3300005563 Ga0068855_100230582 Ga0068855_1002305822 141
79 3300005577 Ga0068857_100709494 Ga0068857_1007094942 141
80 3300005578 Ga0068854_100174713 Ga0068854_1001747132 141
81 3300005616 Ga0068852_100774216 Ga0068852_1007742162 141
82 3300005617 Ga0068859_100625692 Ga0068859_1006256922 141
83 3300005834 Ga0068851_10402427 Ga0068851_104024272 141
84 3300005842 Ga0068858_100187143 Ga0068858_1001871432 141
85 3300005843 Ga0068860_100198503 Ga0068860_1001985033 141
86 3300006042 Ga0075368_10050901 Ga0075368_100509012 141
87 3300006048 Ga0075363_100082586 Ga0075363_1000825862 141
88 3300006051 Ga0075364_10010862 Ga0075364_100108626 141
89 3300006177 Ga0075362_10033912 Ga0075362_100339122 141
90 3300006195 Ga0075366_10019514 Ga0075366_100195143 141
91 3300006353 Ga0075370_10232692 Ga0075370_102326922 141
92 3300006880 Ga0075429_100161567 Ga0075429_1001615671 141
93 3300006931 Ga0097620_100625692 Ga0097620_1006256922 141
94 3300009093 Ga0105240_10355025 Ga0105240_103550253 141
95 3300009094 Ga0111539_10843243 Ga0111539_108432431 141
96 3300009101 Ga0105247_10049784 Ga0105247_100497842 141
97 3300009177 Ga0105248_10299497 Ga0105248_102994973 141
98 3300009545 Ga0105237_10063112 Ga0105237_100631124 141
99 3300009551 Ga0105238_10105988 Ga0105238_101059885 141
100 3300009553 Ga0105249_10416810 Ga0105249_104168102 141
101 3300010375 Ga0105239_10501561 Ga0105239_105015612 141
102 3300011119 Ga0105246_10009041 Ga0105246_100090418 141
103 3300013102 Ga0157371_10846635 Ga0157371_108466351 141
104 3300013296 Ga0157374_10120941 Ga0157374_101209414 141
105 3300013306 Ga0163162_11303833 Ga0163162_113038332 141
106 3300014325 Ga0163163_10080599 Ga0163163_100805992 141
107 3300014968 Ga0157379_10037027 Ga0157379_100370273 141
108 3300014969 Ga0157376_11944773 Ga0157376_119447732 141
109 3300025250 Ga0209026_1026886 Ga0209026_10268862 141
110 3300025254 Ga0209148_1000493 Ga0209148_100049315 141
111 3300025261 Ga0209233_1032562 Ga0209233_10325622 141
112 3300025272 Ga0209455_1002659 Ga0209455_10026594 141
113 3300025272 Ga0209455_1049890 Ga0209455_10498902 141
114 3300025304 Ga0209257_1024838 Ga0209257_10248381 141
115 3300025321 Ga0207656_10680318 Ga0207656_106803181 141
116 3300025900 Ga0207710_10036683 Ga0207710_100366833 141
117 3300025903 Ga0207680_10077211 Ga0207680_100772113 141
118 3300025904 Ga0207647_10004348 Ga0207647_100043489 141
119 3300025910 Ga0207684_10178937 Ga0207684_101789373 141
120 3300025911 Ga0207654_10091551 Ga0207654_100915512 141
121 3300025913 Ga0207695_10392204 Ga0207695_103922042 141
122 3300025914 Ga0207671_10194143 Ga0207671_101941432 141
123 3300025922 Ga0207646_10703918 Ga0207646_107039182 141
124 3300025924 Ga0207694_10395154 Ga0207694_103951542 141
125 3300025925 Ga0207650_10644841 Ga0207650_106448411 141
126 3300025936 Ga0207670_10103440 Ga0207670_101034402 141
127 3300025941 Ga0207711_10225164 Ga0207711_102251642 141
128 3300025942 Ga0207689_11366632 Ga0207689_113666321 141
129 3300025961 Ga0207712_10233276 Ga0207712_102332763 141
130 3300025972 Ga0207668_10052736 Ga0207668_100527363 141
131 3300025981 Ga0207640_10500830 Ga0207640_105008302 141
132 3300025986 Ga0207658_10152390 Ga0207658_101523902 141
133 3300026035 Ga0207703_10392983 Ga0207703_103929833 141
134 3300026067 Ga0207678_10054736 Ga0207678_100547363 141
135 3300026088 Ga0207641_10214951 Ga0207641_102149513 141
136 3300026116 Ga0207674_10450443 Ga0207674_104504432 141
137 3300026116 Ga0207674_10738823 Ga0207674_107388232 141
138 3300026121 Ga0207683_12030149 Ga0207683_120301491 141
139 3300028379 Ga0268266_10150702 Ga0268266_101507022 141
140 3300028381 Ga0268264_10710004 Ga0268264_107100042 141
141 3300031616 Ga0307508_10000740 Ga0307508_1000074017 141
142 3300031730 Ga0307516_10154435 Ga0307516_101544352 141
143 3300044694 Ga0466963_0027230 Ga0466963_0027230_195_635 141
144 3300044719 Ga0466971_0201867 Ga0466971_0201867_19_459 141
145 3300044842 Ga0466957_0234298 Ga0466957_0234298_752_1192 141
146 3300045976 Ga0466967_0046517 Ga0466967_0046517_1433_1873 141
147 3300046507 Ga0495606_0234284 Ga0495606_0234284_461_901 141
148 3300046507 Ga0495606_0536996 Ga0495606_0536996_34_474 141
149 3300046513 Ga0495616_0142443 Ga0495616_0142443_410_850 141
150 3300046542 Ga0495597_0020813 Ga0495597_0020813_1575_2015 141
151 3300046616 Ga0495668_0125394 Ga0495668_0125394_252_692 141
152 3300047323 Ga0495683_0017198 Ga0495683_0017198_46_486 141
153 3300047443 Ga0495687_008900 Ga0495687_008900_3459_3899 141
154 3300048903 Ga0496100_0247658 Ga0496100_0247658_447_887 141
155 3300048904 Ga0496101_0580548 Ga0496101_0580548_164_604 141
156 3300048905 Ga0496102_0678418 Ga0496102_0678418_192_632 141
157 3300048906 Ga0496103_0014633 Ga0496103_0014633_35_475 141
158 3300048907 Ga0496104_0206865 Ga0496104_0206865_1414_1854 141
159 3300048908 Ga0496105_0268157 Ga0496105_0268157_486_926 141
160 3300048909 Ga0496106_0227256 Ga0496106_0227256_644_1084 141
161 3300048910 Ga0496107_0318247 Ga0496107_0318247_233_673 141
162 3300048912 Ga0496109_0200017 Ga0496109_0200017_1211_1651 141
163 3300048913 Ga0496110_0081368 Ga0496110_0081368_102_542 141
164 3300048915 Ga0496112_0087400 Ga0496112_0087400_1024_1464 141
165 3300048919 Ga0496116_0171276 Ga0496116_0171276_420_860 141
166 3300048920 Ga0496117_0040130 Ga0496117_0040130_630_1070 141
167 3300048921 Ga0496118_0031323 Ga0496118_0031323_833_1273 141
168 3300048922 Ga0496119_0062975 Ga0496119_0062975_657_1097 141
169 3300048924 Ga0496121_0281954 Ga0496121_0281954_419_859 141
170 3300048925 Ga0496122_0012141 Ga0496122_0012141_3546_4025 141
171 3300048925 Ga0496122_0285567 Ga0496122_0285567_190_630 141
172 3300048926 Ga0496123_0040310 Ga0496123_0040310_911_1390 141
173 3300048927 Ga0496124_0195238 Ga0496124_0195238_218_658 141
174 3300048928 Ga0496125_0136555 Ga0496125_0136555_977_1417 141
175 3300048929 Ga0496126_0218009 Ga0496126_0218009_216_665 141
176 3300050489 nmdc:mga03683_35729_c1 nmdc:mga03683_35729_c1_251_691 141
177 3300050490 nmdc:mga03n38_20545_c1 nmdc:mga03n38_20545_c1_2123_2563 141
178 3300050491 nmdc:mga00v17_17018_c1 nmdc:mga00v17_17018_c1_2789_3229 141
179 3300050492 nmdc:mga0yw44_161827_c1 nmdc:mga0yw44_161827_c1_319_759 141
180 3300050493 nmdc:mga0k408_293820_c1 nmdc:mga0k408_293820_c1_112_552 141
181 3300050495 nmdc:mga04h51_78730_c1 nmdc:mga04h51_78730_c1_52_492 141
182 3300050496 nmdc:mga07m45_318123_c1 nmdc:mga07m45_318123_c1_19_459 141
183 3300050511 nmdc:mga08y16_1450456_c1 nmdc:mga08y16_1450456_c1_150_602 141
184 3300050516 nmdc:mga0sz30_166942_c1 nmdc:mga0sz30_166942_c1_53_493 141
185 3300053088 Ga0500644_0001001 Ga0500644_0001001_6925_7389 141
186 3300053094 Ga0500566_0157209 Ga0500566_0157209_637_1101 141
187 3300053098 Ga0500650_0071854 Ga0500650_0071854_580_1035 141
188 3300053117 Ga0500593_000850 Ga0500593_000850_3096_3560 141
189 3300053151 Ga0500604_0031446 Ga0500604_0031446_634_1098 141
190 iso_pu_bacteria 2513020051 2513229413 141
191 iso_pu_bacteria 2831265667 2831267200 141
192 iso_pu_bacteria 2838054893 2838056290 141
193 iso_pu_bacteria 2928084124 2928087312 141
194 iso_pu_bacteria 2954767861 2954771407 141
195 3300002705 JGI25156J39149_1000025 JGI25156J39149_1000025104 142
196 3300002738 JGI25154J39366_1000045 JGI25154J39366_1000045104 142
197 3300002741 JGI25157J39369_1000034 JGI25157J39369_1000034104 142
198 3300002987 JGI25159J45721_1016993 JGI25159J45721_10169933 142
199 3300003316 rootH1_10020532 rootH1_1002053211 142
200 3300003322 rootL2_10070810 rootL2_100708103 142
201 3300003354 JGI25160J50197_1033700 JGI25160J50197_10337002 142
202 3300003761 Ga0055535_1000383 Ga0055535_100038310 142
203 3300003762 Ga0055542_1000268 Ga0055542_100026834 142
204 3300003771 Ga0055526_1000306 Ga0055526_100030616 142
205 3300003773 Ga0055537_1000008 Ga0055537_100000826 142
206 3300003775 Ga0055524_1000075 Ga0055524_100007534 142
207 3300003781 Ga0055536_1001446 Ga0055536_10014468 142
208 3300003784 Ga0055534_1007851 Ga0055534_10078511 142
209 3300003790 Ga0055528_1001296 Ga0055528_100129615 142
210 3300003791 Ga0055530_10000152 Ga0055530_1000015226 142
211 3300003792 Ga0055540_1000160 Ga0055540_100016035 142
212 3300003794 Ga0055531_10000366 Ga0055531_1000036618 142
213 3300005343 Ga0070687_100520001 Ga0070687_1005200012 142
214 3300005614 Ga0068856_101806093 Ga0068856_1018060932 142
215 3300005834 Ga0068851_10191010 Ga0068851_101910103 142
216 3300012502 Ga0157347_1044152 Ga0157347_10441522 142
217 3300025206 Ga0209435_100001 Ga0209435_100001878 142
218 3300025228 Ga0209672_101080 Ga0209672_10108011 142
219 3300025229 Ga0209147_102883 Ga0209147_1028835 142
220 3300025242 Ga0209258_100009 Ga0209258_100009199 142
221 3300025245 Ga0207425_1015793 Ga0207425_10157933 142
222 3300025246 Ga0209646_1000001 Ga0209646_10000011247 142
223 3300025250 Ga0209026_1000003 Ga0209026_1000003878 142
224 3300025254 Ga0209148_1000007 Ga0209148_1000007199 142
225 3300025256 Ga0209759_1000001 Ga0209759_1000001878 142
226 3300025263 Ga0209565_1000004 Ga0209565_1000004787 142
227 3300025273 Ga0209673_1000275 Ga0209673_10002757 142
228 3300025284 Ga0209130_1000368 Ga0209130_100036846 142
229 3300025291 Ga0209675_1000044 Ga0209675_1000044210 142
230 3300025292 Ga0209676_1000029 Ga0209676_1000029116 142
231 3300025294 Ga0209025_1039050 Ga0209025_10390503 142
232 3300025295 Ga0209564_1000356 Ga0209564_100035645 142
233 3300025297 Ga0209758_1062221 Ga0209758_10622212 142
234 3300025297 Ga0209758_1142133 Ga0209758_11421331 142
235 3300025298 Ga0209050_1000003 Ga0209050_1000003178 142
236 3300025298 Ga0209050_1000659 Ga0209050_100065917 142
237 3300025299 Ga0209256_1000001 Ga0209256_1000001181 142
238 3300025302 Ga0207426_1005625 Ga0207426_10056255 142
239 3300025303 Ga0209051_1000003 Ga0209051_1000003178 142
240 3300025303 Ga0209051_1012141 Ga0209051_10121412 142
241 3300025304 Ga0209257_1000018 Ga0209257_1000018178 142
242 3300025321 Ga0207656_10057494 Ga0207656_100574943 142
243 3300026078 Ga0207702_10619387 Ga0207702_106193872 142
244 3300028794 Ga0307515_10003072 Ga0307515_1000307222 142
245 3300041404 Ga0439436_0001553 Ga0439436_0001553_5355_5810 142
246 3300041406 Ga0439439_0017818 Ga0439439_0017818_1072_1527 142
247 3300041410 Ga0439461_0017902 Ga0439461_0017902_358_813 142
248 3300041411 Ga0439466_0023241 Ga0439466_0023241_679_1134 142
249 3300041413 Ga0439465_0000742 Ga0439465_0000742_962_1417 142
250 3300041453 Ga0451797_0442460 Ga0451797_0442460_27_485 142
251 3300041460 Ga0451802_0199705 Ga0451802_0199705_32_481 142
252 3300041486 Ga0451807_0059783 Ga0451807_0059783_263_721 142
253 3300041511 Ga0451855_0662111 Ga0451855_0662111_66_524 142
254 3300041512 Ga0451853_0435475 Ga0451853_0435475_480_938 142
255 3300041997 Ga0439431_0000629 Ga0439431_0000629_506_961 142
256 3300041999 Ga0439433_0008566 Ga0439433_0008566_899_1354 142
257 3300042002 Ga0439442_005571 Ga0439442_005571_903_1358 142
258 3300042004 Ga0439445_0004954 Ga0439445_0004954_1563_2018 142
259 3300042006 Ga0439432_004193 Ga0439432_004193_385_840 142
260 3300042007 Ga0439449_0007761 Ga0439449_0007761_882_1337 142
261 3300042010 Ga0439452_003292 Ga0439452_003292_891_1346 142
262 3300042014 Ga0439457_006836 Ga0439457_006836_998_1453 142
263 3300042015 Ga0439462_0005683 Ga0439462_0005683_2201_2656 142
264 3300042156 Ga0439446_0004804 Ga0439446_0004804_818_1273 142
265 3300042185 Ga0450909_048036 Ga0450909_048036_126_581 142
266 3300042435 Ga0439434_0001149 Ga0439434_0001149_4553_5008 142
267 3300053129 Ga0500628_007251 Ga0500628_007251_474_941 142
268 iso_pu_bacteria 2643221628 2644160349 142
269 iso_pu_bacteria 2643221658 2644324922 142
270 iso_pu_bacteria 2643221672 2644396791 142
271 iso_pu_bacteria 2842677519 2842680476 142
272 iso_pu_bacteria 2929520902 2929522248 142
273 iso_pu_bacteria 2945909444 2945910761 142
274 iso_pu_bacteria 2945972063 2945976364 142
275 iso_pu_bacteria 2945984333 2945987066 142
276 3300002773 JGI25152J39213_1008693 JGI25152J39213_10086932 143
277 3300002774 JGI25150J39212_1007481 JGI25150J39212_10074813 143
278 3300002987 JGI25159J45721_1015335 JGI25159J45721_10153352 143
279 3300003187 JGI25151J46595_10024131 JGI25151J46595_100241312 143
280 3300003215 JGI25153J46596_10020571 JGI25153J46596_100205714 143
281 3300003322 rootL2_10216050 rootL2_102160502 143
282 3300003354 JGI25160J50197_1016112 JGI25160J50197_10161122 143
283 3300003578 Ga0006562J51391_1068886 Ga0006562J51391_10688863 143
284 3300003771 Ga0055526_1013091 Ga0055526_10130913 143
285 3300003773 Ga0055537_1008016 Ga0055537_10080164 143
286 3300003775 Ga0055524_1007592 Ga0055524_10075925 143
287 3300003781 Ga0055536_1002335 Ga0055536_100233510 143
288 3300003784 Ga0055534_1007895 Ga0055534_10078952 143
289 3300003790 Ga0055528_1017522 Ga0055528_10175224 143
290 3300003791 Ga0055530_10001009 Ga0055530_100010094 143
291 3300003792 Ga0055540_1007680 Ga0055540_10076805 143
292 3300003794 Ga0055531_10014416 Ga0055531_100144163 143
293 3300004625 Ga0055543_1000734 Ga0055543_100073416 143
294 3300005262 Ga0065165_1031273 Ga0065165_10312732 143
295 3300005338 Ga0068868_100142599 Ga0068868_1001425993 143
296 3300005539 Ga0068853_100009092 Ga0068853_1000090926 143
297 3300005617 Ga0068859_100770119 Ga0068859_1007701192 143
298 3300005841 Ga0068863_100569881 Ga0068863_1005698813 143
299 3300005842 Ga0068858_100342685 Ga0068858_1003426853 143
300 3300006353 Ga0075370_10538808 Ga0075370_105388082 143
301 3300006931 Ga0097620_100770002 Ga0097620_1007700022 143
302 3300009098 Ga0105245_11194946 Ga0105245_111949462 143
303 3300009553 Ga0105249_10676030 Ga0105249_106760302 143
304 3300010375 Ga0105239_10524110 Ga0105239_105241103 143
305 3300011119 Ga0105246_10589611 Ga0105246_105896111 143
306 3300013104 Ga0157370_10465254 Ga0157370_104652542 143
307 3300015261 Ga0182006_1056913 Ga0182006_10569133 143
308 3300015262 Ga0182007_10079934 Ga0182007_100799342 143
309 3300025245 Ga0207425_1001945 Ga0207425_10019458 143
310 3300025258 Ga0209129_1012411 Ga0209129_10124113 143
311 3300025263 Ga0209565_1005477 Ga0209565_10054775 143
312 3300025273 Ga0209673_1000329 Ga0209673_100032979 143
313 3300025284 Ga0209130_1000429 Ga0209130_100042923 143
314 3300025284 Ga0209130_1001662 Ga0209130_100166212 143
315 3300025291 Ga0209675_1000791 Ga0209675_10007916 143
316 3300025292 Ga0209676_1000004 Ga0209676_1000004306 143
317 3300025295 Ga0209564_1001526 Ga0209564_10015267 143
318 3300025297 Ga0209758_1004956 Ga0209758_10049563 143
319 3300025298 Ga0209050_1000002 Ga0209050_1000002816 143
320 3300025299 Ga0209256_1000472 Ga0209256_100047249 143
321 3300025302 Ga0207426_1000095 Ga0207426_1000095156 143
322 3300025303 Ga0209051_1000002 Ga0209051_1000002584 143
323 3300025304 Ga0209257_1000002 Ga0209257_1000002725 143
324 3300025304 Ga0209257_1000286 Ga0209257_1000286103 143
325 3300025927 Ga0207687_10827051 Ga0207687_108270512 143
326 3300025933 Ga0207706_10899213 Ga0207706_108992132 143
327 3300026023 Ga0207677_10171696 Ga0207677_101716961 143
328 3300026035 Ga0207703_10278829 Ga0207703_102788291 143
329 3300026041 Ga0207639_10016199 Ga0207639_100161993 143
330 3300026088 Ga0207641_10261285 Ga0207641_102612852 143
331 3300048921 Ga0496118_0031565 Ga0496118_0031565_763_1230 143
332 3300048927 Ga0496124_0062766 Ga0496124_0062766_700_1167 143
333 3300053079 Ga0500610_0314758 Ga0500610_0314758_39_485 143
334 iso_pu_bacteria 2818991446 2819599925 143
335 iso_pu_bacteria 2899924645 2899926663 143
336 iso_pu_bacteria 2928037797 2928044251 143
337 iso_pu_bacteria 2928044640 2928048383 143
338 iso_pu_bacteria 2928051484 2928052349 143
339 iso_pu_bacteria 2928064002 2928064981 143
340 3300003578 Ga0006562J51391_1066545 Ga0006562J51391_10665452 144
341 3300003792 Ga0055540_1003160 Ga0055540_10031605 144
342 3300005539 Ga0068853_101317606 Ga0068853_1013176061 144
343 3300006177 Ga0075362_10003070 Ga0075362_100030705 144
344 3300006353 Ga0075370_10028995 Ga0075370_100289953 144
345 3300013100 Ga0157373_10032221 Ga0157373_100322212 144
346 3300013104 Ga0157370_10110003 Ga0157370_101100033 144
347 3300014497 Ga0182008_10065777 Ga0182008_100657772 144
348 3300014497 Ga0182008_10180430 Ga0182008_101804302 144
349 3300025303 Ga0209051_1000113 Ga0209051_100011358 144
350 3300026041 Ga0207639_10817116 Ga0207639_108171162 144
351 3300031548 Ga0307408_100003238 Ga0307408_1000032388 144
352 3300031649 Ga0307514_10007518 Ga0307514_100075189 144
353 3300031731 Ga0307405_10419751 Ga0307405_104197512 144
354 3300031901 Ga0307406_10004177 Ga0307406_100041774 144
355 3300031911 Ga0307412_10001515 Ga0307412_1000151510 144
356 3300041407 Ga0439447_014433 Ga0439447_014433_793_1260 144
357 3300046515 Ga0495620_0049238 Ga0495620_0049238_1216_1695 144
358 3300046518 Ga0495631_0000213 Ga0495631_0000213_24661_25140 144
359 3300046520 Ga0495637_0015117 Ga0495637_0015117_280_729 144
360 3300046539 Ga0495621_0021481 Ga0495621_0021481_1162_1641 144
361 3300046674 Ga0495588_0073008 Ga0495588_0073008_180_647 144
362 3300046691 Ga0495670_0017565 Ga0495670_0017565_252_701 144
363 3300050489 nmdc:mga03683_2343_c2 nmdc:mga03683_2343_c2_1972_2418 144
364 3300050496 nmdc:mga07m45_44155_c1 nmdc:mga07m45_44155_c1_117_587 144
365 3300053079 Ga0500610_0016274 Ga0500610_0016274_193_642 144
366 3300053118 Ga0500594_0003235 Ga0500594_0003235_1057_1536 144
367 3300053122 Ga0500608_013352 Ga0500608_013352_1045_1491 144
368 3300002773 JGI25152J39213_1005692 JGI25152J39213_10056924 145
369 3300002774 JGI25150J39212_1003638 JGI25150J39212_10036383 145
370 3300002987 JGI25159J45721_1011767 JGI25159J45721_10117673 145
371 3300003187 JGI25151J46595_10003810 JGI25151J46595_100038109 145
372 3300003187 JGI25151J46595_10004984 JGI25151J46595_100049846 145
373 3300003187 JGI25151J46595_10014158 JGI25151J46595_100141584 145
374 3300003215 JGI25153J46596_10012915 JGI25153J46596_100129154 145
375 3300003354 JGI25160J50197_1009623 JGI25160J50197_10096234 145
376 3300003374 JGI25161J50226_1007181 JGI25161J50226_10071812 145
377 3300003771 Ga0055526_1013005 Ga0055526_10130054 145
378 3300003773 Ga0055537_1005152 Ga0055537_10051524 145
379 3300003775 Ga0055524_1007501 Ga0055524_10075015 145
380 3300003784 Ga0055534_1005184 Ga0055534_10051844 145
381 3300003790 Ga0055528_1011269 Ga0055528_10112694 145
382 3300003792 Ga0055540_1011025 Ga0055540_10110251 145
383 3300003794 Ga0055531_10014477 Ga0055531_100144773 145
384 3300004625 Ga0055543_1001161 Ga0055543_100116111 145
385 3300005262 Ga0065165_1003617 Ga0065165_100361710 145
386 3300005457 Ga0070662_100365577 Ga0070662_1003655772 145
387 3300006048 Ga0075363_100067085 Ga0075363_1000670852 145
388 3300006177 Ga0075362_10001902 Ga0075362_100019026 145
389 3300006178 Ga0075367_10026891 Ga0075367_100268913 145
390 3300006195 Ga0075366_10062422 Ga0075366_100624223 145
391 3300006353 Ga0075370_10007301 Ga0075370_100073016 145
392 3300009036 Ga0105244_10000502 Ga0105244_100005028 145
393 3300009036 Ga0105244_10035841 Ga0105244_100358414 145
394 3300009098 Ga0105245_10516603 Ga0105245_105166032 145
395 3300009148 Ga0105243_10003756 Ga0105243_1000375611 145
396 3300009148 Ga0105243_10187338 Ga0105243_101873382 145
397 3300009174 Ga0105241_10846207 Ga0105241_108462071 145
398 3300009176 Ga0105242_10085806 Ga0105242_100858061 145
399 3300009551 Ga0105238_10199819 Ga0105238_101998192 145
400 3300010375 Ga0105239_10634025 Ga0105239_106340251 145
401 3300011119 Ga0105246_10404474 Ga0105246_104044742 145
402 3300014497 Ga0182008_10002006 Ga0182008_1000200610 145
403 3300015262 Ga0182007_10000238 Ga0182007_1000023830 145
404 3300017792 Ga0163161_10189527 Ga0163161_101895272 145
405 3300025208 Ga0209436_107788 Ga0209436_1077882 145
406 3300025245 Ga0207425_1000266 Ga0207425_100026615 145
407 3300025258 Ga0209129_1000013 Ga0209129_1000013447 145
408 3300025258 Ga0209129_1003830 Ga0209129_10038306 145
409 3300025263 Ga0209565_1000228 Ga0209565_100022843 145
410 3300025273 Ga0209673_1000309 Ga0209673_100030974 145
411 3300025284 Ga0209130_1000284 Ga0209130_100028424 145
412 3300025291 Ga0209675_1000238 Ga0209675_100023855 145
413 3300025292 Ga0209676_1003498 Ga0209676_10034986 145
414 3300025294 Ga0209025_1000155 Ga0209025_10001555 145
415 3300025294 Ga0209025_1000393 Ga0209025_100039327 145
416 3300025294 Ga0209025_1018473 Ga0209025_10184732 145
417 3300025295 Ga0209564_1000222 Ga0209564_1000222115 145
418 3300025297 Ga0209758_1000134 Ga0209758_1000134157 145
419 3300025299 Ga0209256_1000060 Ga0209256_1000060224 145
420 3300025302 Ga0207426_1000100 Ga0207426_1000100224 145
421 3300025303 Ga0209051_1014263 Ga0209051_10142632 145
422 3300025304 Ga0209257_1001890 Ga0209257_100189024 145
423 3300025935 Ga0207709_10101503 Ga0207709_101015032 145
424 3300030744 Ga0316181_1276434 Ga0316181_12764342 145
425 3300031548 Ga0307408_100186826 Ga0307408_1001868262 145
426 3300031731 Ga0307405_10074261 Ga0307405_100742613 145
427 3300031911 Ga0307412_10150105 Ga0307412_101501052 145
428 3300031911 Ga0307412_10356873 Ga0307412_103568732 145
429 3300032002 Ga0307416_100457423 Ga0307416_1004574232 145
430 3300041404 Ga0439436_0022471 Ga0439436_0022471_519_989 145
431 3300041408 Ga0439453_0176427 Ga0439453_0176427_23_493 145
432 3300041411 Ga0439466_0022338 Ga0439466_0022338_699_1169 145
433 3300041413 Ga0439465_0113659 Ga0439465_0113659_277_747 145
434 3300041999 Ga0439433_0009010 Ga0439433_0009010_994_1464 145
435 3300042002 Ga0439442_060905 Ga0439442_060905_226_696 145
436 3300042006 Ga0439432_004226 Ga0439432_004226_1991_2461 145
437 3300042007 Ga0439449_0003387 Ga0439449_0003387_2782_3252 145
438 3300042014 Ga0439457_102484 Ga0439457_102484_114_584 145
439 3300042015 Ga0439462_0017364 Ga0439462_0017364_1029_1499 145
440 3300042131 Ga0450894_004279 Ga0450894_004279_657_1127 145
441 3300042134 Ga0450898_050433 Ga0450898_050433_80_553 145
442 3300042135 Ga0450899_033330 Ga0450899_033330_87_557 145
443 3300042145 Ga0450906_013444 Ga0450906_013444_835_1305 145
444 3300042146 Ga0450907_016921 Ga0450907_016921_428_898 145
445 3300042156 Ga0439446_0030157 Ga0439446_0030157_69_539 145
446 3300046530 Ga0495654_0025029 Ga0495654_0025029_2521_2973 145
447 3300046616 Ga0495668_0294062 Ga0495668_0294062_357_830 145
448 3300046674 Ga0495588_0034286 Ga0495588_0034286_331_801 145
449 3300046692 Ga0495671_0019710 Ga0495671_0019710_162_614 145
450 3300046810 Ga0495660_0136534 Ga0495660_0136534_336_794 145
451 3300047321 Ga0495676_0003920 Ga0495676_0003920_11817_12287 145
452 3300047673 Ga0495593_0016801 Ga0495593_0016801_1043_1513 145
453 3300048088 Ga0495602_0102266 Ga0495602_0102266_1784_2254 145
454 3300048089 Ga0495614_0006647 Ga0495614_0006647_2161_2631 145
455 3300048919 Ga0496116_0016032 Ga0496116_0016032_2277_2729 145
456 3300048920 Ga0496117_0097036 Ga0496117_0097036_826_1272 145
457 3300048920 Ga0496117_0285045 Ga0496117_0285045_269_739 145
458 3300048921 Ga0496118_0026578 Ga0496118_0026578_3873_4319 145
459 3300048924 Ga0496121_0093851 Ga0496121_0093851_1344_1850 145
460 3300048924 Ga0496121_0537772 Ga0496121_0537772_151_621 145
461 3300048925 Ga0496122_0175360 Ga0496122_0175360_161_673 145
462 3300048925 Ga0496122_0216818 Ga0496122_0216818_112_585 145
463 3300048926 Ga0496123_0282932 Ga0496123_0282932_125_598 145
464 3300048928 Ga0496125_0045744 Ga0496125_0045744_785_1237 145
465 3300050493 nmdc:mga0k408_10327_c2 nmdc:mga0k408_10327_c2_826_1299 145
466 3300050493 nmdc:mga0k408_138126_c1 nmdc:mga0k408_138126_c1_968_1420 145
467 3300050494 nmdc:mga06z11_423866_c1 nmdc:mga06z11_423866_c1_50_502 145
468 3300050496 nmdc:mga07m45_20234_c1 nmdc:mga07m45_20234_c1_1018_1470 145
469 3300053079 Ga0500610_0008818 Ga0500610_0008818_3776_4228 145
470 3300053093 Ga0500651_0000189 Ga0500651_0000189_23994_24464 145
471 3300053094 Ga0500566_0045842 Ga0500566_0045842_728_1198 145
472 3300053110 Ga0500571_000045 Ga0500571_000045_14613_15083 145
473 3300053117 Ga0500593_014332 Ga0500593_014332_2712_3164 145
474 3300053120 Ga0500597_004697 Ga0500597_004697_2357_2851 145
475 3300053121 Ga0500607_002838 Ga0500607_002838_2848_3300 145
476 3300053123 Ga0500614_009430 Ga0500614_009430_227_721 145
477 3300053133 Ga0500655_001735 Ga0500655_001735_1333_1809 145
478 3300053134 Ga0500658_0000288 Ga0500658_0000288_14473_14943 145
479 3300053136 Ga0500559_0048729 Ga0500559_0048729_1176_1649 145
480 3300053141 Ga0500574_000524 Ga0500574_000524_3109_3579 145
481 3300053153 Ga0500616_0027608 Ga0500616_0027608_465_941 145
482 3300053154 Ga0500619_117727 Ga0500619_117727_378_848 145
483 3300053157 Ga0500624_004701 Ga0500624_004701_219_689 145
484 3300053158 Ga0500627_0036706 Ga0500627_0036706_1105_1557 145
485 3300053162 Ga0500638_068784 Ga0500638_068784_660_1136 145
486 3300053177 Ga0500636_0311274 Ga0500636_0311274_196_690 145
487 3300053178 Ga0500637_0158572 Ga0500637_0158572_164_658 145
488 iso_pu_bacteria 2738543012 2739246984 145
489 3300003781 Ga0055536_1006749 Ga0055536_10067495 146
490 3300003781 Ga0055536_1007454 Ga0055536_10074545 146
491 3300003792 Ga0055540_1000814 Ga0055540_10008145 146
492 3300003792 Ga0055540_1004863 Ga0055540_10048635 146
493 3300003794 Ga0055531_10006028 Ga0055531_100060287 146
494 3300003794 Ga0055531_10065219 Ga0055531_100652192 146
495 3300005288 Ga0065714_10008290 Ga0065714_100082906 146
496 3300006038 Ga0075365_10008398 Ga0075365_100083984 146
497 3300006051 Ga0075364_10053464 Ga0075364_100534643 146
498 3300006051 Ga0075364_10632834 Ga0075364_106328342 146
499 3300006058 Ga0075432_10003731 Ga0075432_100037315 146
500 3300006177 Ga0075362_10005583 Ga0075362_100055835 146
501 3300006177 Ga0075362_10042610 Ga0075362_100426103 146
502 3300006178 Ga0075367_10695906 Ga0075367_106959062 146
503 3300006948 Ga0099826_10072488 Ga0099826_100724882 146
504 3300009148 Ga0105243_10219506 Ga0105243_102195062 146
505 3300025273 Ga0209673_1003191 Ga0209673_10031913 146
506 3300025292 Ga0209676_1000162 Ga0209676_100016250 146
507 3300025292 Ga0209676_1000206 Ga0209676_100020627 146
508 3300025298 Ga0209050_1000512 Ga0209050_100051242 146
509 3300025303 Ga0209051_1000274 Ga0209051_100027492 146
510 3300025303 Ga0209051_1000311 Ga0209051_100031125 146
511 3300025304 Ga0209257_1000432 Ga0209257_100043271 146
512 3300025304 Ga0209257_1006446 Ga0209257_10064467 146
513 3300025935 Ga0207709_10000765 Ga0207709_100007655 146
514 3300025938 Ga0207704_10151467 Ga0207704_101514672 146
515 3300025972 Ga0207668_10610967 Ga0207668_106109672 146
516 3300026089 Ga0207648_10344594 Ga0207648_103445943 146
517 3300027666 Ga0209282_1067696 Ga0209282_10676962 146
518 3300027907 Ga0207428_10273130 Ga0207428_102731302 146
519 3300030731 Ga0316177_1063076 Ga0316177_10630762 146
520 3300030733 Ga0314311_1027081 Ga0314311_10270815 146
521 3300030735 Ga0316178_1129918 Ga0316178_11299182 146
522 3300030736 Ga0316180_1028766 Ga0316180_10287665 146
523 3300030742 Ga0316183_1073027 Ga0316183_10730279 146
524 3300030745 Ga0316182_1019128 Ga0316182_10191284 146
525 3300031548 Ga0307408_100242316 Ga0307408_1002423163 146
526 3300031824 Ga0307413_10486727 Ga0307413_104867272 146
527 3300031901 Ga0307406_10347585 Ga0307406_103475852 146
528 3300031901 Ga0307406_11327876 Ga0307406_113278761 146
529 3300031911 Ga0307412_10083720 Ga0307412_100837203 146
530 3300032002 Ga0307416_100305808 Ga0307416_1003058082 146
531 3300032002 Ga0307416_100376140 Ga0307416_1003761402 146
532 3300032004 Ga0307414_10420514 Ga0307414_104205142 146
533 3300032005 Ga0307411_10145911 Ga0307411_101459112 146
534 3300041405 Ga0439438_120254 Ga0439438_120254_79_543 146
535 3300042002 Ga0439442_001238 Ga0439442_001238_1183_1647 146
536 3300042007 Ga0439449_0166328 Ga0439449_0166328_158_622 146
537 3300042121 Ga0450919_010907 Ga0450919_010907_552_1016 146
538 3300042128 Ga0450897_031878 Ga0450897_031878_67_531 146
539 3300042134 Ga0450898_035011 Ga0450898_035011_167_655 146
540 3300042134 Ga0450898_118575 Ga0450898_118575_49_537 146
541 3300042145 Ga0450906_028018 Ga0450906_028018_450_914 146
542 3300042184 Ga0450908_001834 Ga0450908_001834_276_740 146
543 3300042435 Ga0439434_0025836 Ga0439434_0025836_140_604 146
544 3300042531 Ga0450918_013312 Ga0450918_013312_176_640 146
545 3300044683 Ga0466965_0050591 Ga0466965_0050591_49_519 146
546 3300044901 Ga0466960_0066357 Ga0466960_0066357_1113_1583 146
547 3300046660 Ga0495625_0000057 Ga0495625_0000057_37369_37833 146
548 3300049705 Ga0501225_0005947 Ga0501225_0005947_1962_2417 146
549 3300049759 Ga0501262_000600 Ga0501262_000600_860_1315 146
550 3300050489 nmdc:mga03683_25557_c1 nmdc:mga03683_25557_c1_952_1416 146
551 3300050490 nmdc:mga03n38_311727_c1 nmdc:mga03n38_311727_c1_204_668 146
552 3300050491 nmdc:mga00v17_116241_c1 nmdc:mga00v17_116241_c1_865_1326 146
553 3300050491 nmdc:mga00v17_98016_c1 nmdc:mga00v17_98016_c1_339_803 146
554 3300050492 nmdc:mga0yw44_52589_c1 nmdc:mga0yw44_52589_c1_1982_2446 146
555 3300050493 nmdc:mga0k408_85111_c1 nmdc:mga0k408_85111_c1_235_699 146
556 3300050494 nmdc:mga06z11_256770_c1 nmdc:mga06z11_256770_c1_468_932 146
557 3300050516 nmdc:mga0sz30_407319_c1 nmdc:mga0sz30_407319_c1_77_562 146
558 3300025933 Ga0207706_10001106 Ga0207706_1000110621 147
559 3300026075 Ga0207708_10706978 Ga0207708_107069782 147
560 3300026142 Ga0207698_10087597 Ga0207698_100875974 147
561 iso_pu_bacteria 2599185178 2599444230 147
562 iso_pu_bacteria 2900577576 2900579431 147
563 iso_pu_bacteria 2904541872 2904548704 147
564 iso_pu_bacteria 2929160207 2929164630 147
565 3300050493 nmdc:mga0k408_6552_c1 nmdc:mga0k408_6552_c1_5638_6132 148
566 3300003187 JGI25151J46595_10056192 JGI25151J46595_100561922 149
567 3300025294 Ga0209025_1000133 Ga0209025_10001335 149
568 3300050493 nmdc:mga0k408_138650_c1 nmdc:mga0k408_138650_c1_865_1362 149
569 3300001979 JGI24740J21852_10000867 JGI24740J21852_1000086712 151
570 3300003751 Ga0055538_1006381 Ga0055538_10063812 151
571 3300003751 Ga0055538_1006418 Ga0055538_10064182 151
572 3300003752 Ga0055539_1000062 Ga0055539_10000623 151
573 3300003758 Ga0055532_1000019 Ga0055532_1000019259 151
574 3300003759 Ga0055525_1001977 Ga0055525_10019772 151
575 3300003760 Ga0055527_1001936 Ga0055527_10019363 151
576 3300003761 Ga0055535_1000014 Ga0055535_100001422 151
577 3300003763 Ga0055529_1000086 Ga0055529_10000863 151
578 3300003763 Ga0055529_1000368 Ga0055529_100036838 151
579 3300005344 Ga0070661_100000088 Ga0070661_10000008821 151
580 3300005455 Ga0070663_100000010 Ga0070663_1000000108 151
581 3300005564 Ga0070664_100000005 Ga0070664_100000005195 151
582 3300005577 Ga0068857_100077103 Ga0068857_1000771034 151
583 3300005578 Ga0068854_100000104 Ga0068854_10000010459 151
584 3300005614 Ga0068856_100000054 Ga0068856_1000000548 151
585 3300009093 Ga0105240_10012374 Ga0105240_100123744 151
586 3300013100 Ga0157373_10002976 Ga0157373_100029765 151
587 3300013102 Ga0157371_10000103 Ga0157371_10000103106 151
588 3300013104 Ga0157370_10000513 Ga0157370_1000051323 151
589 3300013105 Ga0157369_10010547 Ga0157369_100105477 151
590 3300013307 Ga0157372_10000461 Ga0157372_100004619 151
591 3300015261 Ga0182006_1006704 Ga0182006_10067048 151
592 3300020077 Ga0206351_10043555 Ga0206351_100435552 151
593 3300020610 Ga0154015_1157234 Ga0154015_11572342 151
594 3300025224 Ga0209784_100003 Ga0209784_1000031253 151
595 3300025225 Ga0209566_100002 Ga0209566_1000022207 151
596 3300025225 Ga0209566_100785 Ga0209566_10078516 151
597 3300025226 Ga0209674_100094 Ga0209674_10009424 151
598 3300025226 Ga0209674_102222 Ga0209674_1022225 151
599 3300025228 Ga0209672_100408 Ga0209672_10040825 151
600 3300025229 Ga0209147_100002 Ga0209147_1000021160 151
601 3300025230 Ga0209563_100004 Ga0209563_1000041624 151
602 3300025242 Ga0209258_100002 Ga0209258_1000021160 151
603 3300025253 Ga0209677_100009 Ga0209677_1000098 151
604 3300025254 Ga0209148_1003163 Ga0209148_10031634 151
605 3300025256 Ga0209759_1002059 Ga0209759_100205910 151
606 3300025256 Ga0209759_1002381 Ga0209759_10023814 151
607 3300025272 Ga0209455_1000076 Ga0209455_1000076257 151
608 3300025913 Ga0207695_10002145 Ga0207695_1000214516 151
609 3300025920 Ga0207649_10000098 Ga0207649_1000009858 151
610 3300025945 Ga0207679_10000020 Ga0207679_10000020188 151
611 3300025981 Ga0207640_10000092 Ga0207640_1000009268 151
612 3300026067 Ga0207678_10000181 Ga0207678_1000018142 151
613 3300026078 Ga0207702_10000017 Ga0207702_10000017188 151
614 3300026116 Ga0207674_10137420 Ga0207674_101374203 151
615 3300037418 Ga0395900_0031258 Ga0395900_0031258_2258_2713 151
616 3300048928 Ga0496125_0021624 Ga0496125_0021624_756_1211 151

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00376

MerR

MerR family regulatory protein

2

39

0.99

PF13411

MerR_1

MerR HTH family regulatory protein

1

69

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dg6-assembly1.cif.gz_A-2 crystal structure of the putative transcriptional regulator sco5550 from streptomyces coelicolor a3(2) 0.8822 9 78
5i44-assembly4.cif.gz_E structure of raca-dna complex; p21 form 0.8681 8 69
7npe-assembly1.cif.gz_B vibrio cholerae para2-adp 0.8477 8 55
5i44-assembly4.cif.gz_I-2 structure of raca-dna complex; p21 form 0.8454 9 69
5i44-assembly4.cif.gz_G-2 structure of raca-dna complex; p21 form 0.8427 7 71
ID Description Score Start End Superfamily
af_O06302_4_79_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8846 8 73 1.10.1660.10
3hh0D01 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8821 9 76 1.10.1660.10
3hh0C01 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8591 9 73 1.10.1660.10
5i44J00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.857 8 69 1.10.1660.10
3hh0B01 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8551 8 73 1.10.1660.10
ID Description Score Start End GO Terms
AF-A0A2N3JBU2-F1-model_v4 deleted 0.9714 8 106
AF-A0A4Q2IKR1-F1-model_v4 deleted 0.9381 9 91
AF-X2JTA8-F1-model_v4 deleted 0.9272 9 95
AF-A0A174E158-F1-model_v4 Putative transcriptional regulator 0.9207 8 126 GO:0003677
GO:0003700
AF-A0A4Q2IKR1-F1-model_v4 deleted 0.9173 9 91

Feature Viewer

pLDDT pTM Quality
87.6 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map