F469513
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 616 | 370 | 577 | 152 |
Family's Representative Sequence
| Representative Sequence | 3300005338|Ga0068868_100142599|Ga0068868_1001425993 |
| Length | 174 |
| Sequence | VKIGELSSRSGRSIHAIRWYEAQGLIPGVERDPGGRRVYTDLHVGWLDLMDRLRRTGMTIAQMREYTALVRKGRGTLDERHALLTAHRTRVRNTIAEWTTALELIQSKIDYYGEWLATGERPRQPRGVTPNSARKARVKFDTSPKPQSSATSTILPGASVNRAAASRSRARSTY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 2 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 3 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 4 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 5 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 6 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 7 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 8 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 9 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 10 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 11 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 12 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 13 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 14 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 15 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 16 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 17 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 18 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 19 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 20 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 21 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 22 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 23 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 24 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 25 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 26 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 27 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 28 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 29 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 30 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 31 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 32 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 33 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 34 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 35 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 36 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 37 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 38 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 39 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 40 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 41 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 42 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 43 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 44 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 45 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 46 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 47 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 48 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 49 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 50 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 51 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 52 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 53 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 54 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 55 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 56 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 57 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 58 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 59 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 60 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 61 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 62 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 63 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 64 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 65 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 66 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 67 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 68 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 69 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 70 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 71 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 72 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 73 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 74 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 75 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 77 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 79 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 80 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 85 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 94 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 96 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 98 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 99 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 100 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 101 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 102 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 103 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 104 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 105 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 106 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 107 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 108 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 109 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 110 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 111 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 112 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 113 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 114 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 115 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 116 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 117 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 118 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 120 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 136 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 145 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 148 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 149 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 151 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 152 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 153 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 163 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 164 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 167 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 168 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 172 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 174 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 177 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 180 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 220 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 221 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 224 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 225 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 226 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 227 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 228 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 229 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 230 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 231 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 232 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 233 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 234 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 235 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 236 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 237 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 238 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 239 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 240 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 241 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 242 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 243 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 244 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 245 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 246 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 247 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 248 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 249 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 250 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 251 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 252 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 253 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 254 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 255 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 256 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 257 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 258 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 259 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 260 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 261 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 262 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 263 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 264 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 265 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 266 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 267 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 268 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 269 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 270 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 271 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 272 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 273 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 274 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 275 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 276 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 277 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 278 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 279 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 280 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 281 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 282 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 283 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 284 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 285 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 286 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 287 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 288 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 312 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 313 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 314 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 315 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 316 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 317 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 320 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 321 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 322 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 323 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 324 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 325 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 326 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 327 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 328 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 329 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 330 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 331 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 332 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 333 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 334 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 335 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 336 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 337 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 338 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 339 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 340 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 341 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 342 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 344 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 345 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 346 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 347 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 348 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 349 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 350 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 351 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 352 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 353 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 354 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 355 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 356 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 357 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 358 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 359 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 360 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 361 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 362 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 363 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 364 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 365 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 366 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 367 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 368 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 369 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 370 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.02 |
| Metatranscriptomes | 0.65 |
| Isolates | 6.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 36.85 |
| Nodule | 0.81 |
| Rhizoplane | 3.9 |
| Rhizosphere | 47.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000867 | 3300001979 | Bacteria | 13368 |
| 2 | JGI25156J39149_1000025 | 3300002705 | Bacteria | 136287 |
| 3 | JGI25154J39366_1000045 | 3300002738 | Bacteria | 136302 |
| 4 | JGI25157J39369_1000034 | 3300002741 | Bacteria | 136301 |
| 5 | JGI25152J39213_1005692 | 3300002773 | Bacteria | 3566 |
| 6 | JGI25152J39213_1008693 | 3300002773 | Bacteria | 2492 |
| 7 | JGI25150J39212_1003638 | 3300002774 | Bacteria | 3578 |
| 8 | JGI25150J39212_1007481 | 3300002774 | Bacteria | 2189 |
| 9 | JGI25159J45721_1011767 | 3300002987 | Bacteria | 2123 |
| 10 | JGI25159J45721_1015335 | 3300002987 | Bacteria | 1684 |
| 11 | JGI25159J45721_1016993 | 3300002987 | Bacteria | 1525 |
| 12 | JGI25151J46595_10003810 | 3300003187 | Bacteria | 8177 |
| 13 | JGI25151J46595_10004984 | 3300003187 | Bacteria | 6923 |
| 14 | JGI25151J46595_10014158 | 3300003187 | Bacteria | 3566 |
| 15 | JGI25151J46595_10024131 | 3300003187 | Bacteria | 2492 |
| 16 | JGI25151J46595_10056192 | 3300003187 | Bacteria | 1292 |
| 17 | JGI25153J46596_10012915 | 3300003215 | Bacteria | 3566 |
| 18 | JGI25153J46596_10020571 | 3300003215 | Bacteria | 2492 |
| 19 | rootH1_10020532 | 3300003316 | Bacteria | 9390 |
| 20 | rootL2_10070810 | 3300003322 | Bacteria | 3675 |
| 21 | rootL2_10216050 | 3300003322 | Bacteria | 1174 |
| 22 | JGI25160J50197_1009623 | 3300003354 | Bacteria | 3566 |
| 23 | JGI25160J50197_1016112 | 3300003354 | Bacteria | 2420 |
| 24 | JGI25160J50197_1033700 | 3300003354 | Bacteria | 1283 |
| 25 | JGI25161J50226_1007181 | 3300003374 | Bacteria | 1903 |
| 26 | Ga0006562J51391_1066545 | 3300003578 | Bacteria | 1320 |
| 27 | Ga0006562J51391_1068886 | 3300003578 | Bacteria | 2330 |
| 28 | Ga0055538_1006381 | 3300003751 | Bacteria | 1148 |
| 29 | Ga0055538_1006418 | 3300003751 | Bacteria | 1142 |
| 30 | Ga0055539_1000062 | 3300003752 | Bacteria | 141171 |
| 31 | Ga0055532_1000019 | 3300003758 | Bacteria | 286358 |
| 32 | Ga0055525_1001977 | 3300003759 | Bacteria | 2556 |
| 33 | Ga0055527_1001936 | 3300003760 | Bacteria | 3828 |
| 34 | Ga0055535_1000014 | 3300003761 | Bacteria | 286358 |
| 35 | Ga0055535_1000383 | 3300003761 | Bacteria | 41879 |
| 36 | Ga0055542_1000268 | 3300003762 | Bacteria | 58408 |
| 37 | Ga0055542_1004558 | 3300003762 | Bacteria | 3329 |
| 38 | Ga0055529_1000086 | 3300003763 | Bacteria | 140681 |
| 39 | Ga0055529_1000368 | 3300003763 | Bacteria | 48910 |
| 40 | Ga0055526_1000306 | 3300003771 | Bacteria | 40960 |
| 41 | Ga0055526_1013005 | 3300003771 | Bacteria | 3566 |
| 42 | Ga0055526_1013091 | 3300003771 | Bacteria | 3545 |
| 43 | Ga0055537_1000008 | 3300003773 | Bacteria | 142572 |
| 44 | Ga0055537_1005152 | 3300003773 | Bacteria | 3566 |
| 45 | Ga0055537_1008016 | 3300003773 | Bacteria | 2478 |
| 46 | Ga0055524_1000075 | 3300003775 | Bacteria | 121897 |
| 47 | Ga0055524_1007501 | 3300003775 | Bacteria | 4620 |
| 48 | Ga0055524_1007592 | 3300003775 | Bacteria | 4586 |
| 49 | Ga0055536_1001446 | 3300003781 | Bacteria | 14300 |
| 50 | Ga0055536_1002335 | 3300003781 | Bacteria | 10735 |
| 51 | Ga0055536_1006749 | 3300003781 | Bacteria | 5261 |
| 52 | Ga0055536_1007454 | 3300003781 | Bacteria | 4893 |
| 53 | Ga0055534_1005184 | 3300003784 | Bacteria | 3566 |
| 54 | Ga0055534_1007851 | 3300003784 | Bacteria | 2486 |
| 55 | Ga0055534_1007895 | 3300003784 | Bacteria | 2473 |
| 56 | Ga0055528_1001296 | 3300003790 | Bacteria | 15695 |
| 57 | Ga0055528_1011269 | 3300003790 | Bacteria | 3566 |
| 58 | Ga0055528_1017522 | 3300003790 | Bacteria | 2478 |
| 59 | Ga0055530_10000152 | 3300003791 | Bacteria | 62435 |
| 60 | Ga0055530_10001009 | 3300003791 | Bacteria | 22509 |
| 61 | Ga0055540_1000160 | 3300003792 | Bacteria | 66881 |
| 62 | Ga0055540_1000814 | 3300003792 | Bacteria | 21128 |
| 63 | Ga0055540_1003160 | 3300003792 | Bacteria | 8132 |
| 64 | Ga0055540_1004863 | 3300003792 | Bacteria | 5885 |
| 65 | Ga0055540_1007680 | 3300003792 | Bacteria | 4021 |
| 66 | Ga0055540_1011025 | 3300003792 | Bacteria | 2952 |
| 67 | Ga0055531_10000366 | 3300003794 | Bacteria | 43612 |
| 68 | Ga0055531_10006028 | 3300003794 | Bacteria | 6954 |
| 69 | Ga0055531_10014416 | 3300003794 | Bacteria | 3558 |
| 70 | Ga0055531_10014477 | 3300003794 | Bacteria | 3546 |
| 71 | Ga0055531_10065219 | 3300003794 | Bacteria | 867 |
| 72 | Ga0055543_1000734 | 3300004625 | Bacteria | 16608 |
| 73 | Ga0055543_1001161 | 3300004625 | Bacteria | 11225 |
| 74 | Ga0065165_1003617 | 3300005262 | Bacteria | 10609 |
| 75 | Ga0065165_1031273 | 3300005262 | Bacteria | 1684 |
| 76 | Ga0065714_10008290 | 3300005288 | Bacteria | 7301 |
| 77 | Ga0065712_10595516 | 3300005290 | Bacteria | 593 |
| 78 | Ga0070670_100276236 | 3300005331 | Archaea | 1467 |
| 79 | Ga0070670_100590390 | 3300005331 | Bacteria | 993 |
| 80 | Ga0068869_100230951 | 3300005334 | Unclassified | 1470 |
| 81 | Ga0068869_100830546 | 3300005334 | Bacteria | 796 |
| 82 | Ga0070666_10810818 | 3300005335 | Bacteria | 690 |
| 83 | Ga0068868_100142599 | 3300005338 | Bacteria | 1968 |
| 84 | Ga0070689_100132009 | 3300005340 | Bacteria | 2003 |
| 85 | Ga0070687_100520001 | 3300005343 | Unclassified | 804 |
| 86 | Ga0070661_100000088 | 3300005344 | Bacteria | 73636 |
| 87 | Ga0070668_100047565 | 3300005347 | Bacteria | 3298 |
| 88 | Ga0070675_100389162 | 3300005354 | Bacteria | 1242 |
| 89 | Ga0070688_100002411 | 3300005365 | Bacteria | 9438 |
| 90 | Ga0070659_101131936 | 3300005366 | Bacteria | 691 |
| 91 | Ga0070667_100146495 | 3300005367 | Bacteria | 2071 |
| 92 | Ga0070663_100000010 | 3300005455 | Bacteria | 158193 |
| 93 | Ga0070663_100123233 | 3300005455 | Bacteria | 1960 |
| 94 | Ga0070662_100365577 | 3300005457 | Bacteria | 1185 |
| 95 | Ga0070707_100757935 | 3300005468 | Bacteria | 934 |
| 96 | Ga0070698_100480756 | 3300005471 | Bacteria | 1179 |
| 97 | Ga0070699_100307448 | 3300005518 | Bacteria | 1423 |
| 98 | Ga0070697_100317135 | 3300005536 | Bacteria | 1342 |
| 99 | Ga0068853_100009092 | 3300005539 | Bacteria | 8000 |
| 100 | Ga0068853_100091338 | 3300005539 | Bacteria | 2678 |
| 101 | Ga0068853_101317606 | 3300005539 | Bacteria | 698 |
| 102 | Ga0070665_100161660 | 3300005548 | Bacteria | 2241 |
| 103 | Ga0068855_100230582 | 3300005563 | Bacteria | 2074 |
| 104 | Ga0070664_100000005 | 3300005564 | Bacteria | 222746 |
| 105 | Ga0070664_100368650 | 3300005564 | Unclassified | 1309 |
| 106 | Ga0068857_100077103 | 3300005577 | Bacteria | 2973 |
| 107 | Ga0068857_100709494 | 3300005577 | Bacteria | 956 |
| 108 | Ga0068854_100000104 | 3300005578 | Bacteria | 58909 |
| 109 | Ga0068854_100174713 | 3300005578 | Bacteria | 1674 |
| 110 | Ga0068856_100000054 | 3300005614 | Bacteria | 104246 |
| 111 | Ga0068856_101806093 | 3300005614 | Bacteria | 623 |
| 112 | Ga0068852_100774216 | 3300005616 | Bacteria | 973 |
| 113 | Ga0068859_100625692 | 3300005617 | Bacteria | 1169 |
| 114 | Ga0068859_100770119 | 3300005617 | Bacteria | 1051 |
| 115 | Ga0068851_10191010 | 3300005834 | Bacteria | 1139 |
| 116 | Ga0068851_10402427 | 3300005834 | Bacteria | 806 |
| 117 | Ga0068863_100569881 | 3300005841 | Unclassified | 1119 |
| 118 | Ga0068858_100169772 | 3300005842 | Bacteria | 2056 |
| 119 | Ga0068858_100187143 | 3300005842 | Bacteria | 1956 |
| 120 | Ga0068858_100342685 | 3300005842 | Bacteria | 1431 |
| 121 | Ga0068860_100198503 | 3300005843 | Bacteria | 1943 |
| 122 | Ga0081455_10001755 | 3300005937 | Bacteria | 26202 |
| 123 | Ga0075365_10008398 | 3300006038 | Bacteria | 5859 |
| 124 | Ga0075368_10050901 | 3300006042 | Bacteria | 1646 |
| 125 | Ga0075363_100067085 | 3300006048 | Bacteria | 1943 |
| 126 | Ga0075363_100082586 | 3300006048 | Bacteria | 1759 |
| 127 | Ga0075364_10010862 | 3300006051 | Bacteria | 5515 |
| 128 | Ga0075364_10053464 | 3300006051 | Bacteria | 2640 |
| 129 | Ga0075364_10632834 | 3300006051 | Bacteria | 731 |
| 130 | Ga0075432_10003731 | 3300006058 | Bacteria | 5186 |
| 131 | Ga0075362_10001902 | 3300006177 | Bacteria | 6853 |
| 132 | Ga0075362_10003070 | 3300006177 | Bacteria | 5749 |
| 133 | Ga0075362_10005583 | 3300006177 | Bacteria | 4615 |
| 134 | Ga0075362_10033912 | 3300006177 | Bacteria | 2223 |
| 135 | Ga0075362_10042610 | 3300006177 | Bacteria | 2007 |
| 136 | Ga0075367_10026891 | 3300006178 | Bacteria | 3268 |
| 137 | Ga0075367_10695906 | 3300006178 | Bacteria | 646 |
| 138 | Ga0075366_10019514 | 3300006195 | Bacteria | 3924 |
| 139 | Ga0075366_10062422 | 3300006195 | Bacteria | 2214 |
| 140 | Ga0075370_10007301 | 3300006353 | Bacteria | 5627 |
| 141 | Ga0075370_10028995 | 3300006353 | Bacteria | 3080 |
| 142 | Ga0075370_10122982 | 3300006353 | Bacteria | 1512 |
| 143 | Ga0075370_10232692 | 3300006353 | Bacteria | 1090 |
| 144 | Ga0075370_10538808 | 3300006353 | Bacteria | 706 |
| 145 | Ga0075434_100071863 | 3300006871 | Bacteria | 3452 |
| 146 | Ga0075429_100161567 | 3300006880 | Unclassified | 1962 |
| 147 | Ga0097620_100625692 | 3300006931 | Bacteria | 1169 |
| 148 | Ga0097620_100770002 | 3300006931 | Bacteria | 1051 |
| 149 | Ga0099826_10072488 | 3300006948 | Bacteria | 2180 |
| 150 | Ga0105251_10154943 | 3300009011 | Unclassified | 1034 |
| 151 | Ga0105244_10000502 | 3300009036 | Bacteria | 35162 |
| 152 | Ga0105244_10035841 | 3300009036 | Bacteria | 2604 |
| 153 | Ga0105240_10012374 | 3300009093 | Bacteria | 11782 |
| 154 | Ga0105240_10355025 | 3300009093 | Bacteria | 1662 |
| 155 | Ga0111539_10843243 | 3300009094 | Bacteria | 1066 |
| 156 | Ga0105245_10516603 | 3300009098 | Bacteria | 1212 |
| 157 | Ga0105245_11194946 | 3300009098 | Unclassified | 808 |
| 158 | Ga0105247_10049784 | 3300009101 | Bacteria | 2577 |
| 159 | Ga0105243_10003756 | 3300009148 | Bacteria | 12171 |
| 160 | Ga0105243_10187338 | 3300009148 | Bacteria | 1804 |
| 161 | Ga0105243_10219506 | 3300009148 | Bacteria | 1680 |
| 162 | Ga0105241_10846207 | 3300009174 | Bacteria | 846 |
| 163 | Ga0105242_10085806 | 3300009176 | Bacteria | 2641 |
| 164 | Ga0105248_10008984 | 3300009177 | Bacteria | 10986 |
| 165 | Ga0105248_10299497 | 3300009177 | Bacteria | 1811 |
| 166 | Ga0105237_10063112 | 3300009545 | Bacteria | 3702 |
| 167 | Ga0105238_10105988 | 3300009551 | Bacteria | 2793 |
| 168 | Ga0105238_10199819 | 3300009551 | Bacteria | 1974 |
| 169 | Ga0105249_10416810 | 3300009553 | Bacteria | 1376 |
| 170 | Ga0105249_10676030 | 3300009553 | Unclassified | 1091 |
| 171 | Ga0105239_10501561 | 3300010375 | Bacteria | 1380 |
| 172 | Ga0105239_10524110 | 3300010375 | Bacteria | 1348 |
| 173 | Ga0105239_10634025 | 3300010375 | Bacteria | 1220 |
| 174 | Ga0105246_10009041 | 3300011119 | Bacteria | 6135 |
| 175 | Ga0105246_10404474 | 3300011119 | Bacteria | 1134 |
| 176 | Ga0105246_10589611 | 3300011119 | Archaea | 959 |
| 177 | Ga0157347_1044152 | 3300012502 | Bacteria | 597 |
| 178 | Ga0157373_10002976 | 3300013100 | Bacteria | 12826 |
| 179 | Ga0157373_10032221 | 3300013100 | Bacteria | 3773 |
| 180 | Ga0157371_10000103 | 3300013102 | Bacteria | 128611 |
| 181 | Ga0157371_10846635 | 3300013102 | Bacteria | 691 |
| 182 | Ga0157370_10000513 | 3300013104 | Bacteria | 48371 |
| 183 | Ga0157370_10110003 | 3300013104 | Bacteria | 2576 |
| 184 | Ga0157370_10465254 | 3300013104 | Bacteria | 1162 |
| 185 | Ga0157369_10010547 | 3300013105 | Bacteria | 10515 |
| 186 | Ga0157374_10120941 | 3300013296 | Bacteria | 2527 |
| 187 | Ga0163162_11303833 | 3300013306 | Bacteria | 825 |
| 188 | Ga0157372_10000461 | 3300013307 | Bacteria | 44748 |
| 189 | Ga0163163_10080599 | 3300014325 | Bacteria | 3255 |
| 190 | Ga0163163_10144861 | 3300014325 | Unclassified | 2419 |
| 191 | Ga0182008_10002006 | 3300014497 | Bacteria | 13064 |
| 192 | Ga0182008_10065777 | 3300014497 | Bacteria | 1783 |
| 193 | Ga0182008_10180430 | 3300014497 | Bacteria | 1068 |
| 194 | Ga0157379_10037027 | 3300014968 | Bacteria | 4350 |
| 195 | Ga0157379_10091543 | 3300014968 | Bacteria | 2728 |
| 196 | Ga0157376_11944773 | 3300014969 | Bacteria | 625 |
| 197 | Ga0182006_1006704 | 3300015261 | Bacteria | 5324 |
| 198 | Ga0182006_1056913 | 3300015261 | Bacteria | 1488 |
| 199 | Ga0182007_10000238 | 3300015262 | Bacteria | 37140 |
| 200 | Ga0182007_10079934 | 3300015262 | Bacteria | 1072 |
| 201 | Ga0163161_10189527 | 3300017792 | Bacteria | 1580 |
| 202 | Ga0206351_10043555 | 3300020077 | Bacteria | 3163 |
| 203 | Ga0154015_1157234 | 3300020610 | Bacteria | 8841 |
| 204 | Ga0209435_100001 | 3300025206 | Bacteria | 1424171 |
| 205 | Ga0209436_107788 | 3300025208 | Bacteria | 2199 |
| 206 | Ga0209784_100003 | 3300025224 | Bacteria | 1379451 |
| 207 | Ga0209566_100002 | 3300025225 | Bacteria | 2614868 |
| 208 | Ga0209566_100785 | 3300025225 | Bacteria | 16803 |
| 209 | Ga0209674_100094 | 3300025226 | Bacteria | 169506 |
| 210 | Ga0209674_102222 | 3300025226 | Bacteria | 4307 |
| 211 | Ga0209672_100408 | 3300025228 | Bacteria | 25493 |
| 212 | Ga0209672_101080 | 3300025228 | Bacteria | 11613 |
| 213 | Ga0209147_100002 | 3300025229 | Bacteria | 2158988 |
| 214 | Ga0209147_102883 | 3300025229 | Bacteria | 3783 |
| 215 | Ga0209563_100004 | 3300025230 | Bacteria | 1814108 |
| 216 | Ga0209258_100002 | 3300025242 | Bacteria | 2158988 |
| 217 | Ga0209258_100009 | 3300025242 | Bacteria | 996276 |
| 218 | Ga0207425_1000266 | 3300025245 | Bacteria | 38532 |
| 219 | Ga0207425_1001945 | 3300025245 | Bacteria | 7777 |
| 220 | Ga0207425_1015793 | 3300025245 | Bacteria | 1687 |
| 221 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 222 | Ga0209026_1000003 | 3300025250 | Bacteria | 1060571 |
| 223 | Ga0209026_1026886 | 3300025250 | Bacteria | 863 |
| 224 | Ga0209677_100009 | 3300025253 | Bacteria | 749530 |
| 225 | Ga0209148_1000007 | 3300025254 | Bacteria | 1592273 |
| 226 | Ga0209148_1000493 | 3300025254 | Bacteria | 40546 |
| 227 | Ga0209148_1003163 | 3300025254 | Bacteria | 4744 |
| 228 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 229 | Ga0209759_1002059 | 3300025256 | Bacteria | 9429 |
| 230 | Ga0209759_1002381 | 3300025256 | Bacteria | 8347 |
| 231 | Ga0209129_1000013 | 3300025258 | Bacteria | 524874 |
| 232 | Ga0209129_1003830 | 3300025258 | Bacteria | 6281 |
| 233 | Ga0209129_1012411 | 3300025258 | Bacteria | 1956 |
| 234 | Ga0209233_1032562 | 3300025261 | Bacteria | 1204 |
| 235 | Ga0209565_1000004 | 3300025263 | Bacteria | 983150 |
| 236 | Ga0209565_1000228 | 3300025263 | Bacteria | 61687 |
| 237 | Ga0209565_1005477 | 3300025263 | Bacteria | 3688 |
| 238 | Ga0209455_1000076 | 3300025272 | Bacteria | 284092 |
| 239 | Ga0209455_1002659 | 3300025272 | Bacteria | 6735 |
| 240 | Ga0209455_1049890 | 3300025272 | Bacteria | 591 |
| 241 | Ga0209673_1000275 | 3300025273 | Bacteria | 96728 |
| 242 | Ga0209673_1000309 | 3300025273 | Bacteria | 90058 |
| 243 | Ga0209673_1000329 | 3300025273 | Bacteria | 87170 |
| 244 | Ga0209673_1003191 | 3300025273 | Bacteria | 9956 |
| 245 | Ga0209130_1000284 | 3300025284 | Bacteria | 62277 |
| 246 | Ga0209130_1000368 | 3300025284 | Bacteria | 51152 |
| 247 | Ga0209130_1000429 | 3300025284 | Bacteria | 45047 |
| 248 | Ga0209130_1001662 | 3300025284 | Bacteria | 13593 |
| 249 | Ga0209675_1000044 | 3300025291 | Bacteria | 230392 |
| 250 | Ga0209675_1000238 | 3300025291 | Bacteria | 54807 |
| 251 | Ga0209675_1000791 | 3300025291 | Bacteria | 20977 |
| 252 | Ga0209676_1000004 | 3300025292 | Bacteria | 1138360 |
| 253 | Ga0209676_1000029 | 3300025292 | Bacteria | 520536 |
| 254 | Ga0209676_1000162 | 3300025292 | Bacteria | 159931 |
| 255 | Ga0209676_1000206 | 3300025292 | Bacteria | 132202 |
| 256 | Ga0209676_1003498 | 3300025292 | Bacteria | 9614 |
| 257 | Ga0209025_1000133 | 3300025294 | Bacteria | 195885 |
| 258 | Ga0209025_1000155 | 3300025294 | Bacteria | 169116 |
| 259 | Ga0209025_1000393 | 3300025294 | Bacteria | 90571 |
| 260 | Ga0209025_1018473 | 3300025294 | Bacteria | 3946 |
| 261 | Ga0209025_1039050 | 3300025294 | Bacteria | 2077 |
| 262 | Ga0209564_1000222 | 3300025295 | Bacteria | 129405 |
| 263 | Ga0209564_1000356 | 3300025295 | Bacteria | 85562 |
| 264 | Ga0209564_1001526 | 3300025295 | Bacteria | 23009 |
| 265 | Ga0209758_1000134 | 3300025297 | Bacteria | 178294 |
| 266 | Ga0209758_1004956 | 3300025297 | Bacteria | 10666 |
| 267 | Ga0209758_1062221 | 3300025297 | Bacteria | 1223 |
| 268 | Ga0209758_1142133 | 3300025297 | Bacteria | 621 |
| 269 | Ga0209050_1000002 | 3300025298 | Bacteria | 1792849 |
| 270 | Ga0209050_1000003 | 3300025298 | Bacteria | 1609245 |
| 271 | Ga0209050_1000512 | 3300025298 | Bacteria | 65551 |
| 272 | Ga0209050_1000659 | 3300025298 | Bacteria | 53383 |
| 273 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 274 | Ga0209256_1000060 | 3300025299 | Bacteria | 262342 |
| 275 | Ga0209256_1000472 | 3300025299 | Bacteria | 60473 |
| 276 | Ga0207426_1000095 | 3300025302 | Bacteria | 274234 |
| 277 | Ga0207426_1000100 | 3300025302 | Bacteria | 262342 |
| 278 | Ga0207426_1005625 | 3300025302 | Bacteria | 5671 |
| 279 | Ga0209051_1000002 | 3300025303 | Bacteria | 1631846 |
| 280 | Ga0209051_1000003 | 3300025303 | Bacteria | 1609245 |
| 281 | Ga0209051_1000113 | 3300025303 | Bacteria | 152417 |
| 282 | Ga0209051_1000274 | 3300025303 | Bacteria | 84662 |
| 283 | Ga0209051_1000311 | 3300025303 | Bacteria | 76050 |
| 284 | Ga0209051_1012141 | 3300025303 | Bacteria | 4185 |
| 285 | Ga0209051_1014263 | 3300025303 | Bacteria | 3718 |
| 286 | Ga0209257_1000002 | 3300025304 | Bacteria | 1767052 |
| 287 | Ga0209257_1000018 | 3300025304 | Bacteria | 836016 |
| 288 | Ga0209257_1000286 | 3300025304 | Bacteria | 111738 |
| 289 | Ga0209257_1000432 | 3300025304 | Bacteria | 80643 |
| 290 | Ga0209257_1001890 | 3300025304 | Bacteria | 22644 |
| 291 | Ga0209257_1006446 | 3300025304 | Bacteria | 7556 |
| 292 | Ga0209257_1024838 | 3300025304 | Bacteria | 2063 |
| 293 | Ga0207656_10057494 | 3300025321 | Bacteria | 1697 |
| 294 | Ga0207656_10680318 | 3300025321 | Bacteria | 527 |
| 295 | Ga0207710_10036683 | 3300025900 | Bacteria | 2162 |
| 296 | Ga0207710_10119223 | 3300025900 | Bacteria | 1259 |
| 297 | Ga0207680_10077211 | 3300025903 | Bacteria | 2082 |
| 298 | Ga0207647_10004348 | 3300025904 | Bacteria | 10505 |
| 299 | Ga0207684_10178937 | 3300025910 | Bacteria | 1828 |
| 300 | Ga0207654_10091551 | 3300025911 | Bacteria | 1855 |
| 301 | Ga0207695_10002145 | 3300025913 | Bacteria | 29897 |
| 302 | Ga0207695_10392204 | 3300025913 | Bacteria | 1273 |
| 303 | Ga0207671_10194143 | 3300025914 | Bacteria | 1584 |
| 304 | Ga0207649_10000098 | 3300025920 | Bacteria | 71539 |
| 305 | Ga0207646_10703918 | 3300025922 | Bacteria | 903 |
| 306 | Ga0207694_10395154 | 3300025924 | Bacteria | 1149 |
| 307 | Ga0207650_10644841 | 3300025925 | Bacteria | 892 |
| 308 | Ga0207650_10849219 | 3300025925 | Bacteria | 775 |
| 309 | Ga0207687_10827051 | 3300025927 | Unclassified | 791 |
| 310 | Ga0207706_10001106 | 3300025933 | Bacteria | 27447 |
| 311 | Ga0207706_10899213 | 3300025933 | Bacteria | 748 |
| 312 | Ga0207709_10000765 | 3300025935 | Bacteria | 25358 |
| 313 | Ga0207709_10101503 | 3300025935 | Bacteria | 1903 |
| 314 | Ga0207670_10103440 | 3300025936 | Bacteria | 2038 |
| 315 | Ga0207704_10151467 | 3300025938 | Bacteria | 1637 |
| 316 | Ga0207711_10175989 | 3300025941 | Bacteria | 1944 |
| 317 | Ga0207711_10225164 | 3300025941 | Bacteria | 1716 |
| 318 | Ga0207689_10235825 | 3300025942 | Unclassified | 1512 |
| 319 | Ga0207689_11366632 | 3300025942 | Bacteria | 594 |
| 320 | Ga0207679_10000020 | 3300025945 | Bacteria | 225727 |
| 321 | Ga0207679_10118159 | 3300025945 | Bacteria | 2105 |
| 322 | Ga0207712_10233276 | 3300025961 | Bacteria | 1478 |
| 323 | Ga0207668_10052736 | 3300025972 | Bacteria | 2815 |
| 324 | Ga0207668_10610967 | 3300025972 | Bacteria | 951 |
| 325 | Ga0207640_10000092 | 3300025981 | Bacteria | 71354 |
| 326 | Ga0207640_10500830 | 3300025981 | Bacteria | 1011 |
| 327 | Ga0207658_10152390 | 3300025986 | Bacteria | 1885 |
| 328 | Ga0207677_10171696 | 3300026023 | Bacteria | 1696 |
| 329 | Ga0207703_10126484 | 3300026035 | Bacteria | 2201 |
| 330 | Ga0207703_10278829 | 3300026035 | Bacteria | 1517 |
| 331 | Ga0207703_10392983 | 3300026035 | Bacteria | 1285 |
| 332 | Ga0207639_10016199 | 3300026041 | Bacteria | 5268 |
| 333 | Ga0207639_10817116 | 3300026041 | Bacteria | 869 |
| 334 | Ga0207678_10000181 | 3300026067 | Bacteria | 53999 |
| 335 | Ga0207678_10054736 | 3300026067 | Bacteria | 3436 |
| 336 | Ga0207708_10706978 | 3300026075 | Bacteria | 862 |
| 337 | Ga0207702_10000017 | 3300026078 | Bacteria | 222964 |
| 338 | Ga0207702_10619387 | 3300026078 | Bacteria | 1063 |
| 339 | Ga0207641_10214951 | 3300026088 | Bacteria | 1780 |
| 340 | Ga0207641_10261285 | 3300026088 | Bacteria | 1621 |
| 341 | Ga0207641_10372977 | 3300026088 | Archaea | 1365 |
| 342 | Ga0207648_10344594 | 3300026089 | Bacteria | 1342 |
| 343 | Ga0207676_10120781 | 3300026095 | Unclassified | 2209 |
| 344 | Ga0207676_10156399 | 3300026095 | Bacteria | 1970 |
| 345 | Ga0207674_10137420 | 3300026116 | Bacteria | 2405 |
| 346 | Ga0207674_10450443 | 3300026116 | Bacteria | 1244 |
| 347 | Ga0207674_10738823 | 3300026116 | Bacteria | 950 |
| 348 | Ga0207683_12030149 | 3300026121 | Bacteria | 523 |
| 349 | Ga0207698_10087597 | 3300026142 | Bacteria | 2536 |
| 350 | Ga0209282_1067696 | 3300027666 | Bacteria | 1959 |
| 351 | Ga0207428_10273130 | 3300027907 | Bacteria | 1256 |
| 352 | Ga0268266_10150702 | 3300028379 | Bacteria | 2096 |
| 353 | Ga0268264_10155303 | 3300028381 | Bacteria | 2056 |
| 354 | Ga0268264_10710004 | 3300028381 | Bacteria | 999 |
| 355 | Ga0307515_10003072 | 3300028794 | Bacteria | 35359 |
| 356 | Ga0316177_1063076 | 3300030731 | Bacteria | 2716 |
| 357 | Ga0314311_1027081 | 3300030733 | Bacteria | 14353 |
| 358 | Ga0316178_1129918 | 3300030735 | Bacteria | 2727 |
| 359 | Ga0316180_1028766 | 3300030736 | Bacteria | 5000 |
| 360 | Ga0316183_1073027 | 3300030742 | Bacteria | 8781 |
| 361 | Ga0316181_1276434 | 3300030744 | Bacteria | 1471 |
| 362 | Ga0316182_1019128 | 3300030745 | Bacteria | 2145 |
| 363 | Ga0307408_100003238 | 3300031548 | Bacteria | 11195 |
| 364 | Ga0307408_100121256 | 3300031548 | Bacteria | 2026 |
| 365 | Ga0307408_100186826 | 3300031548 | Bacteria | 1666 |
| 366 | Ga0307408_100242316 | 3300031548 | Bacteria | 1482 |
| 367 | Ga0307508_10000740 | 3300031616 | Bacteria | 38713 |
| 368 | Ga0307514_10007518 | 3300031649 | Bacteria | 9389 |
| 369 | Ga0307514_10141616 | 3300031649 | Bacteria | 1633 |
| 370 | Ga0307516_10154435 | 3300031730 | Bacteria | 2052 |
| 371 | Ga0307405_10070917 | 3300031731 | Bacteria | 2240 |
| 372 | Ga0307405_10074261 | 3300031731 | Bacteria | 2198 |
| 373 | Ga0307405_10419751 | 3300031731 | Bacteria | 1052 |
| 374 | Ga0307413_10486727 | 3300031824 | Bacteria | 987 |
| 375 | Ga0307406_10004177 | 3300031901 | Bacteria | 7864 |
| 376 | Ga0307406_10347585 | 3300031901 | Bacteria | 1157 |
| 377 | Ga0307406_11327876 | 3300031901 | Bacteria | 628 |
| 378 | Ga0307412_10001515 | 3300031911 | Bacteria | 12884 |
| 379 | Ga0307412_10083720 | 3300031911 | Bacteria | 2212 |
| 380 | Ga0307412_10150105 | 3300031911 | Bacteria | 1718 |
| 381 | Ga0307412_10356873 | 3300031911 | Bacteria | 1176 |
| 382 | Ga0307416_100124799 | 3300032002 | Bacteria | 2304 |
| 383 | Ga0307416_100305808 | 3300032002 | Bacteria | 1583 |
| 384 | Ga0307416_100376140 | 3300032002 | Bacteria | 1448 |
| 385 | Ga0307416_100457423 | 3300032002 | Bacteria | 1330 |
| 386 | Ga0307414_10420514 | 3300032004 | Bacteria | 1165 |
| 387 | Ga0307411_10145911 | 3300032005 | Bacteria | 1751 |
| 388 | Ga0395900_0031258 | 3300037418 | Bacteria | 5468 |
| 389 | Ga0439436_0001553 | 3300041404 | Bacteria | 6689 |
| 390 | Ga0439436_0022471 | 3300041404 | Bacteria | 1868 |
| 391 | Ga0439438_120254 | 3300041405 | Bacteria | 632 |
| 392 | Ga0439439_0017818 | 3300041406 | Bacteria | 1750 |
| 393 | Ga0439447_014433 | 3300041407 | Bacteria | 2217 |
| 394 | Ga0439453_0176427 | 3300041408 | Bacteria | 519 |
| 395 | Ga0439461_0017902 | 3300041410 | Bacteria | 1381 |
| 396 | Ga0439466_0022338 | 3300041411 | Bacteria | 2234 |
| 397 | Ga0439466_0023241 | 3300041411 | Bacteria | 2182 |
| 398 | Ga0439465_0000742 | 3300041413 | Bacteria | 10100 |
| 399 | Ga0439465_0113659 | 3300041413 | Bacteria | 944 |
| 400 | Ga0451797_0442460 | 3300041453 | Bacteria | 637 |
| 401 | Ga0451802_0199705 | 3300041460 | Bacteria | 1179 |
| 402 | Ga0451807_0059783 | 3300041486 | Bacteria | 1088 |
| 403 | Ga0451855_0662111 | 3300041511 | Bacteria | 555 |
| 404 | Ga0451853_0435475 | 3300041512 | Bacteria | 983 |
| 405 | Ga0439431_0000629 | 3300041997 | Bacteria | 7487 |
| 406 | Ga0439431_0095947 | 3300041997 | Unclassified | 811 |
| 407 | Ga0439433_0008566 | 3300041999 | Bacteria | 2220 |
| 408 | Ga0439433_0009010 | 3300041999 | Bacteria | 2173 |
| 409 | Ga0439442_001238 | 3300042002 | Bacteria | 5075 |
| 410 | Ga0439442_005571 | 3300042002 | Bacteria | 2518 |
| 411 | Ga0439442_060905 | 3300042002 | Bacteria | 800 |
| 412 | Ga0439442_072879 | 3300042002 | Bacteria | 732 |
| 413 | Ga0439445_0004954 | 3300042004 | Bacteria | 3025 |
| 414 | Ga0439432_004193 | 3300042006 | Bacteria | 5272 |
| 415 | Ga0439432_004226 | 3300042006 | Bacteria | 5251 |
| 416 | Ga0439449_0000525 | 3300042007 | Bacteria | 14260 |
| 417 | Ga0439449_0003387 | 3300042007 | Bacteria | 6214 |
| 418 | Ga0439449_0007761 | 3300042007 | Bacteria | 4074 |
| 419 | Ga0439449_0166328 | 3300042007 | Bacteria | 824 |
| 420 | Ga0439452_003292 | 3300042010 | Bacteria | 5691 |
| 421 | Ga0439457_006836 | 3300042014 | Bacteria | 2763 |
| 422 | Ga0439457_102484 | 3300042014 | Bacteria | 668 |
| 423 | Ga0439462_0005683 | 3300042015 | Bacteria | 3079 |
| 424 | Ga0439462_0017364 | 3300042015 | Bacteria | 1863 |
| 425 | Ga0450919_010907 | 3300042121 | Bacteria | 1034 |
| 426 | Ga0450890_019320 | 3300042127 | Bacteria | 917 |
| 427 | Ga0450897_031878 | 3300042128 | Bacteria | 599 |
| 428 | Ga0450892_019542 | 3300042130 | Bacteria | 657 |
| 429 | Ga0450894_004279 | 3300042131 | Bacteria | 1859 |
| 430 | Ga0450898_035011 | 3300042134 | Unclassified | 934 |
| 431 | Ga0450898_050433 | 3300042134 | Bacteria | 803 |
| 432 | Ga0450898_118575 | 3300042134 | Unclassified | 564 |
| 433 | Ga0450899_033330 | 3300042135 | Bacteria | 631 |
| 434 | Ga0450906_013444 | 3300042145 | Bacteria | 1508 |
| 435 | Ga0450906_028018 | 3300042145 | Bacteria | 998 |
| 436 | Ga0450907_016921 | 3300042146 | Bacteria | 1216 |
| 437 | Ga0439446_0004804 | 3300042156 | Bacteria | 3444 |
| 438 | Ga0439446_0030157 | 3300042156 | Bacteria | 1567 |
| 439 | Ga0450908_001834 | 3300042184 | Bacteria | 4153 |
| 440 | Ga0450909_048036 | 3300042185 | Bacteria | 663 |
| 441 | Ga0439434_0001149 | 3300042435 | Bacteria | 7661 |
| 442 | Ga0439434_0025836 | 3300042435 | Bacteria | 1773 |
| 443 | Ga0450918_013312 | 3300042531 | Bacteria | 1431 |
| 444 | Ga0466972_0003409 | 3300044658 | Bacteria | 7883 |
| 445 | Ga0466965_0050591 | 3300044683 | Bacteria | 2060 |
| 446 | Ga0466961_0472460 | 3300044693 | Bacteria | 758 |
| 447 | Ga0466963_0027230 | 3300044694 | Bacteria | 3659 |
| 448 | Ga0466971_0201867 | 3300044719 | Bacteria | 939 |
| 449 | Ga0466957_0234298 | 3300044842 | Bacteria | 1216 |
| 450 | Ga0466960_0066357 | 3300044901 | Bacteria | 1784 |
| 451 | Ga0451576_0953373 | 3300045051 | Unclassified | 900 |
| 452 | Ga0466967_0046517 | 3300045976 | Bacteria | 3778 |
| 453 | Ga0495638_0004688 | 3300046460 | Bacteria | 10335 |
| 454 | Ga0495606_0234284 | 3300046507 | Bacteria | 1027 |
| 455 | Ga0495606_0536996 | 3300046507 | Bacteria | 584 |
| 456 | Ga0495616_0142443 | 3300046513 | Bacteria | 1090 |
| 457 | Ga0495620_0049238 | 3300046515 | Bacteria | 1804 |
| 458 | Ga0495631_0000213 | 3300046518 | Bacteria | 39910 |
| 459 | Ga0495637_0015117 | 3300046520 | Bacteria | 3626 |
| 460 | Ga0495654_0025029 | 3300046530 | Bacteria | 3078 |
| 461 | Ga0495621_0021481 | 3300046539 | Bacteria | 2128 |
| 462 | Ga0495597_0020813 | 3300046542 | Bacteria | 3052 |
| 463 | Ga0495668_0125394 | 3300046616 | Bacteria | 1405 |
| 464 | Ga0495668_0294062 | 3300046616 | Bacteria | 890 |
| 465 | Ga0495625_0000057 | 3300046660 | Bacteria | 181623 |
| 466 | Ga0495588_0034286 | 3300046674 | Bacteria | 2568 |
| 467 | Ga0495588_0073008 | 3300046674 | Bacteria | 1786 |
| 468 | Ga0495670_0017565 | 3300046691 | Bacteria | 3522 |
| 469 | Ga0495671_0019710 | 3300046692 | Bacteria | 3561 |
| 470 | Ga0495660_0136534 | 3300046810 | Bacteria | 1225 |
| 471 | Ga0495676_0003920 | 3300047321 | Bacteria | 13532 |
| 472 | Ga0495683_0017198 | 3300047323 | Bacteria | 3750 |
| 473 | Ga0495687_008900 | 3300047443 | Bacteria | 5684 |
| 474 | Ga0495593_0016801 | 3300047673 | Bacteria | 4121 |
| 475 | Ga0495602_0102266 | 3300048088 | Bacteria | 2349 |
| 476 | Ga0495614_0006647 | 3300048089 | Bacteria | 5179 |
| 477 | Ga0496100_0247658 | 3300048903 | Bacteria | 1317 |
| 478 | Ga0496101_0580548 | 3300048904 | Bacteria | 886 |
| 479 | Ga0496102_0678418 | 3300048905 | Bacteria | 953 |
| 480 | Ga0496103_0014633 | 3300048906 | Bacteria | 4662 |
| 481 | Ga0496103_0655902 | 3300048906 | Bacteria | 666 |
| 482 | Ga0496104_0206865 | 3300048907 | Bacteria | 1874 |
| 483 | Ga0496104_0425156 | 3300048907 | Unclassified | 1240 |
| 484 | Ga0496105_0268157 | 3300048908 | Bacteria | 1379 |
| 485 | Ga0496106_0227256 | 3300048909 | Bacteria | 1489 |
| 486 | Ga0496107_0318247 | 3300048910 | Bacteria | 1158 |
| 487 | Ga0496108_0496976 | 3300048911 | Unclassified | 1065 |
| 488 | Ga0496109_0200017 | 3300048912 | Bacteria | 1878 |
| 489 | Ga0496109_0680481 | 3300048912 | Archaea | 966 |
| 490 | Ga0496110_0081368 | 3300048913 | Bacteria | 2887 |
| 491 | Ga0496112_0006563 | 3300048915 | Bacteria | 10238 |
| 492 | Ga0496112_0087400 | 3300048915 | Bacteria | 3084 |
| 493 | Ga0496113_0071700 | 3300048916 | Bacteria | 2635 |
| 494 | Ga0496116_0016032 | 3300048919 | Bacteria | 5889 |
| 495 | Ga0496116_0171276 | 3300048919 | Bacteria | 1176 |
| 496 | Ga0496117_0040130 | 3300048920 | Bacteria | 3448 |
| 497 | Ga0496117_0097036 | 3300048920 | Bacteria | 1878 |
| 498 | Ga0496117_0285045 | 3300048920 | Bacteria | 882 |
| 499 | Ga0496118_0026578 | 3300048921 | Bacteria | 4925 |
| 500 | Ga0496118_0031323 | 3300048921 | Bacteria | 4411 |
| 501 | Ga0496118_0031565 | 3300048921 | Bacteria | 4388 |
| 502 | Ga0496119_0062975 | 3300048922 | Bacteria | 2208 |
| 503 | Ga0496121_0093851 | 3300048924 | Bacteria | 2335 |
| 504 | Ga0496121_0281954 | 3300048924 | Bacteria | 1136 |
| 505 | Ga0496121_0537772 | 3300048924 | Bacteria | 733 |
| 506 | Ga0496122_0012141 | 3300048925 | Bacteria | 8623 |
| 507 | Ga0496122_0175360 | 3300048925 | Bacteria | 1286 |
| 508 | Ga0496122_0216818 | 3300048925 | Bacteria | 1102 |
| 509 | Ga0496122_0285567 | 3300048925 | Bacteria | 899 |
| 510 | Ga0496123_0040310 | 3300048926 | Bacteria | 3255 |
| 511 | Ga0496123_0282932 | 3300048926 | Bacteria | 800 |
| 512 | Ga0496124_0062766 | 3300048927 | Bacteria | 3108 |
| 513 | Ga0496124_0195238 | 3300048927 | Bacteria | 1545 |
| 514 | Ga0496125_0021624 | 3300048928 | Bacteria | 5995 |
| 515 | Ga0496125_0045744 | 3300048928 | Bacteria | 3679 |
| 516 | Ga0496125_0136555 | 3300048928 | Bacteria | 1714 |
| 517 | Ga0496126_0218009 | 3300048929 | Bacteria | 1604 |
| 518 | Ga0501225_0005947 | 3300049705 | Bacteria | 3572 |
| 519 | Ga0501262_000600 | 3300049759 | Bacteria | 4241 |
| 520 | nmdc:mga03683_2343_c2 | 3300050489 | Bacteria | 4682 |
| 521 | nmdc:mga03683_25557_c1 | 3300050489 | Bacteria | 2322 |
| 522 | nmdc:mga03683_35729_c1 | 3300050489 | Bacteria | 2017 |
| 523 | nmdc:mga03n38_20545_c1 | 3300050490 | Bacteria | 2644 |
| 524 | nmdc:mga03n38_311727_c1 | 3300050490 | Bacteria | 848 |
| 525 | nmdc:mga00v17_116241_c1 | 3300050491 | Bacteria | 1700 |
| 526 | nmdc:mga00v17_17018_c1 | 3300050491 | Bacteria | 4106 |
| 527 | nmdc:mga00v17_98016_c1 | 3300050491 | Bacteria | 1848 |
| 528 | nmdc:mga0yw44_161827_c1 | 3300050492 | Bacteria | 1466 |
| 529 | nmdc:mga0yw44_52589_c1 | 3300050492 | Bacteria | 2470 |
| 530 | nmdc:mga0k408_10327_c2 | 3300050493 | Bacteria | 3719 |
| 531 | nmdc:mga0k408_138126_c1 | 3300050493 | Bacteria | 1449 |
| 532 | nmdc:mga0k408_138650_c1 | 3300050493 | Bacteria | 1446 |
| 533 | nmdc:mga0k408_293820_c1 | 3300050493 | Bacteria | 970 |
| 534 | nmdc:mga0k408_6552_c1 | 3300050493 | Bacteria | 6203 |
| 535 | nmdc:mga0k408_85111_c1 | 3300050493 | Bacteria | 1856 |
| 536 | nmdc:mga06z11_256770_c1 | 3300050494 | Bacteria | 1030 |
| 537 | nmdc:mga06z11_423866_c1 | 3300050494 | Bacteria | 802 |
| 538 | nmdc:mga04h51_78730_c1 | 3300050495 | Bacteria | 1166 |
| 539 | nmdc:mga07m45_116300_c1 | 3300050496 | Bacteria | 1542 |
| 540 | nmdc:mga07m45_20234_c1 | 3300050496 | Bacteria | 3615 |
| 541 | nmdc:mga07m45_318123_c1 | 3300050496 | Bacteria | 905 |
| 542 | nmdc:mga07m45_44155_c1 | 3300050496 | Bacteria | 2500 |
| 543 | nmdc:mga08y16_1450456_c1 | 3300050511 | Bacteria | 648 |
| 544 | nmdc:mga0sz30_166942_c1 | 3300050516 | Bacteria | 976 |
| 545 | nmdc:mga0sz30_407319_c1 | 3300050516 | Bacteria | 609 |
| 546 | Ga0500610_0008818 | 3300053079 | Bacteria | 4420 |
| 547 | Ga0500610_0016274 | 3300053079 | Bacteria | 3541 |
| 548 | Ga0500610_0314758 | 3300053079 | Bacteria | 682 |
| 549 | Ga0500644_0001001 | 3300053088 | Bacteria | 8728 |
| 550 | Ga0500651_0000189 | 3300053093 | Bacteria | 39346 |
| 551 | Ga0500566_0045842 | 3300053094 | Bacteria | 2515 |
| 552 | Ga0500566_0054958 | 3300053094 | Bacteria | 2269 |
| 553 | Ga0500566_0157209 | 3300053094 | Bacteria | 1189 |
| 554 | Ga0500650_0071854 | 3300053098 | Bacteria | 1617 |
| 555 | Ga0500571_000045 | 3300053110 | Bacteria | 39238 |
| 556 | Ga0500593_000850 | 3300053117 | Bacteria | 11363 |
| 557 | Ga0500593_014332 | 3300053117 | Bacteria | 3399 |
| 558 | Ga0500594_0003235 | 3300053118 | Bacteria | 3567 |
| 559 | Ga0500597_004697 | 3300053120 | Bacteria | 4286 |
| 560 | Ga0500607_002838 | 3300053121 | Bacteria | 13393 |
| 561 | Ga0500608_013352 | 3300053122 | Bacteria | 3639 |
| 562 | Ga0500614_009430 | 3300053123 | Bacteria | 2083 |
| 563 | Ga0500628_007251 | 3300053129 | Bacteria | 1895 |
| 564 | Ga0500655_001735 | 3300053133 | Bacteria | 4088 |
| 565 | Ga0500658_0000288 | 3300053134 | Bacteria | 22797 |
| 566 | Ga0500559_0048729 | 3300053136 | Bacteria | 1864 |
| 567 | Ga0500574_000524 | 3300053141 | Bacteria | 4928 |
| 568 | Ga0500577_0222936 | 3300053142 | Bacteria | 816 |
| 569 | Ga0500604_0031446 | 3300053151 | Bacteria | 1558 |
| 570 | Ga0500616_0027608 | 3300053153 | Bacteria | 3132 |
| 571 | Ga0500619_117727 | 3300053154 | Bacteria | 905 |
| 572 | Ga0500624_004701 | 3300053157 | Bacteria | 1803 |
| 573 | Ga0500627_0036706 | 3300053158 | Bacteria | 2088 |
| 574 | Ga0500638_068784 | 3300053162 | Bacteria | 1694 |
| 575 | Ga0500636_0311274 | 3300053177 | Bacteria | 770 |
| 576 | Ga0500637_0158572 | 3300053178 | Bacteria | 1305 |
| 577 | Ga0500645_140665 | 3300053730 | Bacteria | 668 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005331 | Ga0070670_100276236 | Ga0070670_1002762361 | 132 |
| 2 | 3300005334 | Ga0068869_100230951 | Ga0068869_1002309512 | 132 |
| 3 | 3300005354 | Ga0070675_100389162 | Ga0070675_1003891622 | 132 |
| 4 | 3300025925 | Ga0207650_10849219 | Ga0207650_108492191 | 132 |
| 5 | 3300025942 | Ga0207689_10235825 | Ga0207689_102358252 | 132 |
| 6 | 3300026095 | Ga0207676_10156399 | Ga0207676_101563993 | 132 |
| 7 | 3300028381 | Ga0268264_10155303 | Ga0268264_101553033 | 134 |
| 8 | 3300041997 | Ga0439431_0095947 | Ga0439431_0095947_40_537 | 135 |
| 9 | 3300042130 | Ga0450892_019542 | Ga0450892_019542_55_543 | 135 |
| 10 | 3300005290 | Ga0065712_10595516 | Ga0065712_105955161 | 136 |
| 11 | 3300005564 | Ga0070664_100368650 | Ga0070664_1003686502 | 136 |
| 12 | 3300005842 | Ga0068858_100169772 | Ga0068858_1001697722 | 136 |
| 13 | 3300009011 | Ga0105251_10154943 | Ga0105251_101549432 | 136 |
| 14 | 3300009177 | Ga0105248_10008984 | Ga0105248_100089843 | 136 |
| 15 | 3300014325 | Ga0163163_10144861 | Ga0163163_101448612 | 136 |
| 16 | 3300014968 | Ga0157379_10091543 | Ga0157379_100915432 | 136 |
| 17 | 3300025900 | Ga0207710_10119223 | Ga0207710_101192233 | 136 |
| 18 | 3300025941 | Ga0207711_10175989 | Ga0207711_101759893 | 136 |
| 19 | 3300025945 | Ga0207679_10118159 | Ga0207679_101181593 | 136 |
| 20 | 3300026035 | Ga0207703_10126484 | Ga0207703_101264843 | 136 |
| 21 | 3300026088 | Ga0207641_10372977 | Ga0207641_103729771 | 136 |
| 22 | 3300026095 | Ga0207676_10120781 | Ga0207676_101207812 | 136 |
| 23 | 3300046460 | Ga0495638_0004688 | Ga0495638_0004688_2763_3185 | 136 |
| 24 | 3300048907 | Ga0496104_0425156 | Ga0496104_0425156_703_1152 | 136 |
| 25 | 3300048911 | Ga0496108_0496976 | Ga0496108_0496976_545_994 | 136 |
| 26 | 3300048912 | Ga0496109_0680481 | Ga0496109_0680481_241_690 | 136 |
| 27 | 3300048915 | Ga0496112_0006563 | Ga0496112_0006563_8613_9062 | 136 |
| 28 | 3300048916 | Ga0496113_0071700 | Ga0496113_0071700_1035_1484 | 136 |
| 29 | 3300053142 | Ga0500577_0222936 | Ga0500577_0222936_35_457 | 136 |
| 30 | iso_pu_bacteria | 2643221683 | 2644467721 | 137 |
| 31 | 3300006353 | Ga0075370_10122982 | Ga0075370_101229823 | 138 |
| 32 | 3300042002 | Ga0439442_072879 | Ga0439442_072879_114_554 | 138 |
| 33 | 3300042007 | Ga0439449_0000525 | Ga0439449_0000525_5585_6025 | 138 |
| 34 | 3300050496 | nmdc:mga07m45_116300_c1 | nmdc:mga07m45_116300_c1_165_614 | 138 |
| 35 | 3300053094 | Ga0500566_0054958 | Ga0500566_0054958_939_1388 | 138 |
| 36 | 3300053730 | Ga0500645_140665 | Ga0500645_140665_50_499 | 138 |
| 37 | iso_pu_bacteria | 2511231002 | 2511244234 | 138 |
| 38 | 3300005937 | Ga0081455_10001755 | Ga0081455_1000175524 | 139 |
| 39 | 3300044658 | Ga0466972_0003409 | Ga0466972_0003409_3988_4425 | 139 |
| 40 | 3300044693 | Ga0466961_0472460 | Ga0466961_0472460_112_549 | 139 |
| 41 | iso_pu_bacteria | 2599185214 | 2599622739 | 139 |
| 42 | iso_pu_bacteria | 2599185226 | 2599671218 | 139 |
| 43 | iso_pu_bacteria | 2599185227 | 2599679745 | 139 |
| 44 | iso_pu_bacteria | 2599185229 | 2599691761 | 139 |
| 45 | iso_pu_bacteria | 2824679649 | 2824682505 | 139 |
| 46 | iso_pu_bacteria | 2885192300 | 2885196013 | 139 |
| 47 | iso_pu_bacteria | 2885198086 | 2885204770 | 139 |
| 48 | iso_pu_bacteria | 2885211737 | 2885218543 | 139 |
| 49 | iso_pu_bacteria | 2922393267 | 2922395433 | 139 |
| 50 | iso_pu_bacteria | 2928070936 | 2928074536 | 139 |
| 51 | iso_pu_bacteria | 3005594810 | 3005598249 | 139 |
| 52 | 3300006871 | Ga0075434_100071863 | Ga0075434_1000718635 | 140 |
| 53 | 3300031548 | Ga0307408_100121256 | Ga0307408_1001212562 | 140 |
| 54 | 3300031649 | Ga0307514_10141616 | Ga0307514_101416163 | 140 |
| 55 | 3300031731 | Ga0307405_10070917 | Ga0307405_100709172 | 140 |
| 56 | 3300032002 | Ga0307416_100124799 | Ga0307416_1001247992 | 140 |
| 57 | 3300042127 | Ga0450890_019320 | Ga0450890_019320_92_568 | 140 |
| 58 | 3300045051 | Ga0451576_0953373 | Ga0451576_0953373_393_830 | 140 |
| 59 | 3300048906 | Ga0496103_0655902 | Ga0496103_0655902_216_653 | 140 |
| 60 | iso_pu_bacteria | 2904449895 | 2904452324 | 140 |
| 61 | iso_pu_bacteria | 2904456579 | 2904458530 | 140 |
| 62 | 3300003762 | Ga0055542_1004558 | Ga0055542_10045585 | 141 |
| 63 | 3300005331 | Ga0070670_100590390 | Ga0070670_1005903901 | 141 |
| 64 | 3300005334 | Ga0068869_100830546 | Ga0068869_1008305462 | 141 |
| 65 | 3300005335 | Ga0070666_10810818 | Ga0070666_108108181 | 141 |
| 66 | 3300005340 | Ga0070689_100132009 | Ga0070689_1001320092 | 141 |
| 67 | 3300005347 | Ga0070668_100047565 | Ga0070668_1000475655 | 141 |
| 68 | 3300005365 | Ga0070688_100002411 | Ga0070688_1000024117 | 141 |
| 69 | 3300005366 | Ga0070659_101131936 | Ga0070659_1011319362 | 141 |
| 70 | 3300005367 | Ga0070667_100146495 | Ga0070667_1001464951 | 141 |
| 71 | 3300005455 | Ga0070663_100123233 | Ga0070663_1001232335 | 141 |
| 72 | 3300005468 | Ga0070707_100757935 | Ga0070707_1007579352 | 141 |
| 73 | 3300005471 | Ga0070698_100480756 | Ga0070698_1004807562 | 141 |
| 74 | 3300005518 | Ga0070699_100307448 | Ga0070699_1003074482 | 141 |
| 75 | 3300005536 | Ga0070697_100317135 | Ga0070697_1003171352 | 141 |
| 76 | 3300005539 | Ga0068853_100091338 | Ga0068853_1000913382 | 141 |
| 77 | 3300005548 | Ga0070665_100161660 | Ga0070665_1001616605 | 141 |
| 78 | 3300005563 | Ga0068855_100230582 | Ga0068855_1002305822 | 141 |
| 79 | 3300005577 | Ga0068857_100709494 | Ga0068857_1007094942 | 141 |
| 80 | 3300005578 | Ga0068854_100174713 | Ga0068854_1001747132 | 141 |
| 81 | 3300005616 | Ga0068852_100774216 | Ga0068852_1007742162 | 141 |
| 82 | 3300005617 | Ga0068859_100625692 | Ga0068859_1006256922 | 141 |
| 83 | 3300005834 | Ga0068851_10402427 | Ga0068851_104024272 | 141 |
| 84 | 3300005842 | Ga0068858_100187143 | Ga0068858_1001871432 | 141 |
| 85 | 3300005843 | Ga0068860_100198503 | Ga0068860_1001985033 | 141 |
| 86 | 3300006042 | Ga0075368_10050901 | Ga0075368_100509012 | 141 |
| 87 | 3300006048 | Ga0075363_100082586 | Ga0075363_1000825862 | 141 |
| 88 | 3300006051 | Ga0075364_10010862 | Ga0075364_100108626 | 141 |
| 89 | 3300006177 | Ga0075362_10033912 | Ga0075362_100339122 | 141 |
| 90 | 3300006195 | Ga0075366_10019514 | Ga0075366_100195143 | 141 |
| 91 | 3300006353 | Ga0075370_10232692 | Ga0075370_102326922 | 141 |
| 92 | 3300006880 | Ga0075429_100161567 | Ga0075429_1001615671 | 141 |
| 93 | 3300006931 | Ga0097620_100625692 | Ga0097620_1006256922 | 141 |
| 94 | 3300009093 | Ga0105240_10355025 | Ga0105240_103550253 | 141 |
| 95 | 3300009094 | Ga0111539_10843243 | Ga0111539_108432431 | 141 |
| 96 | 3300009101 | Ga0105247_10049784 | Ga0105247_100497842 | 141 |
| 97 | 3300009177 | Ga0105248_10299497 | Ga0105248_102994973 | 141 |
| 98 | 3300009545 | Ga0105237_10063112 | Ga0105237_100631124 | 141 |
| 99 | 3300009551 | Ga0105238_10105988 | Ga0105238_101059885 | 141 |
| 100 | 3300009553 | Ga0105249_10416810 | Ga0105249_104168102 | 141 |
| 101 | 3300010375 | Ga0105239_10501561 | Ga0105239_105015612 | 141 |
| 102 | 3300011119 | Ga0105246_10009041 | Ga0105246_100090418 | 141 |
| 103 | 3300013102 | Ga0157371_10846635 | Ga0157371_108466351 | 141 |
| 104 | 3300013296 | Ga0157374_10120941 | Ga0157374_101209414 | 141 |
| 105 | 3300013306 | Ga0163162_11303833 | Ga0163162_113038332 | 141 |
| 106 | 3300014325 | Ga0163163_10080599 | Ga0163163_100805992 | 141 |
| 107 | 3300014968 | Ga0157379_10037027 | Ga0157379_100370273 | 141 |
| 108 | 3300014969 | Ga0157376_11944773 | Ga0157376_119447732 | 141 |
| 109 | 3300025250 | Ga0209026_1026886 | Ga0209026_10268862 | 141 |
| 110 | 3300025254 | Ga0209148_1000493 | Ga0209148_100049315 | 141 |
| 111 | 3300025261 | Ga0209233_1032562 | Ga0209233_10325622 | 141 |
| 112 | 3300025272 | Ga0209455_1002659 | Ga0209455_10026594 | 141 |
| 113 | 3300025272 | Ga0209455_1049890 | Ga0209455_10498902 | 141 |
| 114 | 3300025304 | Ga0209257_1024838 | Ga0209257_10248381 | 141 |
| 115 | 3300025321 | Ga0207656_10680318 | Ga0207656_106803181 | 141 |
| 116 | 3300025900 | Ga0207710_10036683 | Ga0207710_100366833 | 141 |
| 117 | 3300025903 | Ga0207680_10077211 | Ga0207680_100772113 | 141 |
| 118 | 3300025904 | Ga0207647_10004348 | Ga0207647_100043489 | 141 |
| 119 | 3300025910 | Ga0207684_10178937 | Ga0207684_101789373 | 141 |
| 120 | 3300025911 | Ga0207654_10091551 | Ga0207654_100915512 | 141 |
| 121 | 3300025913 | Ga0207695_10392204 | Ga0207695_103922042 | 141 |
| 122 | 3300025914 | Ga0207671_10194143 | Ga0207671_101941432 | 141 |
| 123 | 3300025922 | Ga0207646_10703918 | Ga0207646_107039182 | 141 |
| 124 | 3300025924 | Ga0207694_10395154 | Ga0207694_103951542 | 141 |
| 125 | 3300025925 | Ga0207650_10644841 | Ga0207650_106448411 | 141 |
| 126 | 3300025936 | Ga0207670_10103440 | Ga0207670_101034402 | 141 |
| 127 | 3300025941 | Ga0207711_10225164 | Ga0207711_102251642 | 141 |
| 128 | 3300025942 | Ga0207689_11366632 | Ga0207689_113666321 | 141 |
| 129 | 3300025961 | Ga0207712_10233276 | Ga0207712_102332763 | 141 |
| 130 | 3300025972 | Ga0207668_10052736 | Ga0207668_100527363 | 141 |
| 131 | 3300025981 | Ga0207640_10500830 | Ga0207640_105008302 | 141 |
| 132 | 3300025986 | Ga0207658_10152390 | Ga0207658_101523902 | 141 |
| 133 | 3300026035 | Ga0207703_10392983 | Ga0207703_103929833 | 141 |
| 134 | 3300026067 | Ga0207678_10054736 | Ga0207678_100547363 | 141 |
| 135 | 3300026088 | Ga0207641_10214951 | Ga0207641_102149513 | 141 |
| 136 | 3300026116 | Ga0207674_10450443 | Ga0207674_104504432 | 141 |
| 137 | 3300026116 | Ga0207674_10738823 | Ga0207674_107388232 | 141 |
| 138 | 3300026121 | Ga0207683_12030149 | Ga0207683_120301491 | 141 |
| 139 | 3300028379 | Ga0268266_10150702 | Ga0268266_101507022 | 141 |
| 140 | 3300028381 | Ga0268264_10710004 | Ga0268264_107100042 | 141 |
| 141 | 3300031616 | Ga0307508_10000740 | Ga0307508_1000074017 | 141 |
| 142 | 3300031730 | Ga0307516_10154435 | Ga0307516_101544352 | 141 |
| 143 | 3300044694 | Ga0466963_0027230 | Ga0466963_0027230_195_635 | 141 |
| 144 | 3300044719 | Ga0466971_0201867 | Ga0466971_0201867_19_459 | 141 |
| 145 | 3300044842 | Ga0466957_0234298 | Ga0466957_0234298_752_1192 | 141 |
| 146 | 3300045976 | Ga0466967_0046517 | Ga0466967_0046517_1433_1873 | 141 |
| 147 | 3300046507 | Ga0495606_0234284 | Ga0495606_0234284_461_901 | 141 |
| 148 | 3300046507 | Ga0495606_0536996 | Ga0495606_0536996_34_474 | 141 |
| 149 | 3300046513 | Ga0495616_0142443 | Ga0495616_0142443_410_850 | 141 |
| 150 | 3300046542 | Ga0495597_0020813 | Ga0495597_0020813_1575_2015 | 141 |
| 151 | 3300046616 | Ga0495668_0125394 | Ga0495668_0125394_252_692 | 141 |
| 152 | 3300047323 | Ga0495683_0017198 | Ga0495683_0017198_46_486 | 141 |
| 153 | 3300047443 | Ga0495687_008900 | Ga0495687_008900_3459_3899 | 141 |
| 154 | 3300048903 | Ga0496100_0247658 | Ga0496100_0247658_447_887 | 141 |
| 155 | 3300048904 | Ga0496101_0580548 | Ga0496101_0580548_164_604 | 141 |
| 156 | 3300048905 | Ga0496102_0678418 | Ga0496102_0678418_192_632 | 141 |
| 157 | 3300048906 | Ga0496103_0014633 | Ga0496103_0014633_35_475 | 141 |
| 158 | 3300048907 | Ga0496104_0206865 | Ga0496104_0206865_1414_1854 | 141 |
| 159 | 3300048908 | Ga0496105_0268157 | Ga0496105_0268157_486_926 | 141 |
| 160 | 3300048909 | Ga0496106_0227256 | Ga0496106_0227256_644_1084 | 141 |
| 161 | 3300048910 | Ga0496107_0318247 | Ga0496107_0318247_233_673 | 141 |
| 162 | 3300048912 | Ga0496109_0200017 | Ga0496109_0200017_1211_1651 | 141 |
| 163 | 3300048913 | Ga0496110_0081368 | Ga0496110_0081368_102_542 | 141 |
| 164 | 3300048915 | Ga0496112_0087400 | Ga0496112_0087400_1024_1464 | 141 |
| 165 | 3300048919 | Ga0496116_0171276 | Ga0496116_0171276_420_860 | 141 |
| 166 | 3300048920 | Ga0496117_0040130 | Ga0496117_0040130_630_1070 | 141 |
| 167 | 3300048921 | Ga0496118_0031323 | Ga0496118_0031323_833_1273 | 141 |
| 168 | 3300048922 | Ga0496119_0062975 | Ga0496119_0062975_657_1097 | 141 |
| 169 | 3300048924 | Ga0496121_0281954 | Ga0496121_0281954_419_859 | 141 |
| 170 | 3300048925 | Ga0496122_0012141 | Ga0496122_0012141_3546_4025 | 141 |
| 171 | 3300048925 | Ga0496122_0285567 | Ga0496122_0285567_190_630 | 141 |
| 172 | 3300048926 | Ga0496123_0040310 | Ga0496123_0040310_911_1390 | 141 |
| 173 | 3300048927 | Ga0496124_0195238 | Ga0496124_0195238_218_658 | 141 |
| 174 | 3300048928 | Ga0496125_0136555 | Ga0496125_0136555_977_1417 | 141 |
| 175 | 3300048929 | Ga0496126_0218009 | Ga0496126_0218009_216_665 | 141 |
| 176 | 3300050489 | nmdc:mga03683_35729_c1 | nmdc:mga03683_35729_c1_251_691 | 141 |
| 177 | 3300050490 | nmdc:mga03n38_20545_c1 | nmdc:mga03n38_20545_c1_2123_2563 | 141 |
| 178 | 3300050491 | nmdc:mga00v17_17018_c1 | nmdc:mga00v17_17018_c1_2789_3229 | 141 |
| 179 | 3300050492 | nmdc:mga0yw44_161827_c1 | nmdc:mga0yw44_161827_c1_319_759 | 141 |
| 180 | 3300050493 | nmdc:mga0k408_293820_c1 | nmdc:mga0k408_293820_c1_112_552 | 141 |
| 181 | 3300050495 | nmdc:mga04h51_78730_c1 | nmdc:mga04h51_78730_c1_52_492 | 141 |
| 182 | 3300050496 | nmdc:mga07m45_318123_c1 | nmdc:mga07m45_318123_c1_19_459 | 141 |
| 183 | 3300050511 | nmdc:mga08y16_1450456_c1 | nmdc:mga08y16_1450456_c1_150_602 | 141 |
| 184 | 3300050516 | nmdc:mga0sz30_166942_c1 | nmdc:mga0sz30_166942_c1_53_493 | 141 |
| 185 | 3300053088 | Ga0500644_0001001 | Ga0500644_0001001_6925_7389 | 141 |
| 186 | 3300053094 | Ga0500566_0157209 | Ga0500566_0157209_637_1101 | 141 |
| 187 | 3300053098 | Ga0500650_0071854 | Ga0500650_0071854_580_1035 | 141 |
| 188 | 3300053117 | Ga0500593_000850 | Ga0500593_000850_3096_3560 | 141 |
| 189 | 3300053151 | Ga0500604_0031446 | Ga0500604_0031446_634_1098 | 141 |
| 190 | iso_pu_bacteria | 2513020051 | 2513229413 | 141 |
| 191 | iso_pu_bacteria | 2831265667 | 2831267200 | 141 |
| 192 | iso_pu_bacteria | 2838054893 | 2838056290 | 141 |
| 193 | iso_pu_bacteria | 2928084124 | 2928087312 | 141 |
| 194 | iso_pu_bacteria | 2954767861 | 2954771407 | 141 |
| 195 | 3300002705 | JGI25156J39149_1000025 | JGI25156J39149_1000025104 | 142 |
| 196 | 3300002738 | JGI25154J39366_1000045 | JGI25154J39366_1000045104 | 142 |
| 197 | 3300002741 | JGI25157J39369_1000034 | JGI25157J39369_1000034104 | 142 |
| 198 | 3300002987 | JGI25159J45721_1016993 | JGI25159J45721_10169933 | 142 |
| 199 | 3300003316 | rootH1_10020532 | rootH1_1002053211 | 142 |
| 200 | 3300003322 | rootL2_10070810 | rootL2_100708103 | 142 |
| 201 | 3300003354 | JGI25160J50197_1033700 | JGI25160J50197_10337002 | 142 |
| 202 | 3300003761 | Ga0055535_1000383 | Ga0055535_100038310 | 142 |
| 203 | 3300003762 | Ga0055542_1000268 | Ga0055542_100026834 | 142 |
| 204 | 3300003771 | Ga0055526_1000306 | Ga0055526_100030616 | 142 |
| 205 | 3300003773 | Ga0055537_1000008 | Ga0055537_100000826 | 142 |
| 206 | 3300003775 | Ga0055524_1000075 | Ga0055524_100007534 | 142 |
| 207 | 3300003781 | Ga0055536_1001446 | Ga0055536_10014468 | 142 |
| 208 | 3300003784 | Ga0055534_1007851 | Ga0055534_10078511 | 142 |
| 209 | 3300003790 | Ga0055528_1001296 | Ga0055528_100129615 | 142 |
| 210 | 3300003791 | Ga0055530_10000152 | Ga0055530_1000015226 | 142 |
| 211 | 3300003792 | Ga0055540_1000160 | Ga0055540_100016035 | 142 |
| 212 | 3300003794 | Ga0055531_10000366 | Ga0055531_1000036618 | 142 |
| 213 | 3300005343 | Ga0070687_100520001 | Ga0070687_1005200012 | 142 |
| 214 | 3300005614 | Ga0068856_101806093 | Ga0068856_1018060932 | 142 |
| 215 | 3300005834 | Ga0068851_10191010 | Ga0068851_101910103 | 142 |
| 216 | 3300012502 | Ga0157347_1044152 | Ga0157347_10441522 | 142 |
| 217 | 3300025206 | Ga0209435_100001 | Ga0209435_100001878 | 142 |
| 218 | 3300025228 | Ga0209672_101080 | Ga0209672_10108011 | 142 |
| 219 | 3300025229 | Ga0209147_102883 | Ga0209147_1028835 | 142 |
| 220 | 3300025242 | Ga0209258_100009 | Ga0209258_100009199 | 142 |
| 221 | 3300025245 | Ga0207425_1015793 | Ga0207425_10157933 | 142 |
| 222 | 3300025246 | Ga0209646_1000001 | Ga0209646_10000011247 | 142 |
| 223 | 3300025250 | Ga0209026_1000003 | Ga0209026_1000003878 | 142 |
| 224 | 3300025254 | Ga0209148_1000007 | Ga0209148_1000007199 | 142 |
| 225 | 3300025256 | Ga0209759_1000001 | Ga0209759_1000001878 | 142 |
| 226 | 3300025263 | Ga0209565_1000004 | Ga0209565_1000004787 | 142 |
| 227 | 3300025273 | Ga0209673_1000275 | Ga0209673_10002757 | 142 |
| 228 | 3300025284 | Ga0209130_1000368 | Ga0209130_100036846 | 142 |
| 229 | 3300025291 | Ga0209675_1000044 | Ga0209675_1000044210 | 142 |
| 230 | 3300025292 | Ga0209676_1000029 | Ga0209676_1000029116 | 142 |
| 231 | 3300025294 | Ga0209025_1039050 | Ga0209025_10390503 | 142 |
| 232 | 3300025295 | Ga0209564_1000356 | Ga0209564_100035645 | 142 |
| 233 | 3300025297 | Ga0209758_1062221 | Ga0209758_10622212 | 142 |
| 234 | 3300025297 | Ga0209758_1142133 | Ga0209758_11421331 | 142 |
| 235 | 3300025298 | Ga0209050_1000003 | Ga0209050_1000003178 | 142 |
| 236 | 3300025298 | Ga0209050_1000659 | Ga0209050_100065917 | 142 |
| 237 | 3300025299 | Ga0209256_1000001 | Ga0209256_1000001181 | 142 |
| 238 | 3300025302 | Ga0207426_1005625 | Ga0207426_10056255 | 142 |
| 239 | 3300025303 | Ga0209051_1000003 | Ga0209051_1000003178 | 142 |
| 240 | 3300025303 | Ga0209051_1012141 | Ga0209051_10121412 | 142 |
| 241 | 3300025304 | Ga0209257_1000018 | Ga0209257_1000018178 | 142 |
| 242 | 3300025321 | Ga0207656_10057494 | Ga0207656_100574943 | 142 |
| 243 | 3300026078 | Ga0207702_10619387 | Ga0207702_106193872 | 142 |
| 244 | 3300028794 | Ga0307515_10003072 | Ga0307515_1000307222 | 142 |
| 245 | 3300041404 | Ga0439436_0001553 | Ga0439436_0001553_5355_5810 | 142 |
| 246 | 3300041406 | Ga0439439_0017818 | Ga0439439_0017818_1072_1527 | 142 |
| 247 | 3300041410 | Ga0439461_0017902 | Ga0439461_0017902_358_813 | 142 |
| 248 | 3300041411 | Ga0439466_0023241 | Ga0439466_0023241_679_1134 | 142 |
| 249 | 3300041413 | Ga0439465_0000742 | Ga0439465_0000742_962_1417 | 142 |
| 250 | 3300041453 | Ga0451797_0442460 | Ga0451797_0442460_27_485 | 142 |
| 251 | 3300041460 | Ga0451802_0199705 | Ga0451802_0199705_32_481 | 142 |
| 252 | 3300041486 | Ga0451807_0059783 | Ga0451807_0059783_263_721 | 142 |
| 253 | 3300041511 | Ga0451855_0662111 | Ga0451855_0662111_66_524 | 142 |
| 254 | 3300041512 | Ga0451853_0435475 | Ga0451853_0435475_480_938 | 142 |
| 255 | 3300041997 | Ga0439431_0000629 | Ga0439431_0000629_506_961 | 142 |
| 256 | 3300041999 | Ga0439433_0008566 | Ga0439433_0008566_899_1354 | 142 |
| 257 | 3300042002 | Ga0439442_005571 | Ga0439442_005571_903_1358 | 142 |
| 258 | 3300042004 | Ga0439445_0004954 | Ga0439445_0004954_1563_2018 | 142 |
| 259 | 3300042006 | Ga0439432_004193 | Ga0439432_004193_385_840 | 142 |
| 260 | 3300042007 | Ga0439449_0007761 | Ga0439449_0007761_882_1337 | 142 |
| 261 | 3300042010 | Ga0439452_003292 | Ga0439452_003292_891_1346 | 142 |
| 262 | 3300042014 | Ga0439457_006836 | Ga0439457_006836_998_1453 | 142 |
| 263 | 3300042015 | Ga0439462_0005683 | Ga0439462_0005683_2201_2656 | 142 |
| 264 | 3300042156 | Ga0439446_0004804 | Ga0439446_0004804_818_1273 | 142 |
| 265 | 3300042185 | Ga0450909_048036 | Ga0450909_048036_126_581 | 142 |
| 266 | 3300042435 | Ga0439434_0001149 | Ga0439434_0001149_4553_5008 | 142 |
| 267 | 3300053129 | Ga0500628_007251 | Ga0500628_007251_474_941 | 142 |
| 268 | iso_pu_bacteria | 2643221628 | 2644160349 | 142 |
| 269 | iso_pu_bacteria | 2643221658 | 2644324922 | 142 |
| 270 | iso_pu_bacteria | 2643221672 | 2644396791 | 142 |
| 271 | iso_pu_bacteria | 2842677519 | 2842680476 | 142 |
| 272 | iso_pu_bacteria | 2929520902 | 2929522248 | 142 |
| 273 | iso_pu_bacteria | 2945909444 | 2945910761 | 142 |
| 274 | iso_pu_bacteria | 2945972063 | 2945976364 | 142 |
| 275 | iso_pu_bacteria | 2945984333 | 2945987066 | 142 |
| 276 | 3300002773 | JGI25152J39213_1008693 | JGI25152J39213_10086932 | 143 |
| 277 | 3300002774 | JGI25150J39212_1007481 | JGI25150J39212_10074813 | 143 |
| 278 | 3300002987 | JGI25159J45721_1015335 | JGI25159J45721_10153352 | 143 |
| 279 | 3300003187 | JGI25151J46595_10024131 | JGI25151J46595_100241312 | 143 |
| 280 | 3300003215 | JGI25153J46596_10020571 | JGI25153J46596_100205714 | 143 |
| 281 | 3300003322 | rootL2_10216050 | rootL2_102160502 | 143 |
| 282 | 3300003354 | JGI25160J50197_1016112 | JGI25160J50197_10161122 | 143 |
| 283 | 3300003578 | Ga0006562J51391_1068886 | Ga0006562J51391_10688863 | 143 |
| 284 | 3300003771 | Ga0055526_1013091 | Ga0055526_10130913 | 143 |
| 285 | 3300003773 | Ga0055537_1008016 | Ga0055537_10080164 | 143 |
| 286 | 3300003775 | Ga0055524_1007592 | Ga0055524_10075925 | 143 |
| 287 | 3300003781 | Ga0055536_1002335 | Ga0055536_100233510 | 143 |
| 288 | 3300003784 | Ga0055534_1007895 | Ga0055534_10078952 | 143 |
| 289 | 3300003790 | Ga0055528_1017522 | Ga0055528_10175224 | 143 |
| 290 | 3300003791 | Ga0055530_10001009 | Ga0055530_100010094 | 143 |
| 291 | 3300003792 | Ga0055540_1007680 | Ga0055540_10076805 | 143 |
| 292 | 3300003794 | Ga0055531_10014416 | Ga0055531_100144163 | 143 |
| 293 | 3300004625 | Ga0055543_1000734 | Ga0055543_100073416 | 143 |
| 294 | 3300005262 | Ga0065165_1031273 | Ga0065165_10312732 | 143 |
| 295 | 3300005338 | Ga0068868_100142599 | Ga0068868_1001425993 | 143 |
| 296 | 3300005539 | Ga0068853_100009092 | Ga0068853_1000090926 | 143 |
| 297 | 3300005617 | Ga0068859_100770119 | Ga0068859_1007701192 | 143 |
| 298 | 3300005841 | Ga0068863_100569881 | Ga0068863_1005698813 | 143 |
| 299 | 3300005842 | Ga0068858_100342685 | Ga0068858_1003426853 | 143 |
| 300 | 3300006353 | Ga0075370_10538808 | Ga0075370_105388082 | 143 |
| 301 | 3300006931 | Ga0097620_100770002 | Ga0097620_1007700022 | 143 |
| 302 | 3300009098 | Ga0105245_11194946 | Ga0105245_111949462 | 143 |
| 303 | 3300009553 | Ga0105249_10676030 | Ga0105249_106760302 | 143 |
| 304 | 3300010375 | Ga0105239_10524110 | Ga0105239_105241103 | 143 |
| 305 | 3300011119 | Ga0105246_10589611 | Ga0105246_105896111 | 143 |
| 306 | 3300013104 | Ga0157370_10465254 | Ga0157370_104652542 | 143 |
| 307 | 3300015261 | Ga0182006_1056913 | Ga0182006_10569133 | 143 |
| 308 | 3300015262 | Ga0182007_10079934 | Ga0182007_100799342 | 143 |
| 309 | 3300025245 | Ga0207425_1001945 | Ga0207425_10019458 | 143 |
| 310 | 3300025258 | Ga0209129_1012411 | Ga0209129_10124113 | 143 |
| 311 | 3300025263 | Ga0209565_1005477 | Ga0209565_10054775 | 143 |
| 312 | 3300025273 | Ga0209673_1000329 | Ga0209673_100032979 | 143 |
| 313 | 3300025284 | Ga0209130_1000429 | Ga0209130_100042923 | 143 |
| 314 | 3300025284 | Ga0209130_1001662 | Ga0209130_100166212 | 143 |
| 315 | 3300025291 | Ga0209675_1000791 | Ga0209675_10007916 | 143 |
| 316 | 3300025292 | Ga0209676_1000004 | Ga0209676_1000004306 | 143 |
| 317 | 3300025295 | Ga0209564_1001526 | Ga0209564_10015267 | 143 |
| 318 | 3300025297 | Ga0209758_1004956 | Ga0209758_10049563 | 143 |
| 319 | 3300025298 | Ga0209050_1000002 | Ga0209050_1000002816 | 143 |
| 320 | 3300025299 | Ga0209256_1000472 | Ga0209256_100047249 | 143 |
| 321 | 3300025302 | Ga0207426_1000095 | Ga0207426_1000095156 | 143 |
| 322 | 3300025303 | Ga0209051_1000002 | Ga0209051_1000002584 | 143 |
| 323 | 3300025304 | Ga0209257_1000002 | Ga0209257_1000002725 | 143 |
| 324 | 3300025304 | Ga0209257_1000286 | Ga0209257_1000286103 | 143 |
| 325 | 3300025927 | Ga0207687_10827051 | Ga0207687_108270512 | 143 |
| 326 | 3300025933 | Ga0207706_10899213 | Ga0207706_108992132 | 143 |
| 327 | 3300026023 | Ga0207677_10171696 | Ga0207677_101716961 | 143 |
| 328 | 3300026035 | Ga0207703_10278829 | Ga0207703_102788291 | 143 |
| 329 | 3300026041 | Ga0207639_10016199 | Ga0207639_100161993 | 143 |
| 330 | 3300026088 | Ga0207641_10261285 | Ga0207641_102612852 | 143 |
| 331 | 3300048921 | Ga0496118_0031565 | Ga0496118_0031565_763_1230 | 143 |
| 332 | 3300048927 | Ga0496124_0062766 | Ga0496124_0062766_700_1167 | 143 |
| 333 | 3300053079 | Ga0500610_0314758 | Ga0500610_0314758_39_485 | 143 |
| 334 | iso_pu_bacteria | 2818991446 | 2819599925 | 143 |
| 335 | iso_pu_bacteria | 2899924645 | 2899926663 | 143 |
| 336 | iso_pu_bacteria | 2928037797 | 2928044251 | 143 |
| 337 | iso_pu_bacteria | 2928044640 | 2928048383 | 143 |
| 338 | iso_pu_bacteria | 2928051484 | 2928052349 | 143 |
| 339 | iso_pu_bacteria | 2928064002 | 2928064981 | 143 |
| 340 | 3300003578 | Ga0006562J51391_1066545 | Ga0006562J51391_10665452 | 144 |
| 341 | 3300003792 | Ga0055540_1003160 | Ga0055540_10031605 | 144 |
| 342 | 3300005539 | Ga0068853_101317606 | Ga0068853_1013176061 | 144 |
| 343 | 3300006177 | Ga0075362_10003070 | Ga0075362_100030705 | 144 |
| 344 | 3300006353 | Ga0075370_10028995 | Ga0075370_100289953 | 144 |
| 345 | 3300013100 | Ga0157373_10032221 | Ga0157373_100322212 | 144 |
| 346 | 3300013104 | Ga0157370_10110003 | Ga0157370_101100033 | 144 |
| 347 | 3300014497 | Ga0182008_10065777 | Ga0182008_100657772 | 144 |
| 348 | 3300014497 | Ga0182008_10180430 | Ga0182008_101804302 | 144 |
| 349 | 3300025303 | Ga0209051_1000113 | Ga0209051_100011358 | 144 |
| 350 | 3300026041 | Ga0207639_10817116 | Ga0207639_108171162 | 144 |
| 351 | 3300031548 | Ga0307408_100003238 | Ga0307408_1000032388 | 144 |
| 352 | 3300031649 | Ga0307514_10007518 | Ga0307514_100075189 | 144 |
| 353 | 3300031731 | Ga0307405_10419751 | Ga0307405_104197512 | 144 |
| 354 | 3300031901 | Ga0307406_10004177 | Ga0307406_100041774 | 144 |
| 355 | 3300031911 | Ga0307412_10001515 | Ga0307412_1000151510 | 144 |
| 356 | 3300041407 | Ga0439447_014433 | Ga0439447_014433_793_1260 | 144 |
| 357 | 3300046515 | Ga0495620_0049238 | Ga0495620_0049238_1216_1695 | 144 |
| 358 | 3300046518 | Ga0495631_0000213 | Ga0495631_0000213_24661_25140 | 144 |
| 359 | 3300046520 | Ga0495637_0015117 | Ga0495637_0015117_280_729 | 144 |
| 360 | 3300046539 | Ga0495621_0021481 | Ga0495621_0021481_1162_1641 | 144 |
| 361 | 3300046674 | Ga0495588_0073008 | Ga0495588_0073008_180_647 | 144 |
| 362 | 3300046691 | Ga0495670_0017565 | Ga0495670_0017565_252_701 | 144 |
| 363 | 3300050489 | nmdc:mga03683_2343_c2 | nmdc:mga03683_2343_c2_1972_2418 | 144 |
| 364 | 3300050496 | nmdc:mga07m45_44155_c1 | nmdc:mga07m45_44155_c1_117_587 | 144 |
| 365 | 3300053079 | Ga0500610_0016274 | Ga0500610_0016274_193_642 | 144 |
| 366 | 3300053118 | Ga0500594_0003235 | Ga0500594_0003235_1057_1536 | 144 |
| 367 | 3300053122 | Ga0500608_013352 | Ga0500608_013352_1045_1491 | 144 |
| 368 | 3300002773 | JGI25152J39213_1005692 | JGI25152J39213_10056924 | 145 |
| 369 | 3300002774 | JGI25150J39212_1003638 | JGI25150J39212_10036383 | 145 |
| 370 | 3300002987 | JGI25159J45721_1011767 | JGI25159J45721_10117673 | 145 |
| 371 | 3300003187 | JGI25151J46595_10003810 | JGI25151J46595_100038109 | 145 |
| 372 | 3300003187 | JGI25151J46595_10004984 | JGI25151J46595_100049846 | 145 |
| 373 | 3300003187 | JGI25151J46595_10014158 | JGI25151J46595_100141584 | 145 |
| 374 | 3300003215 | JGI25153J46596_10012915 | JGI25153J46596_100129154 | 145 |
| 375 | 3300003354 | JGI25160J50197_1009623 | JGI25160J50197_10096234 | 145 |
| 376 | 3300003374 | JGI25161J50226_1007181 | JGI25161J50226_10071812 | 145 |
| 377 | 3300003771 | Ga0055526_1013005 | Ga0055526_10130054 | 145 |
| 378 | 3300003773 | Ga0055537_1005152 | Ga0055537_10051524 | 145 |
| 379 | 3300003775 | Ga0055524_1007501 | Ga0055524_10075015 | 145 |
| 380 | 3300003784 | Ga0055534_1005184 | Ga0055534_10051844 | 145 |
| 381 | 3300003790 | Ga0055528_1011269 | Ga0055528_10112694 | 145 |
| 382 | 3300003792 | Ga0055540_1011025 | Ga0055540_10110251 | 145 |
| 383 | 3300003794 | Ga0055531_10014477 | Ga0055531_100144773 | 145 |
| 384 | 3300004625 | Ga0055543_1001161 | Ga0055543_100116111 | 145 |
| 385 | 3300005262 | Ga0065165_1003617 | Ga0065165_100361710 | 145 |
| 386 | 3300005457 | Ga0070662_100365577 | Ga0070662_1003655772 | 145 |
| 387 | 3300006048 | Ga0075363_100067085 | Ga0075363_1000670852 | 145 |
| 388 | 3300006177 | Ga0075362_10001902 | Ga0075362_100019026 | 145 |
| 389 | 3300006178 | Ga0075367_10026891 | Ga0075367_100268913 | 145 |
| 390 | 3300006195 | Ga0075366_10062422 | Ga0075366_100624223 | 145 |
| 391 | 3300006353 | Ga0075370_10007301 | Ga0075370_100073016 | 145 |
| 392 | 3300009036 | Ga0105244_10000502 | Ga0105244_100005028 | 145 |
| 393 | 3300009036 | Ga0105244_10035841 | Ga0105244_100358414 | 145 |
| 394 | 3300009098 | Ga0105245_10516603 | Ga0105245_105166032 | 145 |
| 395 | 3300009148 | Ga0105243_10003756 | Ga0105243_1000375611 | 145 |
| 396 | 3300009148 | Ga0105243_10187338 | Ga0105243_101873382 | 145 |
| 397 | 3300009174 | Ga0105241_10846207 | Ga0105241_108462071 | 145 |
| 398 | 3300009176 | Ga0105242_10085806 | Ga0105242_100858061 | 145 |
| 399 | 3300009551 | Ga0105238_10199819 | Ga0105238_101998192 | 145 |
| 400 | 3300010375 | Ga0105239_10634025 | Ga0105239_106340251 | 145 |
| 401 | 3300011119 | Ga0105246_10404474 | Ga0105246_104044742 | 145 |
| 402 | 3300014497 | Ga0182008_10002006 | Ga0182008_1000200610 | 145 |
| 403 | 3300015262 | Ga0182007_10000238 | Ga0182007_1000023830 | 145 |
| 404 | 3300017792 | Ga0163161_10189527 | Ga0163161_101895272 | 145 |
| 405 | 3300025208 | Ga0209436_107788 | Ga0209436_1077882 | 145 |
| 406 | 3300025245 | Ga0207425_1000266 | Ga0207425_100026615 | 145 |
| 407 | 3300025258 | Ga0209129_1000013 | Ga0209129_1000013447 | 145 |
| 408 | 3300025258 | Ga0209129_1003830 | Ga0209129_10038306 | 145 |
| 409 | 3300025263 | Ga0209565_1000228 | Ga0209565_100022843 | 145 |
| 410 | 3300025273 | Ga0209673_1000309 | Ga0209673_100030974 | 145 |
| 411 | 3300025284 | Ga0209130_1000284 | Ga0209130_100028424 | 145 |
| 412 | 3300025291 | Ga0209675_1000238 | Ga0209675_100023855 | 145 |
| 413 | 3300025292 | Ga0209676_1003498 | Ga0209676_10034986 | 145 |
| 414 | 3300025294 | Ga0209025_1000155 | Ga0209025_10001555 | 145 |
| 415 | 3300025294 | Ga0209025_1000393 | Ga0209025_100039327 | 145 |
| 416 | 3300025294 | Ga0209025_1018473 | Ga0209025_10184732 | 145 |
| 417 | 3300025295 | Ga0209564_1000222 | Ga0209564_1000222115 | 145 |
| 418 | 3300025297 | Ga0209758_1000134 | Ga0209758_1000134157 | 145 |
| 419 | 3300025299 | Ga0209256_1000060 | Ga0209256_1000060224 | 145 |
| 420 | 3300025302 | Ga0207426_1000100 | Ga0207426_1000100224 | 145 |
| 421 | 3300025303 | Ga0209051_1014263 | Ga0209051_10142632 | 145 |
| 422 | 3300025304 | Ga0209257_1001890 | Ga0209257_100189024 | 145 |
| 423 | 3300025935 | Ga0207709_10101503 | Ga0207709_101015032 | 145 |
| 424 | 3300030744 | Ga0316181_1276434 | Ga0316181_12764342 | 145 |
| 425 | 3300031548 | Ga0307408_100186826 | Ga0307408_1001868262 | 145 |
| 426 | 3300031731 | Ga0307405_10074261 | Ga0307405_100742613 | 145 |
| 427 | 3300031911 | Ga0307412_10150105 | Ga0307412_101501052 | 145 |
| 428 | 3300031911 | Ga0307412_10356873 | Ga0307412_103568732 | 145 |
| 429 | 3300032002 | Ga0307416_100457423 | Ga0307416_1004574232 | 145 |
| 430 | 3300041404 | Ga0439436_0022471 | Ga0439436_0022471_519_989 | 145 |
| 431 | 3300041408 | Ga0439453_0176427 | Ga0439453_0176427_23_493 | 145 |
| 432 | 3300041411 | Ga0439466_0022338 | Ga0439466_0022338_699_1169 | 145 |
| 433 | 3300041413 | Ga0439465_0113659 | Ga0439465_0113659_277_747 | 145 |
| 434 | 3300041999 | Ga0439433_0009010 | Ga0439433_0009010_994_1464 | 145 |
| 435 | 3300042002 | Ga0439442_060905 | Ga0439442_060905_226_696 | 145 |
| 436 | 3300042006 | Ga0439432_004226 | Ga0439432_004226_1991_2461 | 145 |
| 437 | 3300042007 | Ga0439449_0003387 | Ga0439449_0003387_2782_3252 | 145 |
| 438 | 3300042014 | Ga0439457_102484 | Ga0439457_102484_114_584 | 145 |
| 439 | 3300042015 | Ga0439462_0017364 | Ga0439462_0017364_1029_1499 | 145 |
| 440 | 3300042131 | Ga0450894_004279 | Ga0450894_004279_657_1127 | 145 |
| 441 | 3300042134 | Ga0450898_050433 | Ga0450898_050433_80_553 | 145 |
| 442 | 3300042135 | Ga0450899_033330 | Ga0450899_033330_87_557 | 145 |
| 443 | 3300042145 | Ga0450906_013444 | Ga0450906_013444_835_1305 | 145 |
| 444 | 3300042146 | Ga0450907_016921 | Ga0450907_016921_428_898 | 145 |
| 445 | 3300042156 | Ga0439446_0030157 | Ga0439446_0030157_69_539 | 145 |
| 446 | 3300046530 | Ga0495654_0025029 | Ga0495654_0025029_2521_2973 | 145 |
| 447 | 3300046616 | Ga0495668_0294062 | Ga0495668_0294062_357_830 | 145 |
| 448 | 3300046674 | Ga0495588_0034286 | Ga0495588_0034286_331_801 | 145 |
| 449 | 3300046692 | Ga0495671_0019710 | Ga0495671_0019710_162_614 | 145 |
| 450 | 3300046810 | Ga0495660_0136534 | Ga0495660_0136534_336_794 | 145 |
| 451 | 3300047321 | Ga0495676_0003920 | Ga0495676_0003920_11817_12287 | 145 |
| 452 | 3300047673 | Ga0495593_0016801 | Ga0495593_0016801_1043_1513 | 145 |
| 453 | 3300048088 | Ga0495602_0102266 | Ga0495602_0102266_1784_2254 | 145 |
| 454 | 3300048089 | Ga0495614_0006647 | Ga0495614_0006647_2161_2631 | 145 |
| 455 | 3300048919 | Ga0496116_0016032 | Ga0496116_0016032_2277_2729 | 145 |
| 456 | 3300048920 | Ga0496117_0097036 | Ga0496117_0097036_826_1272 | 145 |
| 457 | 3300048920 | Ga0496117_0285045 | Ga0496117_0285045_269_739 | 145 |
| 458 | 3300048921 | Ga0496118_0026578 | Ga0496118_0026578_3873_4319 | 145 |
| 459 | 3300048924 | Ga0496121_0093851 | Ga0496121_0093851_1344_1850 | 145 |
| 460 | 3300048924 | Ga0496121_0537772 | Ga0496121_0537772_151_621 | 145 |
| 461 | 3300048925 | Ga0496122_0175360 | Ga0496122_0175360_161_673 | 145 |
| 462 | 3300048925 | Ga0496122_0216818 | Ga0496122_0216818_112_585 | 145 |
| 463 | 3300048926 | Ga0496123_0282932 | Ga0496123_0282932_125_598 | 145 |
| 464 | 3300048928 | Ga0496125_0045744 | Ga0496125_0045744_785_1237 | 145 |
| 465 | 3300050493 | nmdc:mga0k408_10327_c2 | nmdc:mga0k408_10327_c2_826_1299 | 145 |
| 466 | 3300050493 | nmdc:mga0k408_138126_c1 | nmdc:mga0k408_138126_c1_968_1420 | 145 |
| 467 | 3300050494 | nmdc:mga06z11_423866_c1 | nmdc:mga06z11_423866_c1_50_502 | 145 |
| 468 | 3300050496 | nmdc:mga07m45_20234_c1 | nmdc:mga07m45_20234_c1_1018_1470 | 145 |
| 469 | 3300053079 | Ga0500610_0008818 | Ga0500610_0008818_3776_4228 | 145 |
| 470 | 3300053093 | Ga0500651_0000189 | Ga0500651_0000189_23994_24464 | 145 |
| 471 | 3300053094 | Ga0500566_0045842 | Ga0500566_0045842_728_1198 | 145 |
| 472 | 3300053110 | Ga0500571_000045 | Ga0500571_000045_14613_15083 | 145 |
| 473 | 3300053117 | Ga0500593_014332 | Ga0500593_014332_2712_3164 | 145 |
| 474 | 3300053120 | Ga0500597_004697 | Ga0500597_004697_2357_2851 | 145 |
| 475 | 3300053121 | Ga0500607_002838 | Ga0500607_002838_2848_3300 | 145 |
| 476 | 3300053123 | Ga0500614_009430 | Ga0500614_009430_227_721 | 145 |
| 477 | 3300053133 | Ga0500655_001735 | Ga0500655_001735_1333_1809 | 145 |
| 478 | 3300053134 | Ga0500658_0000288 | Ga0500658_0000288_14473_14943 | 145 |
| 479 | 3300053136 | Ga0500559_0048729 | Ga0500559_0048729_1176_1649 | 145 |
| 480 | 3300053141 | Ga0500574_000524 | Ga0500574_000524_3109_3579 | 145 |
| 481 | 3300053153 | Ga0500616_0027608 | Ga0500616_0027608_465_941 | 145 |
| 482 | 3300053154 | Ga0500619_117727 | Ga0500619_117727_378_848 | 145 |
| 483 | 3300053157 | Ga0500624_004701 | Ga0500624_004701_219_689 | 145 |
| 484 | 3300053158 | Ga0500627_0036706 | Ga0500627_0036706_1105_1557 | 145 |
| 485 | 3300053162 | Ga0500638_068784 | Ga0500638_068784_660_1136 | 145 |
| 486 | 3300053177 | Ga0500636_0311274 | Ga0500636_0311274_196_690 | 145 |
| 487 | 3300053178 | Ga0500637_0158572 | Ga0500637_0158572_164_658 | 145 |
| 488 | iso_pu_bacteria | 2738543012 | 2739246984 | 145 |
| 489 | 3300003781 | Ga0055536_1006749 | Ga0055536_10067495 | 146 |
| 490 | 3300003781 | Ga0055536_1007454 | Ga0055536_10074545 | 146 |
| 491 | 3300003792 | Ga0055540_1000814 | Ga0055540_10008145 | 146 |
| 492 | 3300003792 | Ga0055540_1004863 | Ga0055540_10048635 | 146 |
| 493 | 3300003794 | Ga0055531_10006028 | Ga0055531_100060287 | 146 |
| 494 | 3300003794 | Ga0055531_10065219 | Ga0055531_100652192 | 146 |
| 495 | 3300005288 | Ga0065714_10008290 | Ga0065714_100082906 | 146 |
| 496 | 3300006038 | Ga0075365_10008398 | Ga0075365_100083984 | 146 |
| 497 | 3300006051 | Ga0075364_10053464 | Ga0075364_100534643 | 146 |
| 498 | 3300006051 | Ga0075364_10632834 | Ga0075364_106328342 | 146 |
| 499 | 3300006058 | Ga0075432_10003731 | Ga0075432_100037315 | 146 |
| 500 | 3300006177 | Ga0075362_10005583 | Ga0075362_100055835 | 146 |
| 501 | 3300006177 | Ga0075362_10042610 | Ga0075362_100426103 | 146 |
| 502 | 3300006178 | Ga0075367_10695906 | Ga0075367_106959062 | 146 |
| 503 | 3300006948 | Ga0099826_10072488 | Ga0099826_100724882 | 146 |
| 504 | 3300009148 | Ga0105243_10219506 | Ga0105243_102195062 | 146 |
| 505 | 3300025273 | Ga0209673_1003191 | Ga0209673_10031913 | 146 |
| 506 | 3300025292 | Ga0209676_1000162 | Ga0209676_100016250 | 146 |
| 507 | 3300025292 | Ga0209676_1000206 | Ga0209676_100020627 | 146 |
| 508 | 3300025298 | Ga0209050_1000512 | Ga0209050_100051242 | 146 |
| 509 | 3300025303 | Ga0209051_1000274 | Ga0209051_100027492 | 146 |
| 510 | 3300025303 | Ga0209051_1000311 | Ga0209051_100031125 | 146 |
| 511 | 3300025304 | Ga0209257_1000432 | Ga0209257_100043271 | 146 |
| 512 | 3300025304 | Ga0209257_1006446 | Ga0209257_10064467 | 146 |
| 513 | 3300025935 | Ga0207709_10000765 | Ga0207709_100007655 | 146 |
| 514 | 3300025938 | Ga0207704_10151467 | Ga0207704_101514672 | 146 |
| 515 | 3300025972 | Ga0207668_10610967 | Ga0207668_106109672 | 146 |
| 516 | 3300026089 | Ga0207648_10344594 | Ga0207648_103445943 | 146 |
| 517 | 3300027666 | Ga0209282_1067696 | Ga0209282_10676962 | 146 |
| 518 | 3300027907 | Ga0207428_10273130 | Ga0207428_102731302 | 146 |
| 519 | 3300030731 | Ga0316177_1063076 | Ga0316177_10630762 | 146 |
| 520 | 3300030733 | Ga0314311_1027081 | Ga0314311_10270815 | 146 |
| 521 | 3300030735 | Ga0316178_1129918 | Ga0316178_11299182 | 146 |
| 522 | 3300030736 | Ga0316180_1028766 | Ga0316180_10287665 | 146 |
| 523 | 3300030742 | Ga0316183_1073027 | Ga0316183_10730279 | 146 |
| 524 | 3300030745 | Ga0316182_1019128 | Ga0316182_10191284 | 146 |
| 525 | 3300031548 | Ga0307408_100242316 | Ga0307408_1002423163 | 146 |
| 526 | 3300031824 | Ga0307413_10486727 | Ga0307413_104867272 | 146 |
| 527 | 3300031901 | Ga0307406_10347585 | Ga0307406_103475852 | 146 |
| 528 | 3300031901 | Ga0307406_11327876 | Ga0307406_113278761 | 146 |
| 529 | 3300031911 | Ga0307412_10083720 | Ga0307412_100837203 | 146 |
| 530 | 3300032002 | Ga0307416_100305808 | Ga0307416_1003058082 | 146 |
| 531 | 3300032002 | Ga0307416_100376140 | Ga0307416_1003761402 | 146 |
| 532 | 3300032004 | Ga0307414_10420514 | Ga0307414_104205142 | 146 |
| 533 | 3300032005 | Ga0307411_10145911 | Ga0307411_101459112 | 146 |
| 534 | 3300041405 | Ga0439438_120254 | Ga0439438_120254_79_543 | 146 |
| 535 | 3300042002 | Ga0439442_001238 | Ga0439442_001238_1183_1647 | 146 |
| 536 | 3300042007 | Ga0439449_0166328 | Ga0439449_0166328_158_622 | 146 |
| 537 | 3300042121 | Ga0450919_010907 | Ga0450919_010907_552_1016 | 146 |
| 538 | 3300042128 | Ga0450897_031878 | Ga0450897_031878_67_531 | 146 |
| 539 | 3300042134 | Ga0450898_035011 | Ga0450898_035011_167_655 | 146 |
| 540 | 3300042134 | Ga0450898_118575 | Ga0450898_118575_49_537 | 146 |
| 541 | 3300042145 | Ga0450906_028018 | Ga0450906_028018_450_914 | 146 |
| 542 | 3300042184 | Ga0450908_001834 | Ga0450908_001834_276_740 | 146 |
| 543 | 3300042435 | Ga0439434_0025836 | Ga0439434_0025836_140_604 | 146 |
| 544 | 3300042531 | Ga0450918_013312 | Ga0450918_013312_176_640 | 146 |
| 545 | 3300044683 | Ga0466965_0050591 | Ga0466965_0050591_49_519 | 146 |
| 546 | 3300044901 | Ga0466960_0066357 | Ga0466960_0066357_1113_1583 | 146 |
| 547 | 3300046660 | Ga0495625_0000057 | Ga0495625_0000057_37369_37833 | 146 |
| 548 | 3300049705 | Ga0501225_0005947 | Ga0501225_0005947_1962_2417 | 146 |
| 549 | 3300049759 | Ga0501262_000600 | Ga0501262_000600_860_1315 | 146 |
| 550 | 3300050489 | nmdc:mga03683_25557_c1 | nmdc:mga03683_25557_c1_952_1416 | 146 |
| 551 | 3300050490 | nmdc:mga03n38_311727_c1 | nmdc:mga03n38_311727_c1_204_668 | 146 |
| 552 | 3300050491 | nmdc:mga00v17_116241_c1 | nmdc:mga00v17_116241_c1_865_1326 | 146 |
| 553 | 3300050491 | nmdc:mga00v17_98016_c1 | nmdc:mga00v17_98016_c1_339_803 | 146 |
| 554 | 3300050492 | nmdc:mga0yw44_52589_c1 | nmdc:mga0yw44_52589_c1_1982_2446 | 146 |
| 555 | 3300050493 | nmdc:mga0k408_85111_c1 | nmdc:mga0k408_85111_c1_235_699 | 146 |
| 556 | 3300050494 | nmdc:mga06z11_256770_c1 | nmdc:mga06z11_256770_c1_468_932 | 146 |
| 557 | 3300050516 | nmdc:mga0sz30_407319_c1 | nmdc:mga0sz30_407319_c1_77_562 | 146 |
| 558 | 3300025933 | Ga0207706_10001106 | Ga0207706_1000110621 | 147 |
| 559 | 3300026075 | Ga0207708_10706978 | Ga0207708_107069782 | 147 |
| 560 | 3300026142 | Ga0207698_10087597 | Ga0207698_100875974 | 147 |
| 561 | iso_pu_bacteria | 2599185178 | 2599444230 | 147 |
| 562 | iso_pu_bacteria | 2900577576 | 2900579431 | 147 |
| 563 | iso_pu_bacteria | 2904541872 | 2904548704 | 147 |
| 564 | iso_pu_bacteria | 2929160207 | 2929164630 | 147 |
| 565 | 3300050493 | nmdc:mga0k408_6552_c1 | nmdc:mga0k408_6552_c1_5638_6132 | 148 |
| 566 | 3300003187 | JGI25151J46595_10056192 | JGI25151J46595_100561922 | 149 |
| 567 | 3300025294 | Ga0209025_1000133 | Ga0209025_10001335 | 149 |
| 568 | 3300050493 | nmdc:mga0k408_138650_c1 | nmdc:mga0k408_138650_c1_865_1362 | 149 |
| 569 | 3300001979 | JGI24740J21852_10000867 | JGI24740J21852_1000086712 | 151 |
| 570 | 3300003751 | Ga0055538_1006381 | Ga0055538_10063812 | 151 |
| 571 | 3300003751 | Ga0055538_1006418 | Ga0055538_10064182 | 151 |
| 572 | 3300003752 | Ga0055539_1000062 | Ga0055539_10000623 | 151 |
| 573 | 3300003758 | Ga0055532_1000019 | Ga0055532_1000019259 | 151 |
| 574 | 3300003759 | Ga0055525_1001977 | Ga0055525_10019772 | 151 |
| 575 | 3300003760 | Ga0055527_1001936 | Ga0055527_10019363 | 151 |
| 576 | 3300003761 | Ga0055535_1000014 | Ga0055535_100001422 | 151 |
| 577 | 3300003763 | Ga0055529_1000086 | Ga0055529_10000863 | 151 |
| 578 | 3300003763 | Ga0055529_1000368 | Ga0055529_100036838 | 151 |
| 579 | 3300005344 | Ga0070661_100000088 | Ga0070661_10000008821 | 151 |
| 580 | 3300005455 | Ga0070663_100000010 | Ga0070663_1000000108 | 151 |
| 581 | 3300005564 | Ga0070664_100000005 | Ga0070664_100000005195 | 151 |
| 582 | 3300005577 | Ga0068857_100077103 | Ga0068857_1000771034 | 151 |
| 583 | 3300005578 | Ga0068854_100000104 | Ga0068854_10000010459 | 151 |
| 584 | 3300005614 | Ga0068856_100000054 | Ga0068856_1000000548 | 151 |
| 585 | 3300009093 | Ga0105240_10012374 | Ga0105240_100123744 | 151 |
| 586 | 3300013100 | Ga0157373_10002976 | Ga0157373_100029765 | 151 |
| 587 | 3300013102 | Ga0157371_10000103 | Ga0157371_10000103106 | 151 |
| 588 | 3300013104 | Ga0157370_10000513 | Ga0157370_1000051323 | 151 |
| 589 | 3300013105 | Ga0157369_10010547 | Ga0157369_100105477 | 151 |
| 590 | 3300013307 | Ga0157372_10000461 | Ga0157372_100004619 | 151 |
| 591 | 3300015261 | Ga0182006_1006704 | Ga0182006_10067048 | 151 |
| 592 | 3300020077 | Ga0206351_10043555 | Ga0206351_100435552 | 151 |
| 593 | 3300020610 | Ga0154015_1157234 | Ga0154015_11572342 | 151 |
| 594 | 3300025224 | Ga0209784_100003 | Ga0209784_1000031253 | 151 |
| 595 | 3300025225 | Ga0209566_100002 | Ga0209566_1000022207 | 151 |
| 596 | 3300025225 | Ga0209566_100785 | Ga0209566_10078516 | 151 |
| 597 | 3300025226 | Ga0209674_100094 | Ga0209674_10009424 | 151 |
| 598 | 3300025226 | Ga0209674_102222 | Ga0209674_1022225 | 151 |
| 599 | 3300025228 | Ga0209672_100408 | Ga0209672_10040825 | 151 |
| 600 | 3300025229 | Ga0209147_100002 | Ga0209147_1000021160 | 151 |
| 601 | 3300025230 | Ga0209563_100004 | Ga0209563_1000041624 | 151 |
| 602 | 3300025242 | Ga0209258_100002 | Ga0209258_1000021160 | 151 |
| 603 | 3300025253 | Ga0209677_100009 | Ga0209677_1000098 | 151 |
| 604 | 3300025254 | Ga0209148_1003163 | Ga0209148_10031634 | 151 |
| 605 | 3300025256 | Ga0209759_1002059 | Ga0209759_100205910 | 151 |
| 606 | 3300025256 | Ga0209759_1002381 | Ga0209759_10023814 | 151 |
| 607 | 3300025272 | Ga0209455_1000076 | Ga0209455_1000076257 | 151 |
| 608 | 3300025913 | Ga0207695_10002145 | Ga0207695_1000214516 | 151 |
| 609 | 3300025920 | Ga0207649_10000098 | Ga0207649_1000009858 | 151 |
| 610 | 3300025945 | Ga0207679_10000020 | Ga0207679_10000020188 | 151 |
| 611 | 3300025981 | Ga0207640_10000092 | Ga0207640_1000009268 | 151 |
| 612 | 3300026067 | Ga0207678_10000181 | Ga0207678_1000018142 | 151 |
| 613 | 3300026078 | Ga0207702_10000017 | Ga0207702_10000017188 | 151 |
| 614 | 3300026116 | Ga0207674_10137420 | Ga0207674_101374203 | 151 |
| 615 | 3300037418 | Ga0395900_0031258 | Ga0395900_0031258_2258_2713 | 151 |
| 616 | 3300048928 | Ga0496125_0021624 | Ga0496125_0021624_756_1211 | 151 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2dg6-assembly1.cif.gz_A-2 | crystal structure of the putative transcriptional regulator sco5550 from streptomyces coelicolor a3(2) | 0.8822 | 9 | 78 |
| 5i44-assembly4.cif.gz_E | structure of raca-dna complex; p21 form | 0.8681 | 8 | 69 |
| 7npe-assembly1.cif.gz_B | vibrio cholerae para2-adp | 0.8477 | 8 | 55 |
| 5i44-assembly4.cif.gz_I-2 | structure of raca-dna complex; p21 form | 0.8454 | 9 | 69 |
| 5i44-assembly4.cif.gz_G-2 | structure of raca-dna complex; p21 form | 0.8427 | 7 | 71 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O06302_4_79_1.10.1660.10 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.8846 | 8 | 73 | 1.10.1660.10 |
| 3hh0D01 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.8821 | 9 | 76 | 1.10.1660.10 |
| 3hh0C01 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.8591 | 9 | 73 | 1.10.1660.10 |
| 5i44J00 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.857 | 8 | 69 | 1.10.1660.10 |
| 3hh0B01 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.8551 | 8 | 73 | 1.10.1660.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N3JBU2-F1-model_v4 | deleted | 0.9714 | 8 | 106 |
|
| AF-A0A4Q2IKR1-F1-model_v4 | deleted | 0.9381 | 9 | 91 |
|
| AF-X2JTA8-F1-model_v4 | deleted | 0.9272 | 9 | 95 |
|
| AF-A0A174E158-F1-model_v4 | Putative transcriptional regulator | 0.9207 | 8 | 126 |
GO:0003677
GO:0003700 |
| AF-A0A4Q2IKR1-F1-model_v4 | deleted | 0.9173 | 9 | 91 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar