F469417

General Info

Members Datasets Scaffolds Average Seq Length
615 197 615 226

Family's Representative Sequence

Representative Sequence 3300005354|Ga0070675_100147748|Ga0070675_1001477482
Length 240
Sequence MENRLNKPLVLAMVAIAXXXXVLVGMTTGVASWLFGGPNPKTIASASLESMRAQNRLIAFTARYVSVTTSTQSQLGFSAKRTLILPGDVRYELDLSRLQPKDVTWDKATSTLKVRLPEIEIAGPDVDLSAAQEYGQGGILSAFTNANQALDSANRAKAVADLRKQAQGAVQMRLAHQAARAAIERSFAMPLVAAGFKDVRVVARFPTEGTDDPSYLDLSTPYEEAIKEAERRRAAAGGTK

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
151 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
152 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
153 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
155 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
163 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
164 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
165 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
166 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
167 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
170 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
171 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
172 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
173 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
174 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
175 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
176 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
177 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
178 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
179 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
197 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.16
Nodule 0
Rhizoplane 7.8
Rhizosphere 91.38
Stem 0
Stem Tuber 0
Unclassified 0.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1007296 3300001904 Bacteria 1859
2 JGI24737J22298_10001894 3300001990 Bacteria 7474
3 JGI24737J22298_10005411 3300001990 Bacteria 4411
4 JGI24737J22298_10026179 3300001990 Bacteria 1842
5 JGI24737J22298_10034678 3300001990 Bacteria 1564
6 JGI24744J21845_10004489 3300002077 Bacteria 2884
7 Ga0070658_10024468 3300005327 Bacteria 4844
8 Ga0070658_10074881 3300005327 Bacteria 2776
9 Ga0070658_10610531 3300005327 Bacteria 945
10 Ga0070658_10642189 3300005327 Bacteria 921
11 Ga0070676_10120049 3300005328 Bacteria 1649
12 Ga0070676_10246682 3300005328 Bacteria 1190
13 Ga0070676_10290914 3300005328 Bacteria 1104
14 Ga0070683_101048052 3300005329 Unclassified 783
15 Ga0070690_100002792 3300005330 Bacteria 9428
16 Ga0070690_100002955 3300005330 Bacteria 9188
17 Ga0070670_100007203 3300005331 Bacteria 9420
18 Ga0070670_100043485 3300005331 Bacteria 3861
19 Ga0070670_100056656 3300005331 Bacteria 3364
20 Ga0070670_100082321 3300005331 Bacteria 2766
21 Ga0070670_100144501 3300005331 Bacteria 2058
22 Ga0070670_100380843 3300005331 Bacteria 1243
23 Ga0070670_100926689 3300005331 Bacteria 790
24 Ga0068869_100189041 3300005334 Bacteria 1618
25 Ga0070666_10001353 3300005335 Bacteria 14885
26 Ga0070666_10005625 3300005335 Bacteria 7688
27 Ga0070666_10066999 3300005335 Bacteria 2437
28 Ga0068868_100000361 3300005338 Bacteria 30888
29 Ga0068868_100189023 3300005338 Bacteria 1712
30 Ga0068868_100206603 3300005338 Bacteria 1639
31 Ga0068868_100419493 3300005338 Bacteria 1158
32 Ga0068868_100446099 3300005338 Bacteria 1125
33 Ga0068868_100614772 3300005338 Bacteria 964
34 Ga0070660_100022241 3300005339 Bacteria 4686
35 Ga0070660_100087759 3300005339 Bacteria 2448
36 Ga0070660_100119903 3300005339 Bacteria 2099
37 Ga0070660_100128357 3300005339 Bacteria 2028
38 Ga0070660_100161533 3300005339 Bacteria 1805
39 Ga0070660_100167016 3300005339 Bacteria 1776
40 Ga0070660_100655125 3300005339 Bacteria 879
41 Ga0070689_100644189 3300005340 Bacteria 921
42 Ga0070661_100026820 3300005344 Bacteria 4145
43 Ga0070661_100167835 3300005344 Bacteria 1666
44 Ga0070661_100186449 3300005344 Bacteria 1580
45 Ga0070661_100240164 3300005344 Bacteria 1395
46 Ga0070661_100451747 3300005344 Bacteria 1022
47 Ga0070668_100022684 3300005347 Bacteria 4746
48 Ga0070669_100074968 3300005353 Bacteria 2508
49 Ga0070675_100060619 3300005354 Bacteria 3124
50 Ga0070675_100147748 3300005354 Bacteria 2013
51 Ga0070675_100175059 3300005354 Bacteria 1853
52 Ga0070675_100474116 3300005354 Bacteria 1125
53 Ga0070671_100001412 3300005355 Bacteria 17944
54 Ga0070671_100005114 3300005355 Bacteria 10448
55 Ga0070671_100009375 3300005355 Bacteria 7862
56 Ga0070671_100010501 3300005355 Bacteria 7432
57 Ga0070671_100020832 3300005355 Bacteria 5348
58 Ga0070671_100021658 3300005355 Bacteria 5250
59 Ga0070671_100118784 3300005355 Bacteria 2224
60 Ga0070671_100442460 3300005355 Bacteria 1114
61 Ga0070674_100008467 3300005356 Bacteria 6124
62 Ga0070674_100091658 3300005356 Bacteria 2195
63 Ga0070674_100123160 3300005356 Bacteria 1922
64 Ga0070674_100139601 3300005356 Bacteria 1817
65 Ga0070674_100251960 3300005356 Bacteria 1387
66 Ga0070674_100463738 3300005356 Bacteria 1048
67 Ga0070673_100002274 3300005364 Bacteria 11647
68 Ga0070673_100004701 3300005364 Bacteria 8666
69 Ga0070673_100027429 3300005364 Bacteria 4222
70 Ga0070673_100140151 3300005364 Bacteria 2039
71 Ga0070673_100220413 3300005364 Bacteria 1642
72 Ga0070673_100323193 3300005364 Bacteria 1363
73 Ga0070673_100324582 3300005364 Bacteria 1360
74 Ga0070673_100443017 3300005364 Bacteria 1167
75 Ga0070659_100001160 3300005366 Bacteria 19249
76 Ga0070659_100009353 3300005366 Bacteria 7197
77 Ga0070659_100015652 3300005366 Bacteria 5682
78 Ga0070659_100150808 3300005366 Bacteria 1896
79 Ga0070659_100163506 3300005366 Bacteria 1821
80 Ga0070659_100193656 3300005366 Bacteria 1672
81 Ga0070659_100230858 3300005366 Bacteria 1529
82 Ga0070659_100246829 3300005366 Bacteria 1479
83 Ga0070659_100301752 3300005366 Unclassified 1336
84 Ga0070659_100508445 3300005366 Bacteria 1027
85 Ga0070659_100637820 3300005366 Bacteria 918
86 Ga0070667_100001049 3300005367 Bacteria 25211
87 Ga0070667_100011536 3300005367 Bacteria 7305
88 Ga0070667_100018267 3300005367 Bacteria 5813
89 Ga0070667_100022237 3300005367 Bacteria 5261
90 Ga0070667_100362839 3300005367 Bacteria 1313
91 Ga0070709_10395220 3300005434 Bacteria 1031
92 Ga0070714_100045285 3300005435 Bacteria 3728
93 Ga0070701_10275556 3300005438 Bacteria 1025
94 Ga0070694_100015514 3300005444 Bacteria 4787
95 Ga0070694_100040131 3300005444 Bacteria 3119
96 Ga0070663_100018540 3300005455 Bacteria 4567
97 Ga0070663_100042182 3300005455 Bacteria 3205
98 Ga0070663_100579506 3300005455 Bacteria 941
99 Ga0070678_100001074 3300005456 Bacteria 14303
100 Ga0070678_100187659 3300005456 Bacteria 1697
101 Ga0070662_100002595 3300005457 Bacteria 11141
102 Ga0070662_100005920 3300005457 Bacteria 7843
103 Ga0070662_100012893 3300005457 Bacteria 5554
104 Ga0070662_100048413 3300005457 Bacteria 3062
105 Ga0070662_100062282 3300005457 Bacteria 2725
106 Ga0070662_100144033 3300005457 Bacteria 1850
107 Ga0070681_10853753 3300005458 Bacteria 828
108 Ga0068867_100010641 3300005459 Bacteria 6491
109 Ga0068867_100244514 3300005459 Bacteria 1456
110 Ga0068867_100305419 3300005459 Bacteria 1313
111 Ga0070685_10117234 3300005466 Bacteria 1649
112 Ga0070706_100577308 3300005467 Bacteria 1045
113 Ga0070684_100546347 3300005535 Bacteria 1075
114 Ga0068853_100023203 3300005539 Bacteria 5191
115 Ga0068853_100321344 3300005539 Bacteria 1435
116 Ga0068853_100341810 3300005539 Bacteria 1391
117 Ga0068853_100933541 3300005539 Bacteria 834
118 Ga0070672_100000482 3300005543 Bacteria 23162
119 Ga0070672_100004242 3300005543 Bacteria 9373
120 Ga0070672_100047113 3300005543 Bacteria 3344
121 Ga0070672_100066550 3300005543 Bacteria 2853
122 Ga0070672_100140288 3300005543 Bacteria 1993
123 Ga0070672_100456112 3300005543 Bacteria 1102
124 Ga0070672_100524754 3300005543 Bacteria 1026
125 Ga0070672_100634006 3300005543 Bacteria 933
126 Ga0070686_100027669 3300005544 Bacteria 3433
127 Ga0070686_100050577 3300005544 Bacteria 2642
128 Ga0070686_100577278 3300005544 Bacteria 883
129 Ga0070695_100087122 3300005545 Bacteria 2077
130 Ga0070696_100012858 3300005546 Bacteria 5618
131 Ga0070696_100061179 3300005546 Bacteria 2634
132 Ga0070665_100006491 3300005548 Bacteria 11899
133 Ga0070665_100013915 3300005548 Bacteria 8092
134 Ga0070665_100019486 3300005548 Bacteria 6810
135 Ga0070665_100039773 3300005548 Bacteria 4726
136 Ga0070665_100652199 3300005548 Bacteria 1066
137 Ga0068855_100604952 3300005563 Bacteria 1182
138 Ga0070664_100002900 3300005564 Bacteria 13875
139 Ga0070664_100010573 3300005564 Bacteria 7480
140 Ga0070664_100052207 3300005564 Bacteria 3462
141 Ga0070664_100076363 3300005564 Bacteria 2879
142 Ga0070664_100078152 3300005564 Bacteria 2846
143 Ga0068857_100028584 3300005577 Bacteria 4920
144 Ga0068857_100131180 3300005577 Bacteria 2260
145 Ga0068857_100865927 3300005577 Bacteria 865
146 Ga0068854_100061623 3300005578 Bacteria 2717
147 Ga0068852_100101190 3300005616 Bacteria 2602
148 Ga0068852_100609212 3300005616 Bacteria 1097
149 Ga0068852_100780076 3300005616 Bacteria 969
150 Ga0068852_100960737 3300005616 Bacteria 873
151 Ga0068859_100000855 3300005617 Bacteria 31031
152 Ga0068859_100003354 3300005617 Bacteria 16292
153 Ga0068859_100033722 3300005617 Bacteria 5140
154 Ga0068859_100094285 3300005617 Bacteria 3045
155 Ga0068864_100000366 3300005618 Bacteria 39559
156 Ga0068864_100001105 3300005618 Bacteria 22558
157 Ga0068864_100003858 3300005618 Bacteria 12347
158 Ga0068864_100032901 3300005618 Bacteria 4407
159 Ga0068864_100049023 3300005618 Bacteria 3632
160 Ga0068864_100195262 3300005618 Bacteria 1857
161 Ga0068864_100218769 3300005618 Bacteria 1756
162 Ga0068866_10005046 3300005718 Bacteria 5435
163 Ga0068861_100565685 3300005719 Bacteria 1038
164 Ga0068851_10130974 3300005834 Bacteria 1356
165 Ga0068851_10155780 3300005834 Bacteria 1252
166 Ga0068870_10379145 3300005840 Unclassified 915
167 Ga0068863_100007295 3300005841 Bacteria 10827
168 Ga0068863_100014764 3300005841 Bacteria 7512
169 Ga0068863_100015256 3300005841 Bacteria 7384
170 Ga0068863_100101928 3300005841 Bacteria 2729
171 Ga0068863_100264490 3300005841 Bacteria 1663
172 Ga0068863_100328692 3300005841 Bacteria 1486
173 Ga0068863_100423157 3300005841 Bacteria 1305
174 Ga0068858_100001063 3300005842 Bacteria 28439
175 Ga0068858_100001635 3300005842 Bacteria 22873
176 Ga0068858_100008380 3300005842 Bacteria 9945
177 Ga0068858_100019682 3300005842 Bacteria 6311
178 Ga0068860_100004967 3300005843 Bacteria 13557
179 Ga0068860_100134421 3300005843 Bacteria 2375
180 Ga0068860_100254213 3300005843 Bacteria 1712
181 Ga0068860_100369068 3300005843 Bacteria 1415
182 Ga0068862_100032743 3300005844 Bacteria 4391
183 Ga0068862_100094996 3300005844 Bacteria 2600
184 Ga0081539_10024064 3300005985 Bacteria 3964
185 Ga0070717_10086969 3300006028 Bacteria 2632
186 Ga0070712_100138980 3300006175 Bacteria 1851
187 Ga0097621_100004067 3300006237 Bacteria 10150
188 Ga0097621_100024918 3300006237 Bacteria 4677
189 Ga0068871_100012133 3300006358 Bacteria 6343
190 Ga0068871_100013569 3300006358 Bacteria 6049
191 Ga0068871_100348288 3300006358 Bacteria 1310
192 Ga0075433_10025414 3300006852 Bacteria 5006
193 Ga0068865_100152947 3300006881 Bacteria 1752
194 Ga0068865_100184513 3300006881 Bacteria 1609
195 Ga0097620_100000855 3300006931 Bacteria 31031
196 Ga0097620_100003354 3300006931 Bacteria 16292
197 Ga0097620_100033722 3300006931 Bacteria 5140
198 Ga0097620_100094283 3300006931 Bacteria 3045
199 Ga0105250_10005314 3300009092 Bacteria 5782
200 Ga0105240_10656128 3300009093 Bacteria 1149
201 Ga0111539_10090546 3300009094 Bacteria 3595
202 Ga0105245_10016478 3300009098 Bacteria 6448
203 Ga0105245_10058357 3300009098 Bacteria 3474
204 Ga0105245_10071145 3300009098 Bacteria 3159
205 Ga0105245_10096182 3300009098 Bacteria 2732
206 Ga0105245_10658537 3300009098 Bacteria 1078
207 Ga0105243_10072504 3300009148 Bacteria 2788
208 Ga0105243_10139392 3300009148 Bacteria 2067
209 Ga0105243_10143986 3300009148 Bacteria 2037
210 Ga0105243_10389422 3300009148 Bacteria 1291
211 Ga0105241_10338910 3300009174 Bacteria 1302
212 Ga0105242_10002696 3300009176 Bacteria 13894
213 Ga0105248_10000678 3300009177 Bacteria 38605
214 Ga0105248_10001267 3300009177 Bacteria 28234
215 Ga0105248_10001352 3300009177 Bacteria 27313
216 Ga0105248_10002687 3300009177 Bacteria 19758
217 Ga0105248_10006373 3300009177 Bacteria 12948
218 Ga0105248_10015401 3300009177 Bacteria 8433
219 Ga0105248_10056671 3300009177 Bacteria 4396
220 Ga0105248_10122530 3300009177 Bacteria 2933
221 Ga0105248_10394841 3300009177 Bacteria 1557
222 Ga0105248_10450932 3300009177 Bacteria 1449
223 Ga0105249_10025536 3300009553 Bacteria 5320
224 Ga0105249_10647546 3300009553 Bacteria 1114
225 Ga0105239_10059251 3300010375 Bacteria 4203
226 Ga0105239_10232544 3300010375 Bacteria 2068
227 Ga0105239_10799271 3300010375 Bacteria 1081
228 Ga0105246_10222107 3300011119 Bacteria 1481
229 Ga0157369_10051888 3300013105 Bacteria 4438
230 Ga0157374_10018302 3300013296 Bacteria 6181
231 Ga0157378_10239797 3300013297 Bacteria 1731
232 Ga0163162_10002607 3300013306 Bacteria 17093
233 Ga0163162_10030141 3300013306 Bacteria 5375
234 Ga0163162_10067628 3300013306 Bacteria 3623
235 Ga0163162_10084970 3300013306 Bacteria 3241
236 Ga0163162_10337790 3300013306 Bacteria 1639
237 Ga0163162_10571336 3300013306 Bacteria 1258
238 Ga0157375_10010935 3300013308 Bacteria 8004
239 Ga0157375_10020788 3300013308 Bacteria 6007
240 Ga0157375_10752646 3300013308 Bacteria 1125
241 Ga0163163_10000665 3300014325 Bacteria 29455
242 Ga0163163_10004898 3300014325 Bacteria 11515
243 Ga0163163_10066181 3300014325 Bacteria 3588
244 Ga0157380_10229831 3300014326 Bacteria 1665
245 Ga0157380_10443750 3300014326 Unclassified 1244
246 Ga0157377_10013564 3300014745 Bacteria 4127
247 Ga0157379_10012481 3300014968 Bacteria 7418
248 Ga0157379_10116156 3300014968 Bacteria 2406
249 Ga0157379_10657857 3300014968 Bacteria 981
250 Ga0157376_10461430 3300014969 Bacteria 1241
251 Ga0163161_10253223 3300017792 Bacteria 1373
252 Ga0213876_10119583 3300021384 Bacteria 1398
253 Ga0207697_10004884 3300025315 Bacteria 6321
254 Ga0207656_10048218 3300025321 Bacteria 1833
255 Ga0207696_1033463 3300025711 Bacteria 1540
256 Ga0207682_10116257 3300025893 Bacteria 1182
257 Ga0207642_10028935 3300025899 Bacteria 2288
258 Ga0207642_10073816 3300025899 Bacteria 1633
259 Ga0207688_10096472 3300025901 Bacteria 1703
260 Ga0207680_10003407 3300025903 Bacteria 7498
261 Ga0207680_10442498 3300025903 Bacteria 922
262 Ga0207647_10001089 3300025904 Bacteria 20923
263 Ga0207647_10006282 3300025904 Bacteria 8651
264 Ga0207647_10020394 3300025904 Bacteria 4446
265 Ga0207647_10204560 3300025904 Bacteria 1141
266 Ga0207645_10100734 3300025907 Bacteria 1863
267 Ga0207645_10197172 3300025907 Bacteria 1324
268 Ga0207705_10154789 3300025909 Bacteria 1719
269 Ga0207707_10445879 3300025912 Bacteria 1108
270 Ga0207695_10647195 3300025913 Bacteria 938
271 Ga0207657_10007278 3300025919 Bacteria 11361
272 Ga0207657_10034110 3300025919 Bacteria 4581
273 Ga0207657_10075795 3300025919 Bacteria 2838
274 Ga0207657_10161269 3300025919 Bacteria 1821
275 Ga0207657_10278424 3300025919 Bacteria 1329
276 Ga0207649_10037462 3300025920 Bacteria 2930
277 Ga0207649_10057761 3300025920 Bacteria 2427
278 Ga0207649_10176550 3300025920 Bacteria 1492
279 Ga0207649_10270210 3300025920 Bacteria 1232
280 Ga0207649_10318125 3300025920 Bacteria 1142
281 Ga0207649_10323488 3300025920 Bacteria 1134
282 Ga0207694_10203470 3300025924 Bacteria 1611
283 Ga0207694_10456752 3300025924 Bacteria 1067
284 Ga0207650_10012679 3300025925 Bacteria 5819
285 Ga0207650_10018685 3300025925 Bacteria 4867
286 Ga0207650_10030176 3300025925 Bacteria 3903
287 Ga0207650_10248480 3300025925 Bacteria 1439
288 Ga0207650_10307868 3300025925 Bacteria 1295
289 Ga0207659_10017208 3300025926 Bacteria 4718
290 Ga0207659_10207855 3300025926 Bacteria 1567
291 Ga0207659_10510104 3300025926 Bacteria 1019
292 Ga0207687_10075075 3300025927 Bacteria 2425
293 Ga0207687_10115616 3300025927 Bacteria 1999
294 Ga0207644_10000196 3300025931 Bacteria 43119
295 Ga0207644_10001246 3300025931 Bacteria 16373
296 Ga0207644_10004347 3300025931 Bacteria 9196
297 Ga0207644_10017727 3300025931 Bacteria 4813
298 Ga0207644_10020546 3300025931 Bacteria 4490
299 Ga0207644_10033254 3300025931 Bacteria 3602
300 Ga0207644_10056563 3300025931 Bacteria 2831
301 Ga0207644_10099813 3300025931 Bacteria 2179
302 Ga0207644_10105675 3300025931 Bacteria 2121
303 Ga0207644_10311457 3300025931 Bacteria 1271
304 Ga0207690_10001017 3300025932 Bacteria 17943
305 Ga0207690_10002667 3300025932 Bacteria 10754
306 Ga0207690_10053509 3300025932 Bacteria 2709
307 Ga0207690_10137244 3300025932 Bacteria 1797
308 Ga0207690_10180163 3300025932 Bacteria 1590
309 Ga0207690_10214100 3300025932 Bacteria 1471
310 Ga0207690_10253398 3300025932 Unclassified 1361
311 Ga0207706_10000866 3300025933 Bacteria 31146
312 Ga0207706_10002963 3300025933 Bacteria 16381
313 Ga0207706_10013748 3300025933 Bacteria 7345
314 Ga0207706_10019234 3300025933 Bacteria 6141
315 Ga0207706_10027425 3300025933 Bacteria 5092
316 Ga0207706_10028623 3300025933 Bacteria 4976
317 Ga0207706_10052152 3300025933 Bacteria 3612
318 Ga0207706_10090234 3300025933 Bacteria 2695
319 Ga0207706_10171865 3300025933 Bacteria 1904
320 Ga0207706_10240561 3300025933 Bacteria 1582
321 Ga0207706_10261594 3300025933 Bacteria 1510
322 Ga0207706_10503937 3300025933 Bacteria 1045
323 Ga0207686_10036631 3300025934 Bacteria 2955
324 Ga0207709_10098210 3300025935 Bacteria 1930
325 Ga0207709_10114618 3300025935 Bacteria 1809
326 Ga0207669_10022873 3300025937 Bacteria 3327
327 Ga0207669_10046344 3300025937 Bacteria 2568
328 Ga0207669_10126262 3300025937 Bacteria 1748
329 Ga0207669_10152017 3300025937 Bacteria 1623
330 Ga0207669_10271742 3300025937 Bacteria 1273
331 Ga0207669_10402517 3300025937 Unclassified 1073
332 Ga0207704_10038554 3300025938 Bacteria 2773
333 Ga0207704_10123669 3300025938 Bacteria 1776
334 Ga0207704_10123706 3300025938 Bacteria 1776
335 Ga0207704_10341311 3300025938 Bacteria 1163
336 Ga0207704_10577235 3300025938 Bacteria 917
337 Ga0207691_10000705 3300025940 Bacteria 33075
338 Ga0207691_10002422 3300025940 Bacteria 18263
339 Ga0207691_10006407 3300025940 Bacteria 11371
340 Ga0207691_10022475 3300025940 Bacteria 5948
341 Ga0207691_10024593 3300025940 Bacteria 5665
342 Ga0207691_10101490 3300025940 Bacteria 2567
343 Ga0207691_10272968 3300025940 Bacteria 1456
344 Ga0207691_10523529 3300025940 Bacteria 1006
345 Ga0207711_10000388 3300025941 Bacteria 46611
346 Ga0207711_10000762 3300025941 Bacteria 31637
347 Ga0207711_10002740 3300025941 Bacteria 15533
348 Ga0207711_10002760 3300025941 Bacteria 15467
349 Ga0207711_10003424 3300025941 Bacteria 13726
350 Ga0207711_10018302 3300025941 Bacteria 5823
351 Ga0207711_10060825 3300025941 Bacteria 3255
352 Ga0207711_10077224 3300025941 Bacteria 2902
353 Ga0207711_10081737 3300025941 Bacteria 2823
354 Ga0207711_10206273 3300025941 Bacteria 1795
355 Ga0207689_10008971 3300025942 Bacteria 8665
356 Ga0207689_10017597 3300025942 Bacteria 6042
357 Ga0207679_10023526 3300025945 Bacteria 4214
358 Ga0207679_10032648 3300025945 Bacteria 3658
359 Ga0207679_10075559 3300025945 Bacteria 2557
360 Ga0207679_10183131 3300025945 Bacteria 1734
361 Ga0207679_10190910 3300025945 Bacteria 1703
362 Ga0207679_10194789 3300025945 Bacteria 1688
363 Ga0207679_10505490 3300025945 Bacteria 1079
364 Ga0207679_10689943 3300025945 Bacteria 926
365 Ga0207667_10093251 3300025949 Bacteria 3110
366 Ga0207651_10000999 3300025960 Bacteria 12480
367 Ga0207651_10010072 3300025960 Bacteria 5217
368 Ga0207651_10016217 3300025960 Bacteria 4357
369 Ga0207651_10017520 3300025960 Bacteria 4234
370 Ga0207651_10051695 3300025960 Bacteria 2797
371 Ga0207651_10231301 3300025960 Bacteria 1501
372 Ga0207712_10001307 3300025961 Bacteria 17068
373 Ga0207712_10445567 3300025961 Bacteria 1097
374 Ga0207712_10532762 3300025961 Unclassified 1008
375 Ga0207668_10014958 3300025972 Bacteria 4813
376 Ga0207668_10112134 3300025972 Bacteria 2048
377 Ga0207640_10002493 3300025981 Bacteria 9864
378 Ga0207640_10077959 3300025981 Bacteria 2254
379 Ga0207640_10526014 3300025981 Bacteria 989
380 Ga0207658_10001827 3300025986 Bacteria 15930
381 Ga0207658_10008218 3300025986 Bacteria 7111
382 Ga0207658_10011018 3300025986 Bacteria 6155
383 Ga0207658_10032021 3300025986 Bacteria 3739
384 Ga0207658_10037871 3300025986 Bacteria 3469
385 Ga0207658_10095380 3300025986 Bacteria 2318
386 Ga0207658_10468403 3300025986 Bacteria 1118
387 Ga0207677_10001627 3300026023 Bacteria 11927
388 Ga0207677_10040770 3300026023 Bacteria 3064
389 Ga0207677_10098231 3300026023 Bacteria 2147
390 Ga0207677_10155286 3300026023 Bacteria 1771
391 Ga0207703_10001752 3300026035 Bacteria 19393
392 Ga0207703_10002466 3300026035 Bacteria 16043
393 Ga0207703_10002535 3300026035 Bacteria 15783
394 Ga0207703_10006417 3300026035 Bacteria 9401
395 Ga0207703_10026227 3300026035 Bacteria 4585
396 Ga0207639_10082432 3300026041 Bacteria 2550
397 Ga0207639_10221845 3300026041 Bacteria 1633
398 Ga0207639_10471481 3300026041 Bacteria 1143
399 Ga0207639_10489915 3300026041 Bacteria 1122
400 Ga0207639_10580209 3300026041 Bacteria 1032
401 Ga0207678_10001628 3300026067 Bacteria 20589
402 Ga0207678_10369399 3300026067 Bacteria 1239
403 Ga0207641_10000421 3300026088 Bacteria 49462
404 Ga0207641_10017033 3300026088 Bacteria 5948
405 Ga0207641_10023354 3300026088 Bacteria 5095
406 Ga0207641_10088046 3300026088 Bacteria 2710
407 Ga0207641_10310933 3300026088 Bacteria 1491
408 Ga0207641_10310954 3300026088 Bacteria 1491
409 Ga0207648_10008008 3300026089 Bacteria 10302
410 Ga0207648_10010973 3300026089 Bacteria 8559
411 Ga0207648_10012951 3300026089 Bacteria 7790
412 Ga0207648_10047342 3300026089 Bacteria 3769
413 Ga0207648_10107872 3300026089 Bacteria 2444
414 Ga0207676_10003094 3300026095 Bacteria 11866
415 Ga0207676_10003644 3300026095 Bacteria 10896
416 Ga0207676_10008522 3300026095 Bacteria 7293
417 Ga0207676_10012688 3300026095 Bacteria 6045
418 Ga0207676_10036894 3300026095 Bacteria 3720
419 Ga0207676_10038320 3300026095 Bacteria 3657
420 Ga0207676_10084476 3300026095 Bacteria 2588
421 Ga0207676_10286695 3300026095 Bacteria 1497
422 Ga0207676_10369690 3300026095 Bacteria 1332
423 Ga0207674_10002976 3300026116 Bacteria 21037
424 Ga0207674_10057334 3300026116 Bacteria 3948
425 Ga0207674_10134488 3300026116 Bacteria 2435
426 Ga0207674_10288006 3300026116 Bacteria 1591
427 Ga0207674_10405530 3300026116 Bacteria 1317
428 Ga0207675_100329291 3300026118 Bacteria 1493
429 Ga0207683_10001943 3300026121 Bacteria 18297
430 Ga0207683_10002694 3300026121 Bacteria 15527
431 Ga0207683_10007362 3300026121 Bacteria 9435
432 Ga0207683_10020864 3300026121 Bacteria 5606
433 Ga0207683_10489309 3300026121 Bacteria 1136
434 Ga0207683_10799338 3300026121 Bacteria 875
435 Ga0207698_10033039 3300026142 Bacteria 3755
436 Ga0207698_10045403 3300026142 Bacteria 3310
437 Ga0207698_10052720 3300026142 Bacteria 3118
438 Ga0207698_10444371 3300026142 Bacteria 1250
439 Ga0207698_10546433 3300026142 Bacteria 1135
440 Ga0207698_10582254 3300026142 Bacteria 1101
441 Ga0268266_10018668 3300028379 Bacteria 5909
442 Ga0268266_10021340 3300028379 Bacteria 5517
443 Ga0268266_10721378 3300028379 Bacteria 961
444 Ga0268265_10000980 3300028380 Bacteria 26001
445 Ga0268265_10011047 3300028380 Bacteria 6099
446 Ga0268265_10069773 3300028380 Bacteria 2730
447 Ga0268265_10349736 3300028380 Bacteria 1349
448 Ga0268264_10000338 3300028381 Bacteria 72206
449 Ga0268264_10003081 3300028381 Bacteria 14430
450 Ga0268264_10163279 3300028381 Bacteria 2009
451 Ga0268264_10190844 3300028381 Bacteria 1868
452 Ga0307513_10350112 3300031456 Bacteria 1225
453 Ga0307408_100197357 3300031548 Bacteria 1626
454 Ga0307405_10418888 3300031731 Bacteria 1053
455 Ga0307413_10055576 3300031824 Bacteria 2409
456 Ga0307410_10000681 3300031852 Bacteria 14147
457 Ga0307410_10014182 3300031852 Bacteria 4679
458 Ga0307406_10192481 3300031901 Bacteria 1494
459 Ga0307406_10259439 3300031901 Bacteria 1314
460 Ga0307407_10035571 3300031903 Bacteria 2737
461 Ga0307412_10505499 3300031911 Bacteria 1007
462 Ga0307409_100024756 3300031995 Bacteria 4194
463 Ga0307416_100028706 3300032002 Bacteria 4143
464 Ga0307416_100277652 3300032002 Bacteria 1650
465 Ga0307416_100685371 3300032002 Bacteria 1113
466 Ga0307414_10015475 3300032004 Bacteria 4605
467 Ga0307411_10008875 3300032005 Bacteria 5242
468 Ga0307411_10008926 3300032005 Bacteria 5232
469 Ga0307411_10030350 3300032005 Bacteria 3312
470 Ga0307411_10740633 3300032005 Bacteria 860
471 Ga0307415_100275803 3300032126 Bacteria 1380
472 Ga0373923_0030584 3300035111 Bacteria 2167
473 Ga0373936_0059771 3300035113 Bacteria 1554
474 Ga0373941_0128317 3300035115 Unclassified 911
475 Ga0373943_0045046 3300035170 Bacteria 2148
476 Ga0373935_0007220 3300035692 Bacteria 6637
477 Ga0373935_0212060 3300035692 Bacteria 1342
478 Ga0373927_0040041 3300035695 Bacteria 3041
479 Ga0373925_0037427 3300037068 Bacteria 3583
480 Ga0395899_0025681 3300037312 Bacteria 4446
481 Ga0395899_0037336 3300037312 Bacteria 3642
482 Ga0395899_0040112 3300037312 Bacteria 3502
483 Ga0395899_0153533 3300037312 Bacteria 1630
484 Ga0395899_0216439 3300037312 Bacteria 1329
485 Ga0395899_0295750 3300037312 Bacteria 1097
486 Ga0395900_0023312 3300037418 Bacteria 6335
487 Ga0395900_0027132 3300037418 Bacteria 5863
488 Ga0395900_0078201 3300037418 Bacteria 3399
489 Ga0395900_0079044 3300037418 Bacteria 3379
490 Ga0395900_0089713 3300037418 Bacteria 3160
491 Ga0395900_0111262 3300037418 Bacteria 2813
492 Ga0395900_0169969 3300037418 Bacteria 2220
493 Ga0395900_0306449 3300037418 Bacteria 1573
494 Ga0395900_0471402 3300037418 Bacteria 1209
495 Ga0395900_0518899 3300037418 Bacteria 1140
496 Ga0395900_0563482 3300037418 Bacteria 1083
497 Ga0395900_0588239 3300037418 Bacteria 1054
498 Ga0395898_0003587 3300037466 Bacteria 17305
499 Ga0395898_0014122 3300037466 Bacteria 8210
500 Ga0395898_0041911 3300037466 Bacteria 4519
501 Ga0395898_0119917 3300037466 Bacteria 2520
502 Ga0395898_0403309 3300037466 Bacteria 1304
503 Ga0395898_0461073 3300037466 Bacteria 1210
504 Ga0395905_0000298 3300037471 Bacteria 72500
505 Ga0395905_0006325 3300037471 Bacteria 11937
506 Ga0395905_0008446 3300037471 Bacteria 10154
507 Ga0395905_0009807 3300037471 Bacteria 9333
508 Ga0395905_0010832 3300037471 Bacteria 8834
509 Ga0395905_0011033 3300037471 Bacteria 8743
510 Ga0395905_0022886 3300037471 Bacteria 5906
511 Ga0395905_0038035 3300037471 Bacteria 4514
512 Ga0395905_0052817 3300037471 Bacteria 3804
513 Ga0395905_0064883 3300037471 Bacteria 3418
514 Ga0395905_0206848 3300037471 Bacteria 1839
515 Ga0395905_0251835 3300037471 Bacteria 1650
516 Ga0395905_0302310 3300037471 Bacteria 1487
517 Ga0395905_0341438 3300037471 Bacteria 1389
518 Ga0395905_0363693 3300037471 Bacteria 1340
519 Ga0395905_0435538 3300037471 Bacteria 1208
520 Ga0395905_0501281 3300037471 Bacteria 1114
521 Ga0395905_0532430 3300037471 Bacteria 1075
522 Ga0395905_0550172 3300037471 Bacteria 1055
523 Ga0395905_0575397 3300037471 Bacteria 1028
524 Ga0436364_1360610 3300037853 Bacteria 32497
525 Ga0395901_0003692 3300038443 Bacteria 15438
526 Ga0395901_0005043 3300038443 Bacteria 13334
527 Ga0395901_0037956 3300038443 Bacteria 4982
528 Ga0395901_0061801 3300038443 Bacteria 3897
529 Ga0395901_0078282 3300038443 Bacteria 3452
530 Ga0395901_0087146 3300038443 Bacteria 3264
531 Ga0395901_0093276 3300038443 Bacteria 3152
532 Ga0395901_0105992 3300038443 Bacteria 2950
533 Ga0395901_0110286 3300038443 Bacteria 2889
534 Ga0395901_0143264 3300038443 Bacteria 2512
535 Ga0395901_0198981 3300038443 Bacteria 2100
536 Ga0395901_0235208 3300038443 Bacteria 1912
537 Ga0395901_0432013 3300038443 Bacteria 1349
538 Ga0436365_1417856 3300039437 Bacteria 14894
539 Ga0450905_001199 3300042142 Bacteria 3286
540 Ga0450889_001003 3300042144 Bacteria 2976
541 Ga0439464_0000192 3300042439 Bacteria 10769
542 Ga0466965_0097754 3300044683 Bacteria 1499
543 Ga0466963_0184047 3300044694 Bacteria 1459
544 Ga0466967_0215485 3300045976 Bacteria 1822
545 Ga0495580_0249061 3300046472 Bacteria 1217
546 Ga0495584_0088097 3300046491 Bacteria 1565
547 Ga0495663_0038747 3300046525 Bacteria 1442
548 Ga0495598_0000267 3300046537 Bacteria 9404
549 Ga0495621_0000456 3300046539 Bacteria 10019
550 Ga0495621_0120046 3300046539 Bacteria 1015
551 Ga0495668_0012632 3300046616 Bacteria 5005
552 Ga0495668_0014919 3300046616 Bacteria 4545
553 Ga0495668_0034508 3300046616 Bacteria 2837
554 Ga0495659_0065006 3300046664 Bacteria 1356
555 Ga0495669_0000952 3300046684 Bacteria 12081
556 Ga0495669_0006761 3300046684 Bacteria 4799
557 Ga0495669_0008958 3300046684 Bacteria 4216
558 Ga0495669_0020298 3300046684 Bacteria 2874
559 Ga0495669_0023106 3300046684 Bacteria 2705
560 Ga0495669_0033037 3300046684 Bacteria 2276
561 Ga0495669_0037489 3300046684 Bacteria 2145
562 Ga0495670_0008066 3300046691 Bacteria 5177
563 Ga0495677_0014230 3300047445 Bacteria 2897
564 Ga0496100_0013513 3300048903 Bacteria 4712
565 Ga0496100_0251860 3300048903 Bacteria 1306
566 Ga0496101_0010534 3300048904 Bacteria 6106
567 Ga0496101_0053191 3300048904 Bacteria 2920
568 Ga0496101_0175492 3300048904 Bacteria 1648
569 Ga0496102_0052301 3300048905 Bacteria 3721
570 Ga0496102_0053753 3300048905 Bacteria 3671
571 Ga0496102_0120927 3300048905 Bacteria 2446
572 Ga0496102_0304936 3300048905 Bacteria 1501
573 Ga0496102_1019950 3300048905 Bacteria 748
574 Ga0496103_0277523 3300048906 Bacteria 1078
575 Ga0496104_0243875 3300048907 Bacteria 1709
576 Ga0496106_0008543 3300048909 Bacteria 7576
577 Ga0496106_0174831 3300048909 Bacteria 1703
578 Ga0496107_0011270 3300048910 Bacteria 6221
579 Ga0496108_0000396 3300048911 Bacteria 35971
580 Ga0496108_0001668 3300048911 Bacteria 17616
581 Ga0496108_0009557 3300048911 Bacteria 7861
582 Ga0496108_0029509 3300048911 Bacteria 4543
583 Ga0496108_0086192 3300048911 Bacteria 2666
584 Ga0496109_0003559 3300048912 Bacteria 13006
585 Ga0496109_0004861 3300048912 Bacteria 11217
586 Ga0496109_0009641 3300048912 Bacteria 8237
587 Ga0496109_0009815 3300048912 Bacteria 8172
588 Ga0496109_0274498 3300048912 Bacteria 1588
589 Ga0496110_0001619 3300048913 Bacteria 16509
590 Ga0496110_0004040 3300048913 Bacteria 11323
591 Ga0496110_0021273 3300048913 Bacteria 5489
592 Ga0496110_0027627 3300048913 Bacteria 4865
593 Ga0496110_0447673 3300048913 Bacteria 1177
594 Ga0496111_0010118 3300048914 Bacteria 6313
595 Ga0496111_0014914 3300048914 Bacteria 5320
596 Ga0496112_0000609 3300048915 Bacteria 24640
597 Ga0496112_0012709 3300048915 Bacteria 7743
598 Ga0496112_0028999 3300048915 Bacteria 5348
599 Ga0496112_0038526 3300048915 Bacteria 4668
600 Ga0496112_0064850 3300048915 Bacteria 3604
601 Ga0496112_0099295 3300048915 Bacteria 2881
602 Ga0496112_0163347 3300048915 Bacteria 2193
603 Ga0496112_0265186 3300048915 Bacteria 1666
604 Ga0496113_0000746 3300048916 Bacteria 16744
605 Ga0496113_0001076 3300048916 Bacteria 14777
606 Ga0496113_0024534 3300048916 Bacteria 4287
607 Ga0496113_0245953 3300048916 Bacteria 1427
608 Ga0496114_0000152 3300048917 Bacteria 50128
609 Ga0496114_0161072 3300048917 Bacteria 1951
610 Ga0496114_0730963 3300048917 Bacteria 866
611 Ga0496115_0132467 3300048918 Bacteria 2055
612 Ga0501067_0161122 3300049583 Bacteria 1249
613 nmdc:mga08y16_17079_c1 3300050511 Bacteria 7641
614 nmdc:mga0a205_10035_c1 3300050515 Bacteria 8689
615 Ga0500658_0001554 3300053134 Bacteria 9168

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005339 Ga0070660_100128357 Ga0070660_1001283572 205
2 3300005344 Ga0070661_100186449 Ga0070661_1001864492 205
3 3300005539 Ga0068853_100321344 Ga0068853_1003213442 205
4 3300005834 Ga0068851_10155780 Ga0068851_101557802 205
5 3300025321 Ga0207656_10048218 Ga0207656_100482182 205
6 3300025919 Ga0207657_10278424 Ga0207657_102784242 205
7 3300026041 Ga0207639_10221845 Ga0207639_102218452 205
8 3300026116 Ga0207674_10405530 Ga0207674_104055302 205
9 3300037471 Ga0395905_0532430 Ga0395905_0532430_417_1064 205
10 3300005356 Ga0070674_100251960 Ga0070674_1002519602 207
11 3300005366 Ga0070659_100150808 Ga0070659_1001508082 207
12 3300005455 Ga0070663_100579506 Ga0070663_1005795062 207
13 3300005544 Ga0070686_100577278 Ga0070686_1005772781 207
14 3300005564 Ga0070664_100076363 Ga0070664_1000763633 207
15 3300005577 Ga0068857_100865927 Ga0068857_1008659272 207
16 3300005616 Ga0068852_100101190 Ga0068852_1001011903 207
17 3300009177 Ga0105248_10450932 Ga0105248_104509322 207
18 3300025933 Ga0207706_10013748 Ga0207706_1001374810 207
19 3300025938 Ga0207704_10341311 Ga0207704_103413112 207
20 3300025941 Ga0207711_10081737 Ga0207711_100817372 207
21 3300025945 Ga0207679_10190910 Ga0207679_101909102 207
22 3300026067 Ga0207678_10369399 Ga0207678_103693992 207
23 3300046539 Ga0495621_0120046 Ga0495621_0120046_68_784 207
24 3300048905 Ga0496102_1019950 Ga0496102_1019950_92_736 208
25 3300013306 Ga0163162_10084970 Ga0163162_100849702 209
26 3300037471 Ga0395905_0501281 Ga0395905_0501281_166_885 209
27 3300035111 Ga0373923_0030584 Ga0373923_0030584_1125_1844 210
28 3300035692 Ga0373935_0212060 Ga0373935_0212060_358_1077 210
29 3300025919 Ga0207657_10007278 Ga0207657_100072786 212
30 3300037418 Ga0395900_0306449 Ga0395900_0306449_389_1108 212
31 3300037418 Ga0395900_0471402 Ga0395900_0471402_70_789 212
32 3300038443 Ga0395901_0105992 Ga0395901_0105992_436_1155 212
33 3300005366 Ga0070659_100193656 Ga0070659_1001936562 213
34 3300025932 Ga0207690_10137244 Ga0207690_101372442 213
35 3300026041 Ga0207639_10471481 Ga0207639_104714812 213
36 3300037853 Ga0436364_1360610 Ga0436364_1360610_6636_7364 214
37 3300005330 Ga0070690_100002955 Ga0070690_10000295512 215
38 3300005355 Ga0070671_100118784 Ga0070671_1001187842 215
39 3300005356 Ga0070674_100091658 Ga0070674_1000916583 215
40 3300005364 Ga0070673_100443017 Ga0070673_1004430172 215
41 3300005366 Ga0070659_100301752 Ga0070659_1003017522 215
42 3300005366 Ga0070659_100508445 Ga0070659_1005084452 215
43 3300005367 Ga0070667_100011536 Ga0070667_1000115361 215
44 3300005457 Ga0070662_100012893 Ga0070662_1000128932 215
45 3300005543 Ga0070672_100000482 Ga0070672_10000048224 215
46 3300005544 Ga0070686_100027669 Ga0070686_1000276694 215
47 3300005548 Ga0070665_100652199 Ga0070665_1006521992 215
48 3300005578 Ga0068854_100061623 Ga0068854_1000616232 215
49 3300005718 Ga0068866_10005046 Ga0068866_100050464 215
50 3300005840 Ga0068870_10379145 Ga0068870_103791452 215
51 3300005841 Ga0068863_100014764 Ga0068863_10001476410 215
52 3300005843 Ga0068860_100254213 Ga0068860_1002542132 215
53 3300006237 Ga0097621_100004067 Ga0097621_1000040672 215
54 3300006358 Ga0068871_100012133 Ga0068871_1000121338 215
55 3300009098 Ga0105245_10016478 Ga0105245_100164788 215
56 3300009148 Ga0105243_10389422 Ga0105243_103894222 215
57 3300009176 Ga0105242_10002696 Ga0105242_1000269617 215
58 3300010375 Ga0105239_10232544 Ga0105239_102325443 215
59 3300013306 Ga0163162_10571336 Ga0163162_105713362 215
60 3300013308 Ga0157375_10020788 Ga0157375_100207888 215
61 3300014326 Ga0157380_10443750 Ga0157380_104437502 215
62 3300025899 Ga0207642_10028935 Ga0207642_100289352 215
63 3300025920 Ga0207649_10318125 Ga0207649_103181251 215
64 3300025924 Ga0207694_10203470 Ga0207694_102034702 215
65 3300025925 Ga0207650_10248480 Ga0207650_102484802 215
66 3300025927 Ga0207687_10115616 Ga0207687_101156163 215
67 3300025931 Ga0207644_10000196 Ga0207644_1000019624 215
68 3300025932 Ga0207690_10180163 Ga0207690_101801632 215
69 3300025932 Ga0207690_10253398 Ga0207690_102533982 215
70 3300025933 Ga0207706_10019234 Ga0207706_100192342 215
71 3300025934 Ga0207686_10036631 Ga0207686_100366314 215
72 3300025937 Ga0207669_10271742 Ga0207669_102717422 215
73 3300025937 Ga0207669_10402517 Ga0207669_104025172 215
74 3300025938 Ga0207704_10123669 Ga0207704_101236692 215
75 3300025940 Ga0207691_10000705 Ga0207691_100007054 215
76 3300025960 Ga0207651_10000999 Ga0207651_100009992 215
77 3300025981 Ga0207640_10077959 Ga0207640_100779592 215
78 3300026023 Ga0207677_10155286 Ga0207677_101552862 215
79 3300026035 Ga0207703_10006417 Ga0207703_100064172 215
80 3300026088 Ga0207641_10088046 Ga0207641_100880462 215
81 3300026095 Ga0207676_10038320 Ga0207676_100383202 215
82 3300026121 Ga0207683_10001943 Ga0207683_100019434 215
83 3300026142 Ga0207698_10052720 Ga0207698_100527204 215
84 3300028379 Ga0268266_10721378 Ga0268266_107213782 215
85 3300028381 Ga0268264_10163279 Ga0268264_101632792 215
86 3300035115 Ga0373941_0128317 Ga0373941_0128317_79_798 215
87 3300048903 Ga0496100_0013513 Ga0496100_0013513_553_1272 215
88 3300048904 Ga0496101_0053191 Ga0496101_0053191_1320_2039 215
89 3300048905 Ga0496102_0052301 Ga0496102_0052301_1575_2294 215
90 3300048907 Ga0496104_0243875 Ga0496104_0243875_340_1059 215
91 3300048909 Ga0496106_0174831 Ga0496106_0174831_645_1364 215
92 3300048910 Ga0496107_0011270 Ga0496107_0011270_1163_1882 215
93 3300048911 Ga0496108_0000396 Ga0496108_0000396_3223_3942 215
94 3300048912 Ga0496109_0003559 Ga0496109_0003559_11196_11915 215
95 3300048913 Ga0496110_0001619 Ga0496110_0001619_14628_15347 215
96 3300048914 Ga0496111_0010118 Ga0496111_0010118_4009_4728 215
97 3300048915 Ga0496112_0000609 Ga0496112_0000609_3534_4253 215
98 3300048916 Ga0496113_0000746 Ga0496113_0000746_1348_2067 215
99 3300048917 Ga0496114_0161072 Ga0496114_0161072_284_1003 215
100 3300005366 Ga0070659_100246829 Ga0070659_1002468292 216
101 3300005539 Ga0068853_100933541 Ga0068853_1009335411 216
102 3300025932 Ga0207690_10214100 Ga0207690_102141002 216
103 3300025933 Ga0207706_10503937 Ga0207706_105039372 216
104 3300005327 Ga0070658_10610531 Ga0070658_106105312 217
105 3300005327 Ga0070658_10642189 Ga0070658_106421891 217
106 3300005331 Ga0070670_100082321 Ga0070670_1000823212 217
107 3300005444 Ga0070694_100015514 Ga0070694_1000155145 217
108 3300005458 Ga0070681_10853753 Ga0070681_108537531 217
109 3300005467 Ga0070706_100577308 Ga0070706_1005773082 217
110 3300005543 Ga0070672_100634006 Ga0070672_1006340062 217
111 3300005546 Ga0070696_100012858 Ga0070696_1000128582 217
112 3300009094 Ga0111539_10090546 Ga0111539_100905464 217
113 3300014969 Ga0157376_10461430 Ga0157376_104614302 217
114 3300017792 Ga0163161_10253223 Ga0163161_102532231 217
115 3300025925 Ga0207650_10307868 Ga0207650_103078682 217
116 3300025940 Ga0207691_10523529 Ga0207691_105235292 217
117 3300042142 Ga0450905_001199 Ga0450905_001199_2337_3062 217
118 3300042144 Ga0450889_001003 Ga0450889_001003_1442_2167 217
119 3300048912 Ga0496109_0009815 Ga0496109_0009815_406_1125 217
120 3300048917 Ga0496114_0730963 Ga0496114_0730963_130_849 217
121 3300050511 nmdc:mga08y16_17079_c1 nmdc:mga08y16_17079_c1_1683_2408 217
122 3300005364 Ga0070673_100002274 Ga0070673_10000227416 218
123 3300005367 Ga0070667_100022237 Ga0070667_1000222374 218
124 3300005617 Ga0068859_100000855 Ga0068859_10000085512 218
125 3300005618 Ga0068864_100000366 Ga0068864_10000036642 218
126 3300005719 Ga0068861_100565685 Ga0068861_1005656852 218
127 3300005841 Ga0068863_100007295 Ga0068863_1000072953 218
128 3300005842 Ga0068858_100001635 Ga0068858_1000016353 218
129 3300006931 Ga0097620_100000855 Ga0097620_10000085527 218
130 3300009092 Ga0105250_10005314 Ga0105250_100053142 218
131 3300009177 Ga0105248_10002687 Ga0105248_1000268713 218
132 3300009553 Ga0105249_10647546 Ga0105249_106475462 218
133 3300013306 Ga0163162_10067628 Ga0163162_100676282 218
134 3300014325 Ga0163163_10000665 Ga0163163_1000066512 218
135 3300014968 Ga0157379_10012481 Ga0157379_100124818 218
136 3300025711 Ga0207696_1033463 Ga0207696_10334632 218
137 3300025941 Ga0207711_10000388 Ga0207711_1000038812 218
138 3300025960 Ga0207651_10010072 Ga0207651_100100724 218
139 3300025961 Ga0207712_10532762 Ga0207712_105327621 218
140 3300025986 Ga0207658_10008218 Ga0207658_100082182 218
141 3300025986 Ga0207658_10011018 Ga0207658_100110184 218
142 3300026035 Ga0207703_10001752 Ga0207703_100017523 218
143 3300026088 Ga0207641_10000421 Ga0207641_1000042125 218
144 3300026095 Ga0207676_10012688 Ga0207676_100126882 218
145 3300026118 Ga0207675_100329291 Ga0207675_1003292912 218
146 3300028380 Ga0268265_10000980 Ga0268265_1000098037 218
147 3300028381 Ga0268264_10000338 Ga0268264_1000033840 218
148 3300037312 Ga0395899_0216439 Ga0395899_0216439_415_1125 218
149 3300037418 Ga0395900_0027132 Ga0395900_0027132_1150_1860 218
150 3300037418 Ga0395900_0089713 Ga0395900_0089713_1549_2259 218
151 3300037466 Ga0395898_0119917 Ga0395898_0119917_584_1294 218
152 3300037471 Ga0395905_0010832 Ga0395905_0010832_5478_6188 218
153 3300037471 Ga0395905_0022886 Ga0395905_0022886_4179_4889 218
154 3300037471 Ga0395905_0038035 Ga0395905_0038035_3751_4470 218
155 3300037471 Ga0395905_0064883 Ga0395905_0064883_2459_3178 218
156 3300038443 Ga0395901_0003692 Ga0395901_0003692_10953_11663 218
157 3300038443 Ga0395901_0087146 Ga0395901_0087146_1137_1847 218
158 3300042439 Ga0439464_0000192 Ga0439464_0000192_2229_2942 218
159 3300046491 Ga0495584_0088097 Ga0495584_0088097_725_1444 218
160 3300046664 Ga0495659_0065006 Ga0495659_0065006_308_1027 218
161 3300005327 Ga0070658_10024468 Ga0070658_100244686 219
162 3300005328 Ga0070676_10120049 Ga0070676_101200492 219
163 3300005339 Ga0070660_100161533 Ga0070660_1001615332 219
164 3300005366 Ga0070659_100009353 Ga0070659_1000093534 219
165 3300005459 Ga0068867_100010641 Ga0068867_1000106417 219
166 3300005539 Ga0068853_100023203 Ga0068853_1000232034 219
167 3300005539 Ga0068853_100341810 Ga0068853_1003418102 219
168 3300005616 Ga0068852_100780076 Ga0068852_1007800761 219
169 3300025919 Ga0207657_10161269 Ga0207657_101612692 219
170 3300025924 Ga0207694_10456752 Ga0207694_104567522 219
171 3300025932 Ga0207690_10053509 Ga0207690_100535092 219
172 3300025938 Ga0207704_10577235 Ga0207704_105772351 219
173 3300025945 Ga0207679_10075559 Ga0207679_100755592 219
174 3300026041 Ga0207639_10082432 Ga0207639_100824323 219
175 3300026041 Ga0207639_10489915 Ga0207639_104899152 219
176 3300026089 Ga0207648_10010973 Ga0207648_100109737 219
177 3300026142 Ga0207698_10582254 Ga0207698_105822542 219
178 3300031548 Ga0307408_100197357 Ga0307408_1001973572 219
179 3300031901 Ga0307406_10192481 Ga0307406_101924812 219
180 3300037418 Ga0395900_0078201 Ga0395900_0078201_1829_2548 219
181 3300037471 Ga0395905_0009807 Ga0395905_0009807_2375_3094 219
182 3300037471 Ga0395905_0251835 Ga0395905_0251835_897_1616 219
183 3300038443 Ga0395901_0143264 Ga0395901_0143264_675_1394 219
184 3300044683 Ga0466965_0097754 Ga0466965_0097754_438_1157 219
185 3300044694 Ga0466963_0184047 Ga0466963_0184047_707_1435 219
186 3300045976 Ga0466967_0215485 Ga0466967_0215485_464_1192 219
187 3300046537 Ga0495598_0000267 Ga0495598_0000267_6308_7027 219
188 3300046539 Ga0495621_0000456 Ga0495621_0000456_5920_6639 219
189 3300046684 Ga0495669_0023106 Ga0495669_0023106_1184_1903 219
190 3300046684 Ga0495669_0033037 Ga0495669_0033037_458_1177 219
191 3300046691 Ga0495670_0008066 Ga0495670_0008066_2127_2846 219
192 3300005331 Ga0070670_100380843 Ga0070670_1003808432 220
193 3300005338 Ga0068868_100446099 Ga0068868_1004460991 220
194 3300005347 Ga0070668_100022684 Ga0070668_1000226843 220
195 3300005354 Ga0070675_100175059 Ga0070675_1001750592 220
196 3300005355 Ga0070671_100442460 Ga0070671_1004424601 220
197 3300005844 Ga0068862_100032743 Ga0068862_1000327435 220
198 3300013297 Ga0157378_10239797 Ga0157378_102397972 220
199 3300025893 Ga0207682_10116257 Ga0207682_101162572 220
200 3300025907 Ga0207645_10100734 Ga0207645_101007341 220
201 3300025940 Ga0207691_10272968 Ga0207691_102729682 220
202 3300025945 Ga0207679_10689943 Ga0207679_106899432 220
203 3300025972 Ga0207668_10014958 Ga0207668_100149583 220
204 3300026121 Ga0207683_10489309 Ga0207683_104893091 220
205 3300028380 Ga0268265_10011047 Ga0268265_100110478 220
206 3300031731 Ga0307405_10418888 Ga0307405_104188882 220
207 3300031911 Ga0307412_10505499 Ga0307412_105054992 220
208 3300032126 Ga0307415_100275803 Ga0307415_1002758032 220
209 3300037312 Ga0395899_0153533 Ga0395899_0153533_844_1554 220
210 3300037418 Ga0395900_0079044 Ga0395900_0079044_1383_2093 220
211 3300037418 Ga0395900_0169969 Ga0395900_0169969_1204_1914 220
212 3300037466 Ga0395898_0041911 Ga0395898_0041911_901_1611 220
213 3300037471 Ga0395905_0206848 Ga0395905_0206848_579_1289 220
214 3300037471 Ga0395905_0575397 Ga0395905_0575397_181_891 220
215 3300046616 Ga0495668_0012632 Ga0495668_0012632_128_847 220
216 3300046616 Ga0495668_0034508 Ga0495668_0034508_1282_2001 220
217 3300046684 Ga0495669_0000952 Ga0495669_0000952_7465_8184 220
218 3300046684 Ga0495669_0006761 Ga0495669_0006761_1516_2235 220
219 3300001990 JGI24737J22298_10026179 JGI24737J22298_100261792 221
220 3300005328 Ga0070676_10246682 Ga0070676_102466821 221
221 3300005330 Ga0070690_100002792 Ga0070690_10000279210 221
222 3300005331 Ga0070670_100056656 Ga0070670_1000566563 221
223 3300005335 Ga0070666_10001353 Ga0070666_100013538 221
224 3300005338 Ga0068868_100000361 Ga0068868_10000036128 221
225 3300005338 Ga0068868_100614772 Ga0068868_1006147722 221
226 3300005339 Ga0070660_100167016 Ga0070660_1001670162 221
227 3300005354 Ga0070675_100474116 Ga0070675_1004741162 221
228 3300005355 Ga0070671_100005114 Ga0070671_10000511412 221
229 3300005355 Ga0070671_100020832 Ga0070671_1000208323 221
230 3300005356 Ga0070674_100008467 Ga0070674_1000084672 221
231 3300005364 Ga0070673_100027429 Ga0070673_1000274293 221
232 3300005364 Ga0070673_100140151 Ga0070673_1001401512 221
233 3300005364 Ga0070673_100220413 Ga0070673_1002204132 221
234 3300005367 Ga0070667_100001049 Ga0070667_10000104927 221
235 3300005367 Ga0070667_100362839 Ga0070667_1003628392 221
236 3300005457 Ga0070662_100062282 Ga0070662_1000622823 221
237 3300005544 Ga0070686_100050577 Ga0070686_1000505773 221
238 3300005548 Ga0070665_100019486 Ga0070665_10001948610 221
239 3300005564 Ga0070664_100052207 Ga0070664_1000522073 221
240 3300005577 Ga0068857_100131180 Ga0068857_1001311802 221
241 3300005617 Ga0068859_100033722 Ga0068859_1000337222 221
242 3300005618 Ga0068864_100003858 Ga0068864_1000038587 221
243 3300005841 Ga0068863_100423157 Ga0068863_1004231572 221
244 3300005842 Ga0068858_100001063 Ga0068858_10000106321 221
245 3300005843 Ga0068860_100134421 Ga0068860_1001344212 221
246 3300006931 Ga0097620_100033722 Ga0097620_1000337222 221
247 3300009098 Ga0105245_10096182 Ga0105245_100961822 221
248 3300009098 Ga0105245_10658537 Ga0105245_106585372 221
249 3300009148 Ga0105243_10139392 Ga0105243_101393923 221
250 3300009177 Ga0105248_10000678 Ga0105248_100006786 221
251 3300009177 Ga0105248_10001267 Ga0105248_1000126728 221
252 3300009177 Ga0105248_10122530 Ga0105248_101225306 221
253 3300013296 Ga0157374_10018302 Ga0157374_100183022 221
254 3300013306 Ga0163162_10030141 Ga0163162_100301418 221
255 3300013306 Ga0163162_10337790 Ga0163162_103377902 221
256 3300013308 Ga0157375_10752646 Ga0157375_107526462 221
257 3300014745 Ga0157377_10013564 Ga0157377_100135642 221
258 3300014968 Ga0157379_10116156 Ga0157379_101161562 221
259 3300025903 Ga0207680_10003407 Ga0207680_100034077 221
260 3300025907 Ga0207645_10197172 Ga0207645_101971722 221
261 3300025920 Ga0207649_10037462 Ga0207649_100374622 221
262 3300025920 Ga0207649_10270210 Ga0207649_102702102 221
263 3300025925 Ga0207650_10018685 Ga0207650_100186856 221
264 3300025926 Ga0207659_10510104 Ga0207659_105101041 221
265 3300025931 Ga0207644_10004347 Ga0207644_100043477 221
266 3300025931 Ga0207644_10105675 Ga0207644_101056753 221
267 3300025933 Ga0207706_10090234 Ga0207706_100902341 221
268 3300025933 Ga0207706_10240561 Ga0207706_102405612 221
269 3300025933 Ga0207706_10261594 Ga0207706_102615942 221
270 3300025935 Ga0207709_10098210 Ga0207709_100982102 221
271 3300025937 Ga0207669_10022873 Ga0207669_100228732 221
272 3300025940 Ga0207691_10101490 Ga0207691_101014902 221
273 3300025941 Ga0207711_10000762 Ga0207711_1000076211 221
274 3300025941 Ga0207711_10002760 Ga0207711_1000276016 221
275 3300025941 Ga0207711_10077224 Ga0207711_100772244 221
276 3300025945 Ga0207679_10183131 Ga0207679_101831312 221
277 3300025960 Ga0207651_10016217 Ga0207651_100162173 221
278 3300025960 Ga0207651_10231301 Ga0207651_102313012 221
279 3300025986 Ga0207658_10001827 Ga0207658_1000182713 221
280 3300026023 Ga0207677_10001627 Ga0207677_100016272 221
281 3300026023 Ga0207677_10040770 Ga0207677_100407701 221
282 3300026023 Ga0207677_10098231 Ga0207677_100982312 221
283 3300026035 Ga0207703_10002466 Ga0207703_1000246615 221
284 3300026088 Ga0207641_10310933 Ga0207641_103109332 221
285 3300026095 Ga0207676_10003644 Ga0207676_100036443 221
286 3300026116 Ga0207674_10057334 Ga0207674_100573342 221
287 3300026121 Ga0207683_10799338 Ga0207683_107993381 221
288 3300026142 Ga0207698_10045403 Ga0207698_100454032 221
289 3300028379 Ga0268266_10018668 Ga0268266_100186689 221
290 3300031824 Ga0307413_10055576 Ga0307413_100555763 221
291 3300031852 Ga0307410_10000681 Ga0307410_100006815 221
292 3300031852 Ga0307410_10014182 Ga0307410_100141823 221
293 3300031901 Ga0307406_10259439 Ga0307406_102594392 221
294 3300031903 Ga0307407_10035571 Ga0307407_100355713 221
295 3300031995 Ga0307409_100024756 Ga0307409_1000247562 221
296 3300032004 Ga0307414_10015475 Ga0307414_100154752 221
297 3300032005 Ga0307411_10008926 Ga0307411_100089265 221
298 3300032005 Ga0307411_10030350 Ga0307411_100303502 221
299 3300032005 Ga0307411_10740633 Ga0307411_107406332 221
300 3300037312 Ga0395899_0037336 Ga0395899_0037336_2834_3547 221
301 3300037312 Ga0395899_0040112 Ga0395899_0040112_1341_2054 221
302 3300037418 Ga0395900_0111262 Ga0395900_0111262_1695_2408 221
303 3300037418 Ga0395900_0518899 Ga0395900_0518899_130_849 221
304 3300037466 Ga0395898_0403309 Ga0395898_0403309_25_741 221
305 3300037471 Ga0395905_0052817 Ga0395905_0052817_1731_2444 221
306 3300037471 Ga0395905_0302310 Ga0395905_0302310_680_1399 221
307 3300037471 Ga0395905_0550172 Ga0395905_0550172_300_1013 221
308 3300038443 Ga0395901_0037956 Ga0395901_0037956_420_1133 221
309 3300038443 Ga0395901_0093276 Ga0395901_0093276_1345_2061 221
310 3300038443 Ga0395901_0198981 Ga0395901_0198981_1177_1890 221
311 3300038443 Ga0395901_0432013 Ga0395901_0432013_293_1012 221
312 3300048909 Ga0496106_0008543 Ga0496106_0008543_6326_7054 221
313 3300048911 Ga0496108_0086192 Ga0496108_0086192_1542_2270 221
314 3300048912 Ga0496109_0004861 Ga0496109_0004861_4080_4808 221
315 3300048913 Ga0496110_0004040 Ga0496110_0004040_8371_9099 221
316 3300048915 Ga0496112_0028999 Ga0496112_0028999_2402_3130 221
317 3300048915 Ga0496112_0099295 Ga0496112_0099295_647_1366 221
318 3300048917 Ga0496114_0000152 Ga0496114_0000152_38135_38851 221
319 3300001990 JGI24737J22298_10001894 JGI24737J22298_100018943 222
320 3300001990 JGI24737J22298_10034678 JGI24737J22298_100346782 222
321 3300005327 Ga0070658_10074881 Ga0070658_100748812 222
322 3300005329 Ga0070683_101048052 Ga0070683_1010480521 222
323 3300005331 Ga0070670_100007203 Ga0070670_10000720311 222
324 3300005331 Ga0070670_100926689 Ga0070670_1009266891 222
325 3300005335 Ga0070666_10005625 Ga0070666_100056252 222
326 3300005340 Ga0070689_100644189 Ga0070689_1006441892 222
327 3300005344 Ga0070661_100026820 Ga0070661_1000268201 222
328 3300005354 Ga0070675_100060619 Ga0070675_1000606193 222
329 3300005355 Ga0070671_100001412 Ga0070671_10000141224 222
330 3300005356 Ga0070674_100139601 Ga0070674_1001396012 222
331 3300005356 Ga0070674_100463738 Ga0070674_1004637382 222
332 3300005364 Ga0070673_100004701 Ga0070673_1000047019 222
333 3300005366 Ga0070659_100001160 Ga0070659_10000116017 222
334 3300005366 Ga0070659_100163506 Ga0070659_1001635061 222
335 3300005366 Ga0070659_100637820 Ga0070659_1006378202 222
336 3300005367 Ga0070667_100018267 Ga0070667_1000182678 222
337 3300005456 Ga0070678_100001074 Ga0070678_10000107413 222
338 3300005457 Ga0070662_100002595 Ga0070662_10000259513 222
339 3300005457 Ga0070662_100005920 Ga0070662_1000059204 222
340 3300005459 Ga0068867_100305419 Ga0068867_1003054192 222
341 3300005466 Ga0070685_10117234 Ga0070685_101172342 222
342 3300005535 Ga0070684_100546347 Ga0070684_1005463472 222
343 3300005543 Ga0070672_100004242 Ga0070672_1000042423 222
344 3300005543 Ga0070672_100140288 Ga0070672_1001402883 222
345 3300005543 Ga0070672_100524754 Ga0070672_1005247542 222
346 3300005546 Ga0070696_100061179 Ga0070696_1000611793 222
347 3300005548 Ga0070665_100013915 Ga0070665_1000139153 222
348 3300005548 Ga0070665_100039773 Ga0070665_1000397737 222
349 3300005564 Ga0070664_100010573 Ga0070664_1000105733 222
350 3300005564 Ga0070664_100078152 Ga0070664_1000781522 222
351 3300005577 Ga0068857_100028584 Ga0068857_1000285842 222
352 3300005617 Ga0068859_100003354 Ga0068859_10000335419 222
353 3300005618 Ga0068864_100049023 Ga0068864_1000490234 222
354 3300005618 Ga0068864_100195262 Ga0068864_1001952622 222
355 3300005841 Ga0068863_100015256 Ga0068863_1000152567 222
356 3300005841 Ga0068863_100264490 Ga0068863_1002644902 222
357 3300005841 Ga0068863_100328692 Ga0068863_1003286922 222
358 3300005842 Ga0068858_100019682 Ga0068858_1000196822 222
359 3300005843 Ga0068860_100369068 Ga0068860_1003690682 222
360 3300006237 Ga0097621_100024918 Ga0097621_1000249184 222
361 3300006358 Ga0068871_100013569 Ga0068871_1000135692 222
362 3300006881 Ga0068865_100152947 Ga0068865_1001529472 222
363 3300006931 Ga0097620_100003354 Ga0097620_10000335419 222
364 3300009177 Ga0105248_10006373 Ga0105248_1000637314 222
365 3300009177 Ga0105248_10015401 Ga0105248_1001540110 222
366 3300009177 Ga0105248_10056671 Ga0105248_100566715 222
367 3300009177 Ga0105248_10394841 Ga0105248_103948412 222
368 3300010375 Ga0105239_10799271 Ga0105239_107992711 222
369 3300013105 Ga0157369_10051888 Ga0157369_100518882 222
370 3300013306 Ga0163162_10002607 Ga0163162_1000260715 222
371 3300013308 Ga0157375_10010935 Ga0157375_100109355 222
372 3300014325 Ga0163163_10004898 Ga0163163_100048988 222
373 3300014325 Ga0163163_10066181 Ga0163163_100661812 222
374 3300025903 Ga0207680_10442498 Ga0207680_104424981 222
375 3300025904 Ga0207647_10006282 Ga0207647_100062822 222
376 3300025904 Ga0207647_10204560 Ga0207647_102045602 222
377 3300025909 Ga0207705_10154789 Ga0207705_101547892 222
378 3300025920 Ga0207649_10057761 Ga0207649_100577612 222
379 3300025920 Ga0207649_10176550 Ga0207649_101765502 222
380 3300025925 Ga0207650_10012679 Ga0207650_100126794 222
381 3300025925 Ga0207650_10030176 Ga0207650_100301763 222
382 3300025926 Ga0207659_10017208 Ga0207659_100172085 222
383 3300025931 Ga0207644_10001246 Ga0207644_1000124620 222
384 3300025931 Ga0207644_10017727 Ga0207644_100177276 222
385 3300025931 Ga0207644_10033254 Ga0207644_100332544 222
386 3300025931 Ga0207644_10099813 Ga0207644_100998132 222
387 3300025932 Ga0207690_10002667 Ga0207690_100026678 222
388 3300025933 Ga0207706_10000866 Ga0207706_100008666 222
389 3300025933 Ga0207706_10027425 Ga0207706_100274252 222
390 3300025933 Ga0207706_10052152 Ga0207706_100521525 222
391 3300025937 Ga0207669_10126262 Ga0207669_101262622 222
392 3300025937 Ga0207669_10152017 Ga0207669_101520172 222
393 3300025938 Ga0207704_10123706 Ga0207704_101237062 222
394 3300025940 Ga0207691_10002422 Ga0207691_100024229 222
395 3300025940 Ga0207691_10024593 Ga0207691_100245932 222
396 3300025941 Ga0207711_10002740 Ga0207711_1000274021 222
397 3300025941 Ga0207711_10018302 Ga0207711_100183029 222
398 3300025941 Ga0207711_10060825 Ga0207711_100608252 222
399 3300025941 Ga0207711_10206273 Ga0207711_102062732 222
400 3300025945 Ga0207679_10023526 Ga0207679_100235264 222
401 3300025945 Ga0207679_10032648 Ga0207679_100326482 222
402 3300025960 Ga0207651_10017520 Ga0207651_100175203 222
403 3300025961 Ga0207712_10445567 Ga0207712_104455672 222
404 3300025986 Ga0207658_10037871 Ga0207658_100378712 222
405 3300025986 Ga0207658_10095380 Ga0207658_100953803 222
406 3300025986 Ga0207658_10468403 Ga0207658_104684032 222
407 3300026035 Ga0207703_10026227 Ga0207703_100262276 222
408 3300026088 Ga0207641_10017033 Ga0207641_100170334 222
409 3300026088 Ga0207641_10023354 Ga0207641_100233541 222
410 3300026088 Ga0207641_10310954 Ga0207641_103109542 222
411 3300026089 Ga0207648_10008008 Ga0207648_100080088 222
412 3300026089 Ga0207648_10107872 Ga0207648_101078723 222
413 3300026095 Ga0207676_10008522 Ga0207676_100085224 222
414 3300026095 Ga0207676_10036894 Ga0207676_100368943 222
415 3300026116 Ga0207674_10002976 Ga0207674_1000297614 222
416 3300026121 Ga0207683_10007362 Ga0207683_100073628 222
417 3300026121 Ga0207683_10020864 Ga0207683_100208647 222
418 3300026142 Ga0207698_10033039 Ga0207698_100330393 222
419 3300028379 Ga0268266_10021340 Ga0268266_100213403 222
420 3300028381 Ga0268264_10190844 Ga0268264_101908442 222
421 3300031456 Ga0307513_10350112 Ga0307513_103501121 222
422 3300032002 Ga0307416_100685371 Ga0307416_1006853712 222
423 3300035113 Ga0373936_0059771 Ga0373936_0059771_744_1460 222
424 3300035170 Ga0373943_0045046 Ga0373943_0045046_270_986 222
425 3300035692 Ga0373935_0007220 Ga0373935_0007220_2056_2772 222
426 3300035695 Ga0373927_0040041 Ga0373927_0040041_807_1523 222
427 3300037068 Ga0373925_0037427 Ga0373925_0037427_1094_1810 222
428 3300037312 Ga0395899_0295750 Ga0395899_0295750_360_1076 222
429 3300037418 Ga0395900_0563482 Ga0395900_0563482_120_836 222
430 3300037466 Ga0395898_0461073 Ga0395898_0461073_421_1137 222
431 3300037471 Ga0395905_0011033 Ga0395905_0011033_4991_5707 222
432 3300037471 Ga0395905_0363693 Ga0395905_0363693_94_810 222
433 3300038443 Ga0395901_0110286 Ga0395901_0110286_363_1079 222
434 3300038443 Ga0395901_0235208 Ga0395901_0235208_282_998 222
435 3300046472 Ga0495580_0249061 Ga0495580_0249061_415_1131 222
436 3300046525 Ga0495663_0038747 Ga0495663_0038747_28_744 222
437 3300046684 Ga0495669_0020298 Ga0495669_0020298_1220_1939 222
438 3300046684 Ga0495669_0037489 Ga0495669_0037489_775_1491 222
439 3300047445 Ga0495677_0014230 Ga0495677_0014230_1735_2451 222
440 3300048903 Ga0496100_0251860 Ga0496100_0251860_137_853 222
441 3300048904 Ga0496101_0010534 Ga0496101_0010534_3863_4579 222
442 3300048904 Ga0496101_0175492 Ga0496101_0175492_885_1601 222
443 3300048905 Ga0496102_0120927 Ga0496102_0120927_1568_2284 222
444 3300048911 Ga0496108_0009557 Ga0496108_0009557_5496_6212 222
445 3300048912 Ga0496109_0009641 Ga0496109_0009641_4525_5241 222
446 3300048913 Ga0496110_0027627 Ga0496110_0027627_2674_3390 222
447 3300048913 Ga0496110_0447673 Ga0496110_0447673_395_1111 222
448 3300048914 Ga0496111_0014914 Ga0496111_0014914_1507_2223 222
449 3300048915 Ga0496112_0038526 Ga0496112_0038526_2152_2868 222
450 3300048915 Ga0496112_0265186 Ga0496112_0265186_235_951 222
451 3300048916 Ga0496113_0245953 Ga0496113_0245953_396_1112 222
452 3300048918 Ga0496115_0132467 Ga0496115_0132467_312_1028 222
453 3300001904 JGI24736J21556_1007296 JGI24736J21556_10072962 223
454 3300001990 JGI24737J22298_10005411 JGI24737J22298_100054114 223
455 3300002077 JGI24744J21845_10004489 JGI24744J21845_100044894 223
456 3300005328 Ga0070676_10290914 Ga0070676_102909142 223
457 3300005331 Ga0070670_100043485 Ga0070670_1000434852 223
458 3300005331 Ga0070670_100144501 Ga0070670_1001445012 223
459 3300005334 Ga0068869_100189041 Ga0068869_1001890412 223
460 3300005335 Ga0070666_10066999 Ga0070666_100669992 223
461 3300005338 Ga0068868_100189023 Ga0068868_1001890232 223
462 3300005338 Ga0068868_100206603 Ga0068868_1002066032 223
463 3300005338 Ga0068868_100419493 Ga0068868_1004194932 223
464 3300005339 Ga0070660_100022241 Ga0070660_1000222415 223
465 3300005339 Ga0070660_100087759 Ga0070660_1000877593 223
466 3300005339 Ga0070660_100119903 Ga0070660_1001199032 223
467 3300005339 Ga0070660_100655125 Ga0070660_1006551252 223
468 3300005344 Ga0070661_100167835 Ga0070661_1001678352 223
469 3300005344 Ga0070661_100240164 Ga0070661_1002401642 223
470 3300005344 Ga0070661_100451747 Ga0070661_1004517472 223
471 3300005353 Ga0070669_100074968 Ga0070669_1000749682 223
472 3300005354 Ga0070675_100147748 Ga0070675_1001477482 223
473 3300005355 Ga0070671_100009375 Ga0070671_1000093757 223
474 3300005355 Ga0070671_100010501 Ga0070671_1000105012 223
475 3300005355 Ga0070671_100021658 Ga0070671_1000216583 223
476 3300005356 Ga0070674_100123160 Ga0070674_1001231602 223
477 3300005364 Ga0070673_100323193 Ga0070673_1003231932 223
478 3300005364 Ga0070673_100324582 Ga0070673_1003245822 223
479 3300005366 Ga0070659_100015652 Ga0070659_1000156526 223
480 3300005366 Ga0070659_100230858 Ga0070659_1002308582 223
481 3300005434 Ga0070709_10395220 Ga0070709_103952201 223
482 3300005435 Ga0070714_100045285 Ga0070714_1000452852 223
483 3300005438 Ga0070701_10275556 Ga0070701_102755561 223
484 3300005444 Ga0070694_100040131 Ga0070694_1000401313 223
485 3300005455 Ga0070663_100018540 Ga0070663_1000185406 223
486 3300005455 Ga0070663_100042182 Ga0070663_1000421823 223
487 3300005456 Ga0070678_100187659 Ga0070678_1001876592 223
488 3300005457 Ga0070662_100048413 Ga0070662_1000484133 223
489 3300005457 Ga0070662_100144033 Ga0070662_1001440332 223
490 3300005459 Ga0068867_100244514 Ga0068867_1002445141 223
491 3300005543 Ga0070672_100047113 Ga0070672_1000471135 223
492 3300005543 Ga0070672_100066550 Ga0070672_1000665503 223
493 3300005543 Ga0070672_100456112 Ga0070672_1004561122 223
494 3300005545 Ga0070695_100087122 Ga0070695_1000871223 223
495 3300005548 Ga0070665_100006491 Ga0070665_10000649112 223
496 3300005563 Ga0068855_100604952 Ga0068855_1006049522 223
497 3300005564 Ga0070664_100002900 Ga0070664_10000290018 223
498 3300005616 Ga0068852_100609212 Ga0068852_1006092121 223
499 3300005616 Ga0068852_100960737 Ga0068852_1009607371 223
500 3300005617 Ga0068859_100094285 Ga0068859_1000942853 223
501 3300005618 Ga0068864_100001105 Ga0068864_1000011052 223
502 3300005618 Ga0068864_100032901 Ga0068864_1000329013 223
503 3300005618 Ga0068864_100218769 Ga0068864_1002187692 223
504 3300005834 Ga0068851_10130974 Ga0068851_101309742 223
505 3300005841 Ga0068863_100101928 Ga0068863_1001019282 223
506 3300005842 Ga0068858_100008380 Ga0068858_10000838010 223
507 3300005843 Ga0068860_100004967 Ga0068860_10000496716 223
508 3300005844 Ga0068862_100094996 Ga0068862_1000949963 223
509 3300005985 Ga0081539_10024064 Ga0081539_100240642 223
510 3300006028 Ga0070717_10086969 Ga0070717_100869692 223
511 3300006175 Ga0070712_100138980 Ga0070712_1001389802 223
512 3300006358 Ga0068871_100348288 Ga0068871_1003482882 223
513 3300006852 Ga0075433_10025414 Ga0075433_100254146 223
514 3300006881 Ga0068865_100184513 Ga0068865_1001845132 223
515 3300006931 Ga0097620_100094283 Ga0097620_1000942833 223
516 3300009093 Ga0105240_10656128 Ga0105240_106561282 223
517 3300009098 Ga0105245_10058357 Ga0105245_100583572 223
518 3300009098 Ga0105245_10071145 Ga0105245_100711452 223
519 3300009148 Ga0105243_10072504 Ga0105243_100725043 223
520 3300009148 Ga0105243_10143986 Ga0105243_101439863 223
521 3300009174 Ga0105241_10338910 Ga0105241_103389102 223
522 3300009177 Ga0105248_10001352 Ga0105248_1000135217 223
523 3300009553 Ga0105249_10025536 Ga0105249_100255366 223
524 3300010375 Ga0105239_10059251 Ga0105239_100592514 223
525 3300011119 Ga0105246_10222107 Ga0105246_102221072 223
526 3300014326 Ga0157380_10229831 Ga0157380_102298312 223
527 3300014968 Ga0157379_10657857 Ga0157379_106578572 223
528 3300021384 Ga0213876_10119583 Ga0213876_101195832 223
529 3300025315 Ga0207697_10004884 Ga0207697_100048842 223
530 3300025899 Ga0207642_10073816 Ga0207642_100738162 223
531 3300025901 Ga0207688_10096472 Ga0207688_100964722 223
532 3300025904 Ga0207647_10001089 Ga0207647_1000108924 223
533 3300025904 Ga0207647_10020394 Ga0207647_100203947 223
534 3300025912 Ga0207707_10445879 Ga0207707_104458792 223
535 3300025913 Ga0207695_10647195 Ga0207695_106471952 223
536 3300025919 Ga0207657_10034110 Ga0207657_100341102 223
537 3300025919 Ga0207657_10075795 Ga0207657_100757952 223
538 3300025920 Ga0207649_10323488 Ga0207649_103234882 223
539 3300025926 Ga0207659_10207855 Ga0207659_102078552 223
540 3300025927 Ga0207687_10075075 Ga0207687_100750752 223
541 3300025931 Ga0207644_10020546 Ga0207644_100205466 223
542 3300025931 Ga0207644_10056563 Ga0207644_100565634 223
543 3300025931 Ga0207644_10311457 Ga0207644_103114572 223
544 3300025932 Ga0207690_10001017 Ga0207690_100010174 223
545 3300025933 Ga0207706_10002963 Ga0207706_1000296315 223
546 3300025933 Ga0207706_10028623 Ga0207706_100286237 223
547 3300025933 Ga0207706_10171865 Ga0207706_101718652 223
548 3300025935 Ga0207709_10114618 Ga0207709_101146182 223
549 3300025937 Ga0207669_10046344 Ga0207669_100463442 223
550 3300025938 Ga0207704_10038554 Ga0207704_100385542 223
551 3300025940 Ga0207691_10006407 Ga0207691_100064078 223
552 3300025940 Ga0207691_10022475 Ga0207691_100224757 223
553 3300025941 Ga0207711_10003424 Ga0207711_100034242 223
554 3300025942 Ga0207689_10008971 Ga0207689_100089715 223
555 3300025942 Ga0207689_10017597 Ga0207689_100175977 223
556 3300025945 Ga0207679_10194789 Ga0207679_101947892 223
557 3300025945 Ga0207679_10505490 Ga0207679_105054902 223
558 3300025949 Ga0207667_10093251 Ga0207667_100932513 223
559 3300025960 Ga0207651_10051695 Ga0207651_100516952 223
560 3300025961 Ga0207712_10001307 Ga0207712_100013073 223
561 3300025972 Ga0207668_10112134 Ga0207668_101121342 223
562 3300025981 Ga0207640_10002493 Ga0207640_100024932 223
563 3300025981 Ga0207640_10526014 Ga0207640_105260142 223
564 3300025986 Ga0207658_10032021 Ga0207658_100320212 223
565 3300026035 Ga0207703_10002535 Ga0207703_1000253516 223
566 3300026041 Ga0207639_10580209 Ga0207639_105802092 223
567 3300026067 Ga0207678_10001628 Ga0207678_1000162814 223
568 3300026089 Ga0207648_10012951 Ga0207648_100129512 223
569 3300026089 Ga0207648_10047342 Ga0207648_100473423 223
570 3300026095 Ga0207676_10003094 Ga0207676_1000309410 223
571 3300026095 Ga0207676_10084476 Ga0207676_100844764 223
572 3300026095 Ga0207676_10286695 Ga0207676_102866952 223
573 3300026095 Ga0207676_10369690 Ga0207676_103696902 223
574 3300026116 Ga0207674_10134488 Ga0207674_101344882 223
575 3300026116 Ga0207674_10288006 Ga0207674_102880062 223
576 3300026121 Ga0207683_10002694 Ga0207683_1000269414 223
577 3300026142 Ga0207698_10444371 Ga0207698_104443712 223
578 3300026142 Ga0207698_10546433 Ga0207698_105464332 223
579 3300028380 Ga0268265_10069773 Ga0268265_100697734 223
580 3300028380 Ga0268265_10349736 Ga0268265_103497362 223
581 3300028381 Ga0268264_10003081 Ga0268264_100030814 223
582 3300032002 Ga0307416_100028706 Ga0307416_1000287064 223
583 3300032002 Ga0307416_100277652 Ga0307416_1002776522 223
584 3300032005 Ga0307411_10008875 Ga0307411_100088752 223
585 3300037312 Ga0395899_0025681 Ga0395899_0025681_2474_3193 223
586 3300037418 Ga0395900_0023312 Ga0395900_0023312_562_1287 223
587 3300037418 Ga0395900_0588239 Ga0395900_0588239_315_1034 223
588 3300037466 Ga0395898_0003587 Ga0395898_0003587_13254_13979 223
589 3300037466 Ga0395898_0014122 Ga0395898_0014122_5535_6254 223
590 3300037471 Ga0395905_0000298 Ga0395905_0000298_3350_4069 223
591 3300037471 Ga0395905_0006325 Ga0395905_0006325_413_1138 223
592 3300037471 Ga0395905_0008446 Ga0395905_0008446_4719_5438 223
593 3300037471 Ga0395905_0341438 Ga0395905_0341438_235_954 223
594 3300037471 Ga0395905_0435538 Ga0395905_0435538_237_956 223
595 3300038443 Ga0395901_0005043 Ga0395901_0005043_5683_6408 223
596 3300038443 Ga0395901_0061801 Ga0395901_0061801_2859_3578 223
597 3300038443 Ga0395901_0078282 Ga0395901_0078282_2412_3131 223
598 3300039437 Ga0436365_1417856 Ga0436365_1417856_5858_6577 223
599 3300046616 Ga0495668_0014919 Ga0495668_0014919_213_932 223
600 3300046684 Ga0495669_0008958 Ga0495669_0008958_68_787 223
601 3300048905 Ga0496102_0053753 Ga0496102_0053753_2758_3477 223
602 3300048905 Ga0496102_0304936 Ga0496102_0304936_737_1456 223
603 3300048906 Ga0496103_0277523 Ga0496103_0277523_346_1065 223
604 3300048911 Ga0496108_0001668 Ga0496108_0001668_15678_16397 223
605 3300048911 Ga0496108_0029509 Ga0496108_0029509_2789_3508 223
606 3300048912 Ga0496109_0274498 Ga0496109_0274498_234_953 223
607 3300048913 Ga0496110_0021273 Ga0496110_0021273_1511_2230 223
608 3300048915 Ga0496112_0012709 Ga0496112_0012709_1077_1796 223
609 3300048915 Ga0496112_0064850 Ga0496112_0064850_2532_3257 223
610 3300048915 Ga0496112_0163347 Ga0496112_0163347_929_1648 223
611 3300048916 Ga0496113_0001076 Ga0496113_0001076_11850_12569 223
612 3300048916 Ga0496113_0024534 Ga0496113_0024534_2084_2809 223
613 3300049583 Ga0501067_0161122 Ga0501067_0161122_207_926 223
614 3300050515 nmdc:mga0a205_10035_c1 nmdc:mga0a205_10035_c1_7315_8034 223
615 3300053134 Ga0500658_0001554 Ga0500658_0001554_5599_6318 223

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14014

DUF4230

Protein of unknown function (DUF4230)

49

201

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3a7u-assembly1.cif.gz_A crystal structure of the bovine lipoyltransferase in its unliganded form 0.7029 47 70
5oj2-assembly2.cif.gz_B crystal structure of the chicken mdga1 ectodomain 0.658 44 75
4mhz-assembly1.cif.gz_A crystal structure of apo-form glutaminyl cyclase from ixodes scapularis in complex with pbd150 0.566 25 71
3llc-assembly1.cif.gz_A crystal structure of putative hydrolase (yp_002548124.1) from agrobacterium vitis s4 at 1.80 a resolution 0.5579 48 69
6pku-assembly2.cif.gz_D guinea pig n-acetylglucosamine-1-phosphodiester alpha-n-acetylglucosaminidase (nagpa) catalytic domain (c51s c221s) in complex with n-acetyl-alpha-d-glucosamine (alpha-glcnac) and mannose 6-phosphate (m6p) 0.5558 45 69
ID Description Score Start End Superfamily
af_O80502_72_305_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.7525 46 71 2.120.10.80
af_A0A368UIH5_1_147_1.20.58.1980 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.6901 43 70 1.20.58.1980
af_Q4CSS9_738_889_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.6783 47 71 3.30.565.10
af_Q6AUW4_68_290_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6778 49 68 3.40.50.300
af_A0A1D6DVY2_1_360_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.657 47 71 2.120.10.30
ID Description Score Start End GO Terms
AF-A0A7X1F895-F1-model_v4 DUF4230 domain-containing protein 0.9117 22 196
AF-A0A0N0K0F4-F1-model_v4 DUF4230 domain-containing protein 0.887 14 189
AF-A0A1I1B7M8-F1-model_v4 DUF4230 domain-containing protein 0.8809 39 189
AF-A0A1W9GUB7-F1-model_v4 DUF4230 domain-containing protein 0.875 22 190
AF-A0A081RJE7-F1-model_v4 DUF4230 domain-containing protein 0.8691 19 190

Feature Viewer

pLDDT pTM Quality
76.02 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map