F469416

General Info

Members Datasets Scaffolds Average Seq Length
615 300 1230 397

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100061405|Ga0070669_1000614051
Length 431
Sequence MKRDGGGPTLAADSRSAADYIGNQPSLLSLMSVSTLSTTDQLAAWRADTPGCAHRNHLNNAGAALMPQPVSDAITEHVTLESEIGGYEAADTRANEVAGGYDALAEIVGAKAENIAVVANATAGFTQALSSFDFAPGDVIVTTHCDYTSNQIQYLALSARLGVEIAYADDLPEGGVDPQSVREIVARRRPRVVAVTWIPTNSGLVQDVEAIGAVCEAAGVPYLIDACQAVGQIPIDVARLKCDYLSATARKFMRGPRGIGFMFASDRALARGDHPLFVDMRGARWVEAGTYEVVPTARRYEDWEFPYALVLGQAAAARYSLDVGIDVAQSRAWALAQRLRDALGGMRGVRVLDRGTTRCAIVTAAFEGRDAEPIVRALKDRRINTVSSLREFGIYDFDAKHVKSAVRLSPHYYNTEAEVDAAVAALRDILA

Samples

Sample ID Description Type Environment
1 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
147 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
148 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
151 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
152 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
164 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
165 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
166 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
167 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
168 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
169 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
170 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
171 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
172 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
173 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
174 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
175 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
176 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
177 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
178 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
180 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
181 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
186 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
187 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
188 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
189 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
190 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
191 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
192 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
193 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
194 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
195 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
196 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
197 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
198 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
199 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
200 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
201 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
202 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
203 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
204 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
205 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
206 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
207 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
208 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
209 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
210 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
211 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
212 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
213 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
214 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
215 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
216 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
217 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
218 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
219 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
220 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
221 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
222 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
223 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
224 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
225 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
226 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
227 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
228 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
229 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
230 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
231 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
232 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
233 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
234 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
235 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
236 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
237 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
238 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
243 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
244 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
245 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
246 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
247 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
248 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
261 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
262 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
263 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
264 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
265 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
266 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
267 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
268 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
269 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
270 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
271 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
272 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
273 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
274 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
275 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
276 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
277 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
278 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
281 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
282 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
283 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
284 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
285 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
286 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
287 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
288 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
289 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
290 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
291 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
292 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
293 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
294 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
295 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
296 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
297 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
298 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
299 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
300 2904467357 Chitinophaga sancti 3198 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0
Isolates 0.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.33
Nodule 0
Rhizoplane 4.23
Rhizosphere 93.98
Stem 0
Stem Tuber 0
Unclassified 8.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070669_100061405 3300005353 Bacteria 2761
2 MBSR1b_contig_8136192 2162886012 Bacteria 1470
3 rootL2_10134362 3300003322 Bacteria 3082
4 rootH1_10071314 3300003323 Bacteria 3048
5 Ga0065715_10091439 3300005293 Bacteria 5794
6 Ga0070683_100020868 3300005329 Bacteria 5839
7 Ga0070683_100030918 3300005329 Bacteria 4865
8 Ga0070683_100031536 3300005329 Unclassified 4821
9 Ga0070683_100042722 3300005329 Bacteria 4175
10 Ga0070670_100005703 3300005331 Bacteria 10519
11 Ga0070670_100051372 3300005331 Bacteria 3540
12 Ga0070666_10002732 3300005335 Bacteria 10661
13 Ga0070680_100052988 3300005336 Bacteria 3311
14 Ga0070660_100045498 3300005339 Bacteria 3360
15 Ga0070660_100153439 3300005339 Bacteria 1853
16 Ga0070660_100153916 3300005339 Bacteria 1850
17 Ga0070660_100278173 3300005339 Unclassified 1369
18 Ga0070689_100032716 3300005340 Plasmid 3957
19 Ga0070689_100184627 3300005340 Bacteria 1695
20 Ga0070661_100018417 3300005344 Bacteria 4963
21 Ga0070661_100023899 3300005344 Bacteria 4384
22 Ga0070661_100070716 3300005344 Bacteria 2567
23 Ga0070692_10033435 3300005345 Unclassified 2591
24 Ga0070668_100003340 3300005347 Bacteria 11831
25 Ga0070668_100027220 3300005347 Unclassified 4340
26 Ga0070669_100000040 3300005353 Bacteria 130277
27 Ga0070669_100011625 3300005353 Bacteria 6245
28 Ga0070669_100027070 3300005353 Unclassified 4126
29 Ga0070669_100121510 3300005353 Bacteria 1993
30 Ga0070675_100009221 3300005354 Bacteria 7664
31 Ga0070675_100052412 3300005354 Unclassified 3354
32 Ga0070671_100033499 3300005355 Bacteria 4249
33 Ga0070671_100066740 3300005355 Bacteria 2998
34 Ga0070674_100043057 3300005356 Unclassified 3070
35 Ga0070673_100110609 3300005364 Bacteria 2278
36 Ga0070688_100099417 3300005365 Bacteria 1915
37 Ga0070659_100025724 3300005366 Bacteria 4525
38 Ga0070659_100042998 3300005366 Bacteria 3533
39 Ga0070659_100185918 3300005366 Unclassified 1706
40 Ga0070667_100022099 3300005367 Bacteria 5276
41 Ga0070667_100058297 3300005367 Bacteria 3265
42 Ga0070703_10009734 3300005406 Bacteria 2710
43 Ga0070709_10000058 3300005434 Bacteria 85194
44 Ga0070709_10001443 3300005434 Bacteria 12829
45 Ga0070709_10006185 3300005434 Bacteria 6518
46 Ga0070709_10103736 3300005434 Bacteria 1899
47 Ga0070714_100053139 3300005435 Bacteria 3457
48 Ga0070714_100222263 3300005435 Unclassified 1736
49 Ga0070713_100000077 3300005436 Bacteria 61320
50 Ga0070713_100017710 3300005436 Bacteria 5397
51 Ga0070701_10004874 3300005438 Bacteria 5489
52 Ga0070711_100000135 3300005439 Bacteria 39269
53 Ga0070705_100010965 3300005440 Bacteria 4554
54 Ga0070705_100213721 3300005440 Bacteria 1331
55 Ga0070700_100041700 3300005441 Bacteria 2815
56 Ga0070694_100005514 3300005444 Bacteria 7662
57 Ga0070694_100076434 3300005444 Bacteria 2318
58 Ga0070694_100081280 3300005444 Bacteria 2254
59 Ga0070708_100000854 3300005445 Bacteria 22937
60 Ga0070708_100020641 3300005445 Bacteria 5560
61 Ga0070708_100026273 3300005445 Bacteria 4982
62 Ga0070708_100071143 3300005445 Bacteria 3131
63 Ga0070708_100209304 3300005445 Bacteria 1827
64 Ga0070662_100020021 3300005457 Unclassified 4553
65 Ga0070681_10003174 3300005458 Bacteria 15296
66 Ga0070681_10033825 3300005458 Bacteria 5132
67 Ga0070681_10110821 3300005458 Bacteria 2684
68 Ga0070681_10161385 3300005458 Bacteria 2166
69 Ga0070681_10163489 3300005458 Bacteria 2149
70 Ga0068867_100115503 3300005459 Unclassified 2067
71 Ga0068867_100145142 3300005459 Bacteria 1859
72 Ga0070685_10134571 3300005466 Bacteria 1549
73 Ga0070706_100002646 3300005467 Bacteria 17925
74 Ga0070706_100011008 3300005467 Bacteria 8400
75 Ga0070706_100015385 3300005467 Bacteria 7066
76 Ga0070706_100032810 3300005467 Bacteria 4791
77 Ga0070707_100000940 3300005468 Bacteria 28929
78 Ga0070707_100005017 3300005468 Bacteria 12400
79 Ga0070707_100040393 3300005468 Bacteria 4463
80 Ga0070707_100079661 3300005468 Bacteria 3162
81 Ga0070698_100001663 3300005471 Bacteria 24805
82 Ga0070698_100002473 3300005471 Bacteria 20388
83 Ga0070698_100004836 3300005471 Bacteria 14787
84 Ga0070698_100008172 3300005471 Bacteria 11313
85 Ga0070698_100013739 3300005471 Bacteria 8570
86 Ga0070698_100076686 3300005471 Bacteria 3344
87 Ga0070698_100108942 3300005471 Bacteria 2737
88 Ga0070698_100123653 3300005471 Bacteria 2545
89 Ga0070698_100176094 3300005471 Unclassified 2078
90 Ga0070698_100369782 3300005471 Bacteria 1366
91 Ga0070699_100001889 3300005518 Bacteria 18917
92 Ga0070699_100008414 3300005518 Bacteria 8935
93 Ga0070699_100027430 3300005518 Bacteria 4911
94 Ga0070699_100054538 3300005518 Bacteria 3460
95 Ga0070699_100063021 3300005518 Bacteria 3214
96 Ga0070699_100119533 3300005518 Unclassified 2316
97 Ga0070679_100003567 3300005530 Bacteria 14249
98 Ga0070679_100017214 3300005530 Bacteria 6991
99 Ga0070679_100066870 3300005530 Bacteria 3583
100 Ga0070679_100147557 3300005530 Bacteria 2329
101 Ga0070684_100098662 3300005535 Bacteria 2606
102 Ga0070684_100190905 3300005535 Bacteria 1864
103 Ga0070684_100215288 3300005535 Bacteria 1752
104 Ga0070684_100234743 3300005535 Bacteria 1675
105 Ga0070697_100000381 3300005536 Bacteria 34659
106 Ga0070697_100003424 3300005536 Bacteria 12202
107 Ga0070697_100011737 3300005536 Bacteria 6852
108 Ga0070697_100118533 3300005536 Bacteria 2212
109 Ga0070697_100127875 3300005536 Bacteria 2129
110 Ga0070697_100160625 3300005536 Bacteria 1898
111 Ga0070697_100293861 3300005536 Bacteria 1396
112 Ga0070672_100085422 3300005543 Bacteria 2536
113 Ga0070695_100025086 3300005545 Bacteria 3678
114 Ga0070695_100086577 3300005545 Bacteria 2082
115 Ga0070696_100065549 3300005546 Bacteria 2546
116 Ga0070696_100109157 3300005546 Bacteria 1991
117 Ga0070693_100011727 3300005547 Bacteria 4420
118 Ga0070665_100073629 3300005548 Bacteria 3421
119 Ga0070665_100179219 3300005548 Bacteria 2120
120 Ga0070704_100046495 3300005549 Bacteria 3027
121 Ga0070664_100024556 3300005564 Bacteria 4986
122 Ga0070664_100028605 3300005564 Bacteria 4638
123 Ga0070664_100039639 3300005564 Unclassified 3970
124 Ga0070664_100073471 3300005564 Unclassified 2934
125 Ga0070664_100141633 3300005564 Bacteria 2118
126 Ga0068857_100004462 3300005577 Bacteria 11823
127 Ga0068857_100018881 3300005577 Bacteria 6049
128 Ga0068857_100045447 3300005577 Bacteria 3896
129 Ga0068854_100284011 3300005578 Bacteria 1334
130 Ga0068852_100043192 3300005616 Unclassified 3822
131 Ga0068852_100063758 3300005616 Bacteria 3210
132 Ga0068859_100031563 3300005617 Bacteria 5320
133 Ga0068859_100123243 3300005617 Unclassified 2659
134 Ga0068859_100175320 3300005617 Bacteria 2226
135 Ga0068859_100204583 3300005617 Bacteria 2059
136 Ga0068864_100035751 3300005618 Bacteria 4231
137 Ga0068864_100046891 3300005618 Bacteria 3709
138 Ga0068864_100052294 3300005618 Bacteria 3520
139 Ga0068861_100009018 3300005719 Bacteria 6876
140 Ga0068861_100095165 3300005719 Unclassified 2358
141 Ga0068858_100392407 3300005842 Bacteria 1333
142 Ga0068860_100021485 3300005843 Bacteria 6249
143 Ga0068860_100249180 3300005843 Bacteria 1729
144 Ga0068862_100003550 3300005844 Bacteria 13356
145 Ga0068862_100012182 3300005844 Bacteria 7108
146 Ga0068862_100053312 3300005844 Bacteria 3462
147 Ga0081539_10000035 3300005985 Bacteria 302689
148 Ga0070717_10001001 3300006028 Bacteria 18922
149 Ga0070715_10012078 3300006163 Bacteria 3129
150 Ga0070716_100016565 3300006173 Bacteria 3807
151 Ga0070712_100017466 3300006175 Bacteria 4645
152 Ga0097621_100259234 3300006237 Bacteria 1525
153 Ga0075428_100016478 3300006844 Bacteria 8160
154 Ga0075428_100021709 3300006844 Bacteria 7108
155 Ga0075428_100029113 3300006844 Bacteria 6111
156 Ga0075430_100018727 3300006846 Bacteria 5893
157 Ga0075430_100036910 3300006846 Bacteria 4142
158 Ga0075430_100188400 3300006846 Bacteria 1715
159 Ga0075431_100013938 3300006847 Bacteria 8120
160 Ga0075431_100035928 3300006847 Bacteria 5103
161 Ga0075431_100044594 3300006847 Bacteria 4573
162 Ga0075431_100073394 3300006847 Bacteria 3530
163 Ga0075431_100271165 3300006847 Bacteria 1720
164 Ga0075431_100330245 3300006847 Bacteria 1536
165 Ga0075433_10000469 3300006852 Bacteria 26283
166 Ga0075433_10002031 3300006852 Bacteria 15276
167 Ga0075433_10083086 3300006852 Bacteria 2826
168 Ga0075433_10101589 3300006852 Archaea 2546
169 Ga0075434_100003180 3300006871 Bacteria 14644
170 Ga0075434_100004833 3300006871 Bacteria 12213
171 Ga0075434_100034867 3300006871 Bacteria 4973
172 Ga0075434_100044784 3300006871 Bacteria 4389
173 Ga0075434_100060918 3300006871 Bacteria 3754
174 Ga0075434_100126240 3300006871 Unclassified 2575
175 Ga0075434_100140429 3300006871 Bacteria 2435
176 Ga0075434_100141104 3300006871 Unclassified 2429
177 Ga0075434_100386872 3300006871 Unclassified 1420
178 Ga0075429_100012150 3300006880 Bacteria 7464
179 Ga0075429_100036100 3300006880 Bacteria 4298
180 Ga0075436_100002449 3300006914 Bacteria 12784
181 Ga0075436_100007424 3300006914 Bacteria 7496
182 Ga0075436_100024231 3300006914 Bacteria 4171
183 Ga0075436_100058622 3300006914 Bacteria 2659
184 Ga0075436_100131251 3300006914 Unclassified 1757
185 Ga0097620_100031563 3300006931 Bacteria 5320
186 Ga0097620_100123237 3300006931 Unclassified 2659
187 Ga0097620_100175319 3300006931 Bacteria 2226
188 Ga0097620_100204577 3300006931 Bacteria 2059
189 Ga0075435_100006873 3300007076 Bacteria 8076
190 Ga0075435_100012171 3300007076 Bacteria 6362
191 Ga0075435_100038660 3300007076 Bacteria 3805
192 Ga0075435_100103965 3300007076 Bacteria 2356
193 Ga0075435_100146549 3300007076 Unclassified 1983
194 Ga0075435_100151820 3300007076 Bacteria 1948
195 Ga0099794_10016403 3300007265 Unclassified 3283
196 Ga0099794_10080417 3300007265 Unclassified 1607
197 Ga0111539_10031987 3300009094 Bacteria 6392
198 Ga0111539_10164053 3300009094 Bacteria 2598
199 Ga0111539_10179172 3300009094 Unclassified 2476
200 Ga0114129_10005644 3300009147 Bacteria 17710
201 Ga0114129_10009543 3300009147 Bacteria 13844
202 Ga0114129_10016596 3300009147 Bacteria 10491
203 Ga0114129_10030689 3300009147 Bacteria 7603
204 Ga0114129_10261116 3300009147 Bacteria 2321
205 Ga0114129_10326974 3300009147 Bacteria 2037
206 Ga0105243_10024591 3300009148 Bacteria 4595
207 Ga0105243_10069079 3300009148 Bacteria 2849
208 Ga0105248_10071129 3300009177 Unclassified 3907
209 Ga0105248_10082557 3300009177 Bacteria 3614
210 Ga0105238_10123450 3300009551 Bacteria 2569
211 Ga0105238_10140657 3300009551 Bacteria 2390
212 Ga0105249_10000009 3300009553 Bacteria 313866
213 Ga0105249_10000578 3300009553 Bacteria 33622
214 Ga0105249_10051766 3300009553 Bacteria 3747
215 Ga0105249_10120417 3300009553 Unclassified 2493
216 Ga0157373_10015745 3300013100 Bacteria 5522
217 Ga0157373_10173709 3300013100 Bacteria 1516
218 Ga0157371_10015594 3300013102 Bacteria 5696
219 Ga0157374_10152651 3300013296 Bacteria 2246
220 Ga0157378_10215192 3300013297 Bacteria 1824
221 Ga0163162_10010222 3300013306 Bacteria 9117
222 Ga0163162_10033818 3300013306 Bacteria 5082
223 Ga0163162_10103661 3300013306 Bacteria 2939
224 Ga0157375_10100920 3300013308 Bacteria 2968
225 Ga0163163_10004072 3300014325 Bacteria 12464
226 Ga0163163_10176089 3300014325 Bacteria 2186
227 Ga0157380_10048126 3300014326 Unclassified 3357
228 Ga0157380_10253397 3300014326 Bacteria 1594
229 Ga0157379_10109010 3300014968 Bacteria 2487
230 Ga0157376_10325622 3300014969 Bacteria 1462
231 Ga0182005_1000053 3300015265 Bacteria 113111
232 Ga0163161_10071291 3300017792 Unclassified 2542
233 Ga0209436_105631 3300025208 Unclassified 2847
234 Ga0207697_10027363 3300025315 Unclassified 2331
235 Ga0207656_10015166 3300025321 Bacteria 2980
236 Ga0207653_10003890 3300025885 Bacteria 4694
237 Ga0207653_10006397 3300025885 Bacteria 3674
238 Ga0207692_10005942 3300025898 Bacteria 4926
239 Ga0207642_10025739 3300025899 Bacteria 2385
240 Ga0207647_10052611 3300025904 Bacteria 2513
241 Ga0207699_10000065 3300025906 Bacteria 85512
242 Ga0207699_10002219 3300025906 Bacteria 9160
243 Ga0207699_10086348 3300025906 Unclassified 1959
244 Ga0207699_10109657 3300025906 Bacteria 1767
245 Ga0207645_10000158 3300025907 Bacteria 53304
246 Ga0207684_10000491 3300025910 Bacteria 50201
247 Ga0207684_10001418 3300025910 Bacteria 25959
248 Ga0207684_10016809 3300025910 Bacteria 6281
249 Ga0207684_10028492 3300025910 Bacteria 4758
250 Ga0207684_10056825 3300025910 Bacteria 3320
251 Ga0207684_10094663 3300025910 Bacteria 2548
252 Ga0207684_10171008 3300025910 Bacteria 1873
253 Ga0207684_10333689 3300025910 Bacteria 1306
254 Ga0207707_10013837 3300025912 Bacteria 7035
255 Ga0207707_10093382 3300025912 Bacteria 2628
256 Ga0207707_10113116 3300025912 Bacteria 2373
257 Ga0207695_10153321 3300025913 Bacteria 2241
258 Ga0207693_10019579 3300025915 Bacteria 5382
259 Ga0207663_10000582 3300025916 Bacteria 16145
260 Ga0207662_10011433 3300025918 Bacteria 4924
261 Ga0207657_10146888 3300025919 Bacteria 1923
262 Ga0207652_10028752 3300025921 Bacteria 4640
263 Ga0207646_10004305 3300025922 Bacteria 15544
264 Ga0207646_10044162 3300025922 Bacteria 4000
265 Ga0207646_10095709 3300025922 Bacteria 2660
266 Ga0207681_10000016 3300025923 Bacteria 345352
267 Ga0207681_10006143 3300025923 Bacteria 7369
268 Ga0207681_10046659 3300025923 Bacteria 2915
269 Ga0207650_10176107 3300025925 Unclassified 1702
270 Ga0207659_10006232 3300025926 Bacteria 7295
271 Ga0207700_10001792 3300025928 Bacteria 12189
272 Ga0207700_10008702 3300025928 Bacteria 6306
273 Ga0207664_10010960 3300025929 Bacteria 6420
274 Ga0207690_10207309 3300025932 Bacteria 1492
275 Ga0207706_10021454 3300025933 Bacteria 5801
276 Ga0207709_10027965 3300025935 Bacteria 3255
277 Ga0207670_10133300 3300025936 Unclassified 1823
278 Ga0207670_10180884 3300025936 Bacteria 1588
279 Ga0207665_10002063 3300025939 Bacteria 13544
280 Ga0207691_10021870 3300025940 Bacteria 6036
281 Ga0207691_10026480 3300025940 Bacteria 5440
282 Ga0207689_10006115 3300025942 Bacteria 10648
283 Ga0207661_10014457 3300025944 Bacteria 5786
284 Ga0207661_10020203 3300025944 Unclassified 4973
285 Ga0207679_10001800 3300025945 Bacteria 13345
286 Ga0207679_10025864 3300025945 Bacteria 4041
287 Ga0207679_10058948 3300025945 Bacteria 2847
288 Ga0207679_10082875 3300025945 Bacteria 2456
289 Ga0207679_10136139 3300025945 Unclassified 1978
290 Ga0207712_10006847 3300025961 Bacteria 7193
291 Ga0207712_10006906 3300025961 Bacteria 7165
292 Ga0207712_10061535 3300025961 Bacteria 2665
293 Ga0207668_10015326 3300025972 Bacteria 4760
294 Ga0207668_10031928 3300025972 Unclassified 3474
295 Ga0207640_10263320 3300025981 Bacteria 1345
296 Ga0207658_10063807 3300025986 Bacteria 2762
297 Ga0207658_10191342 3300025986 Bacteria 1701
298 Ga0207677_10032380 3300026023 Bacteria 3360
299 Ga0207677_10122096 3300026023 Bacteria 1962
300 Ga0207708_10045498 3300026075 Bacteria 3345
301 Ga0207708_10206033 3300026075 Bacteria 1571
302 Ga0207702_10068039 3300026078 Bacteria 3059
303 Ga0207641_10035921 3300026088 Bacteria 4133
304 Ga0207641_10098199 3300026088 Bacteria 2575
305 Ga0207648_10014047 3300026089 Bacteria 7413
306 Ga0207648_10059630 3300026089 Bacteria 3328
307 Ga0207648_10072282 3300026089 Bacteria 3007
308 Ga0207648_10333720 3300026089 Bacteria 1364
309 Ga0207676_10160728 3300026095 Bacteria 1946
310 Ga0207676_10357431 3300026095 Bacteria 1353
311 Ga0207676_10397868 3300026095 Bacteria 1286
312 Ga0207674_10000293 3300026116 Bacteria 63260
313 Ga0207674_10007117 3300026116 Bacteria 13071
314 Ga0207674_10008617 3300026116 Bacteria 11757
315 Ga0207675_100000289 3300026118 Bacteria 48475
316 Ga0207675_100002770 3300026118 Bacteria 17213
317 Ga0207698_10062334 3300026142 Bacteria 2911
318 Ga0207698_10117010 3300026142 Unclassified 2247
319 Ga0209969_1003039 3300027360 Bacteria 2321
320 Ga0209996_1002469 3300027395 Bacteria 2290
321 Ga0209999_1001399 3300027543 Bacteria 4133
322 Ga0209588_1009306 3300027671 Bacteria 2934
323 Ga0209998_10001195 3300027717 Bacteria 6411
324 Ga0268266_10077757 3300028379 Unclassified 2886
325 Ga0268265_10004651 3300028380 Bacteria 9476
326 Ga0268264_10001074 3300028381 Bacteria 27186
327 Ga0268264_10135353 3300028381 Bacteria 2190
328 Ga0265338_10004823 3300028800 Bacteria 18022
329 Ga0265338_10005480 3300028800 Bacteria 16549
330 Ga0265328_10000661 3300031239 Bacteria 16011
331 Ga0265316_10007868 3300031344 Bacteria 9975
332 Ga0307408_100003254 3300031548 Bacteria 11167
333 Ga0307408_100011372 3300031548 Bacteria 5880
334 Ga0307408_100307291 3300031548 Bacteria 1331
335 Ga0307508_10007548 3300031616 Bacteria 10099
336 Ga0316578_10204800 3300031728 Bacteria 1187
337 Ga0307405_10117956 3300031731 Bacteria 1810
338 Ga0307405_10207551 3300031731 Bacteria 1427
339 Ga0307413_10127438 3300031824 Bacteria 1736
340 Ga0307410_10002558 3300031852 Bacteria 8815
341 Ga0307410_10013504 3300031852 Bacteria 4768
342 Ga0307410_10016658 3300031852 Bacteria 4391
343 Ga0307410_10062575 3300031852 Unclassified 2550
344 Ga0307410_10155839 3300031852 Bacteria 1706
345 Ga0307410_10172039 3300031852 Bacteria 1633
346 Ga0307406_10013709 3300031901 Bacteria 4650
347 Ga0307407_10006402 3300031903 Bacteria 5228
348 Ga0307412_10013728 3300031911 Bacteria 4759
349 Ga0307412_10017950 3300031911 Bacteria 4245
350 Ga0307412_10060846 3300031911 Bacteria 2536
351 Ga0307412_10151176 3300031911 Bacteria 1713
352 Ga0307409_100002549 3300031995 Bacteria 9559
353 Ga0307409_100121269 3300031995 Bacteria 2214
354 Ga0307409_100179255 3300031995 Bacteria 1874
355 Ga0307409_100195616 3300031995 Unclassified 1804
356 Ga0307416_100008227 3300032002 Bacteria 6710
357 Ga0307416_100017657 3300032002 Bacteria 5001
358 Ga0307416_100035864 3300032002 Bacteria 3794
359 Ga0307416_100079589 3300032002 Bacteria 2762
360 Ga0307416_100123873 3300032002 Bacteria 2311
361 Ga0307416_100146657 3300032002 Bacteria 2156
362 Ga0307416_100195075 3300032002 Bacteria 1915
363 Ga0307414_10016628 3300032004 Bacteria 4478
364 Ga0307411_10006729 3300032005 Bacteria 5779
365 Ga0307411_10008228 3300032005 Bacteria 5385
366 Ga0307411_10083648 3300032005 Bacteria 2205
367 Ga0307411_10119633 3300032005 Bacteria 1903
368 Ga0307415_100043543 3300032126 Bacteria 2996
369 Ga0316583_10005700 3300032133 Unclassified 4479
370 Ga0373926_0003439 3300035083 Bacteria 5102
371 Ga0373929_0000015 3300035085 Bacteria 146315
372 Ga0373934_0000955 3300035086 Bacteria 10479
373 Ga0373941_0030388 3300035115 Bacteria 1601
374 Ga0373945_0003179 3300035116 Bacteria 5153
375 Ga0373954_0035757 3300035118 Bacteria 2304
376 Ga0373956_0001605 3300035119 Bacteria 9321
377 Ga0373943_0002139 3300035170 Bacteria 8984
378 Ga0373943_0113329 3300035170 Bacteria 1433
379 Ga0373946_0025624 3300035171 Bacteria 2320
380 Ga0373955_0001946 3300035172 Bacteria 8902
381 Ga0373961_0004755 3300035241 Bacteria 3266
382 Ga0316574_0008829 3300035398 Bacteria 5618
383 Ga0373924_0001674 3300035410 Bacteria 7295
384 Ga0373931_0043971 3300035691 Bacteria 2355
385 Ga0373935_0001035 3300035692 Bacteria 15135
386 Ga0373935_0001311 3300035692 Bacteria 13752
387 Ga0373935_0003572 3300035692 Bacteria 9064
388 Ga0373927_0012732 3300035695 Bacteria 5594
389 Ga0373933_0000077 3300035724 Bacteria 61323
390 Ga0373947_0000005 3300035725 Bacteria 225129
391 Ga0373947_0000248 3300035725 Bacteria 30473
392 Ga0373937_0000631 3300036401 Bacteria 30842
393 Ga0373937_0127789 3300036401 Bacteria 2372
394 Ga0373925_0001325 3300037068 Bacteria 21661
395 Ga0395905_0214684 3300037471 Bacteria 1802
396 Ga0400485_06752 3300038735 Bacteria 2178
397 Ga0436362_0192171 3300039453 Bacteria 1949
398 Ga0451837_0275603 3300041494 Bacteria 2228
399 Ga0451577_0243714 3300042876 Bacteria 1626
400 Ga0451577_0438107 3300042876 Bacteria 1187
401 Ga0453683_0013102 3300044673 Bacteria 5423
402 Ga0453683_0055177 3300044673 Bacteria 2487
403 Ga0466958_0010688 3300045836 Bacteria 5149
404 Ga0466967_0187002 3300045976 Unclassified 1956
405 Ga0466967_0267225 3300045976 Unclassified 1638
406 Ga0495592_0003964 3300046454 Bacteria 10728
407 Ga0495603_0017950 3300046455 Bacteria 4282
408 Ga0495603_0078749 3300046455 Bacteria 1932
409 Ga0495629_0044552 3300046459 Bacteria 3113
410 Ga0495641_0055257 3300046461 Bacteria 1803
411 Ga0495651_0003616 3300046462 Bacteria 11848
412 Ga0495653_0000979 3300046463 Bacteria 21970
413 Ga0495580_0001174 3300046472 Bacteria 23047
414 Ga0495582_0000561 3300046473 Bacteria 20574
415 Ga0495582_0022588 3300046473 Bacteria 3443
416 Ga0495639_0000384 3300046475 Bacteria 21057
417 Ga0495594_0003732 3300046499 Bacteria 7816
418 Ga0495594_0067431 3300046499 Bacteria 1986
419 Ga0495608_0000171 3300046511 Bacteria 46179
420 Ga0495628_0007771 3300046516 Bacteria 9242
421 Ga0495630_0002204 3300046517 Bacteria 13560
422 Ga0495630_0039448 3300046517 Bacteria 3530
423 Ga0495666_0013410 3300046526 Bacteria 4087
424 Ga0495652_0027732 3300046529 Bacteria 4989
425 Ga0495665_0000214 3300046531 Bacteria 29362
426 Ga0495640_0021626 3300046533 Bacteria 4716
427 Ga0495586_0012262 3300046535 Bacteria 4550
428 Ga0495586_0041077 3300046535 Bacteria 2491
429 Ga0495587_0002687 3300046536 Bacteria 11874
430 Ga0495645_0000542 3300046543 Bacteria 25890
431 Ga0495667_0010545 3300046559 Bacteria 6252
432 Ga0495634_0008010 3300046642 Bacteria 7884
433 Ga0495635_0000238 3300046663 Bacteria 34935
434 Ga0495588_0000501 3300046674 Bacteria 19129
435 Ga0495657_0000272 3300046675 Bacteria 46662
436 Ga0495599_0001923 3300046678 Bacteria 12023
437 Ga0495623_0001621 3300046679 Bacteria 15119
438 Ga0495646_0001689 3300046680 Bacteria 13218
439 Ga0495647_0014566 3300046681 Bacteria 2741
440 Ga0495658_0000251 3300046683 Bacteria 30781
441 Ga0495658_0043075 3300046683 Bacteria 2522
442 Ga0495669_0003354 3300046684 Bacteria 6595
443 Ga0495613_0011972 3300046689 Bacteria 6446
444 Ga0495600_0000187 3300046809 Bacteria 35919
445 Ga0495581_0000380 3300047315 Bacteria 22253
446 Ga0495581_0075418 3300047315 Bacteria 1951
447 Ga0495604_0004999 3300047317 Bacteria 10500
448 Ga0495674_0004356 3300047319 Bacteria 13606
449 Ga0495674_0017834 3300047319 Bacteria 6609
450 Ga0495676_0068210 3300047321 Bacteria 2749
451 Ga0495680_0009937 3300047322 Bacteria 8521
452 Ga0495680_0020393 3300047322 Bacteria 5578
453 Ga0495675_0003846 3300047444 Bacteria 9091
454 Ga0495684_0023051 3300047471 Bacteria 4789
455 Ga0495593_0003069 3300047673 Bacteria 10053
456 Ga0495593_0070874 3300047673 Bacteria 1810
457 Ga0495602_0005260 3300048088 Bacteria 13573
458 Ga0495614_0000990 3300048089 Bacteria 12089
459 Ga0496101_0099717 3300048904 Bacteria 2172
460 Ga0496102_0124485 3300048905 Bacteria 2409
461 Ga0496104_0011801 3300048907 Bacteria 7842
462 Ga0496104_0241091 3300048907 Bacteria 1720
463 Ga0496107_0225346 3300048910 Bacteria 1395
464 Ga0496107_0256275 3300048910 Bacteria 1302
465 Ga0496108_0001761 3300048911 Bacteria 17219
466 Ga0496108_0014218 3300048911 Bacteria 6495
467 Ga0496109_0013539 3300048912 Bacteria 7080
468 Ga0496109_0017451 3300048912 Bacteria 6293
469 Ga0496109_0144954 3300048912 Bacteria 2221
470 Ga0496110_0027663 3300048913 Bacteria 4862
471 Ga0496110_0034731 3300048913 Unclassified 4370
472 Ga0496110_0141366 3300048913 Unclassified 2176
473 Ga0496111_0025787 3300048914 Bacteria 4148
474 Ga0496111_0028065 3300048914 Bacteria 3987
475 Ga0496112_0000138 3300048915 Bacteria 45272
476 Ga0496112_0016819 3300048915 Bacteria 6861
477 Ga0496112_0049371 3300048915 Bacteria 4125
478 Ga0496112_0273084 3300048915 Bacteria 1638
479 Ga0496113_0024363 3300048916 Bacteria 4301
480 Ga0496113_0094192 3300048916 Bacteria 2313
481 Ga0496113_0149545 3300048916 Bacteria 1841
482 Ga0496114_0000032 3300048917 Bacteria 167029
483 Ga0496114_0160806 3300048917 Unclassified 1953
484 Ga0496115_0013042 3300048918 Bacteria 6274
485 Ga0496121_0000026 3300048924 Bacteria 450157
486 Ga0501031_0012869 3300049568 Bacteria 5466
487 Ga0501031_0091345 3300049568 Bacteria 1986
488 Ga0501031_0128270 3300049568 Bacteria 1657
489 Ga0501033_0093957 3300049570 Bacteria 2193
490 Ga0501034_0001000 3300049571 Bacteria 40499
491 Ga0501034_0297927 3300049571 Bacteria 1550
492 Ga0501036_0023671 3300049572 Bacteria 5175
493 Ga0501036_0118085 3300049572 Bacteria 2240
494 Ga0501036_0174287 3300049572 Bacteria 1811
495 Ga0501036_0247746 3300049572 Bacteria 1493
496 Ga0501038_0009314 3300049574 Bacteria 9008
497 Ga0501038_0063412 3300049574 Bacteria 3154
498 Ga0501038_0100387 3300049574 Bacteria 2411
499 Ga0501039_0047346 3300049575 Bacteria 3323
500 Ga0501040_0000935 3300049576 Bacteria 18371
501 Ga0501040_0008554 3300049576 Bacteria 6642
502 Ga0501040_0009190 3300049576 Bacteria 6439
503 Ga0501041_0033421 3300049577 Bacteria 3112
504 Ga0501042_0009935 3300049578 Bacteria 6359
505 Ga0501042_0034501 3300049578 Bacteria 3588
506 Ga0501043_0006437 3300049579 Bacteria 9430
507 Ga0501046_0039985 3300049580 Bacteria 3751
508 Ga0501046_0069070 3300049580 Bacteria 2750
509 Ga0501046_0134872 3300049580 Bacteria 1870
510 Ga0501048_0026240 3300049582 Bacteria 4242
511 Ga0501048_0071020 3300049582 Bacteria 2458
512 Ga0501071_0025654 3300049587 Bacteria 4131
513 Ga0501071_0026836 3300049587 Bacteria 4046
514 Ga0501072_0008703 3300049588 Bacteria 7705
515 Ga0501072_0158695 3300049588 Bacteria 1804
516 Ga0501074_0003251 3300049590 Bacteria 11480
517 Ga0501074_0024793 3300049590 Bacteria 4357
518 Ga0501074_0048563 3300049590 Bacteria 3066
519 Ga0501075_0000304 3300049591 Bacteria 27496
520 Ga0501075_0036068 3300049591 Bacteria 3690
521 Ga0501075_0083067 3300049591 Bacteria 2426
522 Ga0501075_0104082 3300049591 Bacteria 2157
523 Ga0501076_0005829 3300049592 Bacteria 8886
524 Ga0501076_0011684 3300049592 Bacteria 6555
525 Ga0501076_0033975 3300049592 Bacteria 3983
526 Ga0501076_0162948 3300049592 Bacteria 1817
527 Ga0501077_0000381 3300049593 Bacteria 26512
528 Ga0501077_0008797 3300049593 Bacteria 6266
529 Ga0501077_0065751 3300049593 Bacteria 2300
530 Ga0501202_000853 3300049652 Bacteria 4627
531 Ga0501217_000770 3300049661 Bacteria 5578
532 Ga0501235_001593 3300049669 Bacteria 4863
533 Ga0501250_001980 3300049680 Bacteria 1792
534 Ga0501257_012831 3300049686 Bacteria 1920
535 Ga0501261_001255 3300049690 Bacteria 3116
536 Ga0501079_0010627 3300049741 Bacteria 7005
537 Ga0501079_0012513 3300049741 Bacteria 6477
538 Ga0501079_0023357 3300049741 Bacteria 4746
539 Ga0501080_0005114 3300049742 Bacteria 11686
540 Ga0501080_0029748 3300049742 Bacteria 5084
541 Ga0501081_0039330 3300049743 Bacteria 3235
542 Ga0501081_0063701 3300049743 Bacteria 2559
543 Ga0501081_0090351 3300049743 Bacteria 2153
544 Ga0501081_0094515 3300049743 Unclassified 2106
545 Ga0501083_0048278 3300049744 Bacteria 2874
546 Ga0501268_000145 3300049765 Bacteria 6357
547 Ga0501268_000721 3300049765 Unclassified 3767
548 Ga0501268_001791 3300049765 Bacteria 2737
549 Ga0501279_009138 3300049775 Bacteria 1327
550 Ga0501035_0045820 3300049822 Bacteria 3934
551 Ga0501044_0013418 3300049823 Bacteria 8860
552 Ga0501045_0001148 3300049824 Bacteria 17545
553 Ga0501045_0004349 3300049824 Bacteria 9765
554 Ga0501045_0052740 3300049824 Bacteria 2970
555 nmdc:mga05p37_170544_c1 3300050507 Bacteria 2654
556 nmdc:mga05p37_2267_c1 3300050507 Bacteria 22421
557 nmdc:mga05p37_248171_c1 3300050507 Bacteria 2136
558 nmdc:mga05p37_2579_c1 3300050507 Bacteria 21071
559 nmdc:mga05p37_38378_c1 3300050507 Bacteria 5874
560 nmdc:mga05p37_64850_c1 3300050507 Bacteria 4494
561 nmdc:mga09592_102127_c1 3300050508 Bacteria 2457
562 nmdc:mga09592_27386_c1 3300050508 Bacteria 4729
563 nmdc:mga09592_82478_c1 3300050508 Unclassified 2740
564 nmdc:mga09592_9821_c2 3300050508 Bacteria 7443
565 nmdc:mga0qj67_20040_c1 3300050509 Bacteria 5117
566 nmdc:mga06r32_12931_c1 3300050510 Bacteria 7546
567 nmdc:mga06r32_13755_c1 3300050510 Bacteria 7341
568 nmdc:mga06r32_29452_c1 3300050510 Bacteria 5146
569 nmdc:mga06r32_347399_c1 3300050510 Bacteria 1468
570 nmdc:mga06r32_75598_c1 3300050510 Bacteria 3269
571 nmdc:mga08y16_104300_c1 3300050511 Bacteria 2951
572 nmdc:mga08y16_174568_c1 3300050511 Bacteria 2231
573 nmdc:mga08y16_444014_c1 3300050511 Bacteria 1324
574 nmdc:mga0n895_102302_c1 3300050512 Bacteria 2875
575 nmdc:mga0n895_122674_c1 3300050512 Unclassified 2620
576 nmdc:mga0n895_13314_c1 3300050512 Bacteria 7417
577 nmdc:mga0n895_133563_c1 3300050512 Bacteria 2508
578 nmdc:mga0n895_1492_c1 3300050512 Bacteria 17556
579 nmdc:mga0n895_24919_c1 3300050512 Bacteria 5645
580 nmdc:mga0n895_25338_c1 3300050512 Bacteria 5603
581 nmdc:mga0n895_318294_c1 3300050512 Bacteria 1577
582 nmdc:mga0n895_38271_c1 3300050512 Bacteria 4646
583 nmdc:mga0n895_51752_c1 3300050512 Bacteria 4029
584 nmdc:mga0n895_52111_c1 3300050512 Bacteria 4016
585 nmdc:mga0rr50_111145_c1 3300050513 Unclassified 2168
586 nmdc:mga0rr50_113966_c1 3300050513 Bacteria 2143
587 nmdc:mga0rr50_205140_c1 3300050513 Bacteria 1622
588 nmdc:mga08x19_115817_c1 3300050514 Bacteria 1792
589 nmdc:mga08x19_119601_c1 3300050514 Unclassified 1765
590 nmdc:mga08x19_16825_c1 3300050514 Bacteria 4466
591 nmdc:mga08x19_47317_c1 3300050514 Bacteria 2753
592 nmdc:mga08x19_805_c1 3300050514 Bacteria 20022
593 nmdc:mga0a205_1379_c1 3300050515 Bacteria 20530
594 nmdc:mga0a205_194568_c1 3300050515 Bacteria 1919
595 nmdc:mga0a205_235_c2 3300050515 Bacteria 31768
596 nmdc:mga0a205_54239_c1 3300050515 Bacteria 3870
597 nmdc:mga0a205_7192_c1 3300050515 Bacteria 5816
598 nmdc:mga0a205_75657_c1 3300050515 Bacteria 3253
599 Ga0495612_0002278 3300053078 Bacteria 7897
600 Ga0495655_0013407 3300053083 Bacteria 1695
601 Ga0495619_0002024 3300053085 Bacteria 13471
602 Ga0500616_0007586 3300053153 Bacteria 6862
603 Ga0501084_0010556 3300054114 Bacteria 7640
604 Ga0501084_0023004 3300054114 Bacteria 5202
605 Ga0501082_0001047 3300060353 Bacteria 24481
606 Ga0501082_0007625 3300060353 Bacteria 9333
607 Ga0501082_0028612 3300060353 Bacteria 4800
608 Ga0501082_0036933 3300060353 Bacteria 4209
609 Ga0501082_0211292 3300060353 Bacteria 1688
610 Ga0466962_0121042 3300061719 Bacteria 1263
611 Ga0530510_0027457 3300061734 Bacteria 4078
612 Ga0530510_0133591 3300061734 Bacteria 1826
613 2819575779 2818991442 Bacteria 8318214
614 2821138331 2821136567 Bacteria 8080116
615 2904469129 2904467357 Bacteria 8057758
616 Ga0070669_100061405
617 MBSR1b_contig_8136192
618 rootL2_10134362
619 rootH1_10071314
620 Ga0065715_10091439
621 Ga0070683_100020868
622 Ga0070683_100030918
623 Ga0070683_100031536
624 Ga0070683_100042722
625 Ga0070670_100005703
626 Ga0070670_100051372
627 Ga0070666_10002732
628 Ga0070680_100052988
629 Ga0070660_100045498
630 Ga0070660_100153439
631 Ga0070660_100153916
632 Ga0070660_100278173
633 Ga0070689_100032716
634 Ga0070689_100184627
635 Ga0070661_100018417
636 Ga0070661_100023899
637 Ga0070661_100070716
638 Ga0070692_10033435
639 Ga0070668_100003340
640 Ga0070668_100027220
641 Ga0070669_100000040
642 Ga0070669_100011625
643 Ga0070669_100027070
644 Ga0070669_100121510
645 Ga0070675_100009221
646 Ga0070675_100052412
647 Ga0070671_100033499
648 Ga0070671_100066740
649 Ga0070674_100043057
650 Ga0070673_100110609
651 Ga0070688_100099417
652 Ga0070659_100025724
653 Ga0070659_100042998
654 Ga0070659_100185918
655 Ga0070667_100022099
656 Ga0070667_100058297
657 Ga0070703_10009734
658 Ga0070709_10000058
659 Ga0070709_10001443
660 Ga0070709_10006185
661 Ga0070709_10103736
662 Ga0070714_100053139
663 Ga0070714_100222263
664 Ga0070713_100000077
665 Ga0070713_100017710
666 Ga0070701_10004874
667 Ga0070711_100000135
668 Ga0070705_100010965
669 Ga0070705_100213721
670 Ga0070700_100041700
671 Ga0070694_100005514
672 Ga0070694_100076434
673 Ga0070694_100081280
674 Ga0070708_100000854
675 Ga0070708_100020641
676 Ga0070708_100026273
677 Ga0070708_100071143
678 Ga0070708_100209304
679 Ga0070662_100020021
680 Ga0070681_10003174
681 Ga0070681_10033825
682 Ga0070681_10110821
683 Ga0070681_10161385
684 Ga0070681_10163489
685 Ga0068867_100115503
686 Ga0068867_100145142
687 Ga0070685_10134571
688 Ga0070706_100002646
689 Ga0070706_100011008
690 Ga0070706_100015385
691 Ga0070706_100032810
692 Ga0070707_100000940
693 Ga0070707_100005017
694 Ga0070707_100040393
695 Ga0070707_100079661
696 Ga0070698_100001663
697 Ga0070698_100002473
698 Ga0070698_100004836
699 Ga0070698_100008172
700 Ga0070698_100013739
701 Ga0070698_100076686
702 Ga0070698_100108942
703 Ga0070698_100123653
704 Ga0070698_100176094
705 Ga0070698_100369782
706 Ga0070699_100001889
707 Ga0070699_100008414
708 Ga0070699_100027430
709 Ga0070699_100054538
710 Ga0070699_100063021
711 Ga0070699_100119533
712 Ga0070679_100003567
713 Ga0070679_100017214
714 Ga0070679_100066870
715 Ga0070679_100147557
716 Ga0070684_100098662
717 Ga0070684_100190905
718 Ga0070684_100215288
719 Ga0070684_100234743
720 Ga0070697_100000381
721 Ga0070697_100003424
722 Ga0070697_100011737
723 Ga0070697_100118533
724 Ga0070697_100127875
725 Ga0070697_100160625
726 Ga0070697_100293861
727 Ga0070672_100085422
728 Ga0070695_100025086
729 Ga0070695_100086577
730 Ga0070696_100065549
731 Ga0070696_100109157
732 Ga0070693_100011727
733 Ga0070665_100073629
734 Ga0070665_100179219
735 Ga0070704_100046495
736 Ga0070664_100024556
737 Ga0070664_100028605
738 Ga0070664_100039639
739 Ga0070664_100073471
740 Ga0070664_100141633
741 Ga0068857_100004462
742 Ga0068857_100018881
743 Ga0068857_100045447
744 Ga0068854_100284011
745 Ga0068852_100043192
746 Ga0068852_100063758
747 Ga0068859_100031563
748 Ga0068859_100123243
749 Ga0068859_100175320
750 Ga0068859_100204583
751 Ga0068864_100035751
752 Ga0068864_100046891
753 Ga0068864_100052294
754 Ga0068861_100009018
755 Ga0068861_100095165
756 Ga0068858_100392407
757 Ga0068860_100021485
758 Ga0068860_100249180
759 Ga0068862_100003550
760 Ga0068862_100012182
761 Ga0068862_100053312
762 Ga0081539_10000035
763 Ga0070717_10001001
764 Ga0070715_10012078
765 Ga0070716_100016565
766 Ga0070712_100017466
767 Ga0097621_100259234
768 Ga0075428_100016478
769 Ga0075428_100021709
770 Ga0075428_100029113
771 Ga0075430_100018727
772 Ga0075430_100036910
773 Ga0075430_100188400
774 Ga0075431_100013938
775 Ga0075431_100035928
776 Ga0075431_100044594
777 Ga0075431_100073394
778 Ga0075431_100271165
779 Ga0075431_100330245
780 Ga0075433_10000469
781 Ga0075433_10002031
782 Ga0075433_10083086
783 Ga0075433_10101589
784 Ga0075434_100003180
785 Ga0075434_100004833
786 Ga0075434_100034867
787 Ga0075434_100044784
788 Ga0075434_100060918
789 Ga0075434_100126240
790 Ga0075434_100140429
791 Ga0075434_100141104
792 Ga0075434_100386872
793 Ga0075429_100012150
794 Ga0075429_100036100
795 Ga0075436_100002449
796 Ga0075436_100007424
797 Ga0075436_100024231
798 Ga0075436_100058622
799 Ga0075436_100131251
800 Ga0097620_100031563
801 Ga0097620_100123237
802 Ga0097620_100175319
803 Ga0097620_100204577
804 Ga0075435_100006873
805 Ga0075435_100012171
806 Ga0075435_100038660
807 Ga0075435_100103965
808 Ga0075435_100146549
809 Ga0075435_100151820
810 Ga0099794_10016403
811 Ga0099794_10080417
812 Ga0111539_10031987
813 Ga0111539_10164053
814 Ga0111539_10179172
815 Ga0114129_10005644
816 Ga0114129_10009543
817 Ga0114129_10016596
818 Ga0114129_10030689
819 Ga0114129_10261116
820 Ga0114129_10326974
821 Ga0105243_10024591
822 Ga0105243_10069079
823 Ga0105248_10071129
824 Ga0105248_10082557
825 Ga0105238_10123450
826 Ga0105238_10140657
827 Ga0105249_10000009
828 Ga0105249_10000578
829 Ga0105249_10051766
830 Ga0105249_10120417
831 Ga0157373_10015745
832 Ga0157373_10173709
833 Ga0157371_10015594
834 Ga0157374_10152651
835 Ga0157378_10215192
836 Ga0163162_10010222
837 Ga0163162_10033818
838 Ga0163162_10103661
839 Ga0157375_10100920
840 Ga0163163_10004072
841 Ga0163163_10176089
842 Ga0157380_10048126
843 Ga0157380_10253397
844 Ga0157379_10109010
845 Ga0157376_10325622
846 Ga0182005_1000053
847 Ga0163161_10071291
848 Ga0209436_105631
849 Ga0207697_10027363
850 Ga0207656_10015166
851 Ga0207653_10003890
852 Ga0207653_10006397
853 Ga0207692_10005942
854 Ga0207642_10025739
855 Ga0207647_10052611
856 Ga0207699_10000065
857 Ga0207699_10002219
858 Ga0207699_10086348
859 Ga0207699_10109657
860 Ga0207645_10000158
861 Ga0207684_10000491
862 Ga0207684_10001418
863 Ga0207684_10016809
864 Ga0207684_10028492
865 Ga0207684_10056825
866 Ga0207684_10094663
867 Ga0207684_10171008
868 Ga0207684_10333689
869 Ga0207707_10013837
870 Ga0207707_10093382
871 Ga0207707_10113116
872 Ga0207695_10153321
873 Ga0207693_10019579
874 Ga0207663_10000582
875 Ga0207662_10011433
876 Ga0207657_10146888
877 Ga0207652_10028752
878 Ga0207646_10004305
879 Ga0207646_10044162
880 Ga0207646_10095709
881 Ga0207681_10000016
882 Ga0207681_10006143
883 Ga0207681_10046659
884 Ga0207650_10176107
885 Ga0207659_10006232
886 Ga0207700_10001792
887 Ga0207700_10008702
888 Ga0207664_10010960
889 Ga0207690_10207309
890 Ga0207706_10021454
891 Ga0207709_10027965
892 Ga0207670_10133300
893 Ga0207670_10180884
894 Ga0207665_10002063
895 Ga0207691_10021870
896 Ga0207691_10026480
897 Ga0207689_10006115
898 Ga0207661_10014457
899 Ga0207661_10020203
900 Ga0207679_10001800
901 Ga0207679_10025864
902 Ga0207679_10058948
903 Ga0207679_10082875
904 Ga0207679_10136139
905 Ga0207712_10006847
906 Ga0207712_10006906
907 Ga0207712_10061535
908 Ga0207668_10015326
909 Ga0207668_10031928
910 Ga0207640_10263320
911 Ga0207658_10063807
912 Ga0207658_10191342
913 Ga0207677_10032380
914 Ga0207677_10122096
915 Ga0207708_10045498
916 Ga0207708_10206033
917 Ga0207702_10068039
918 Ga0207641_10035921
919 Ga0207641_10098199
920 Ga0207648_10014047
921 Ga0207648_10059630
922 Ga0207648_10072282
923 Ga0207648_10333720
924 Ga0207676_10160728
925 Ga0207676_10357431
926 Ga0207676_10397868
927 Ga0207674_10000293
928 Ga0207674_10007117
929 Ga0207674_10008617
930 Ga0207675_100000289
931 Ga0207675_100002770
932 Ga0207698_10062334
933 Ga0207698_10117010
934 Ga0209969_1003039
935 Ga0209996_1002469
936 Ga0209999_1001399
937 Ga0209588_1009306
938 Ga0209998_10001195
939 Ga0268266_10077757
940 Ga0268265_10004651
941 Ga0268264_10001074
942 Ga0268264_10135353
943 Ga0265338_10004823
944 Ga0265338_10005480
945 Ga0265328_10000661
946 Ga0265316_10007868
947 Ga0307408_100003254
948 Ga0307408_100011372
949 Ga0307408_100307291
950 Ga0307508_10007548
951 Ga0316578_10204800
952 Ga0307405_10117956
953 Ga0307405_10207551
954 Ga0307413_10127438
955 Ga0307410_10002558
956 Ga0307410_10013504
957 Ga0307410_10016658
958 Ga0307410_10062575
959 Ga0307410_10155839
960 Ga0307410_10172039
961 Ga0307406_10013709
962 Ga0307407_10006402
963 Ga0307412_10013728
964 Ga0307412_10017950
965 Ga0307412_10060846
966 Ga0307412_10151176
967 Ga0307409_100002549
968 Ga0307409_100121269
969 Ga0307409_100179255
970 Ga0307409_100195616
971 Ga0307416_100008227
972 Ga0307416_100017657
973 Ga0307416_100035864
974 Ga0307416_100079589
975 Ga0307416_100123873
976 Ga0307416_100146657
977 Ga0307416_100195075
978 Ga0307414_10016628
979 Ga0307411_10006729
980 Ga0307411_10008228
981 Ga0307411_10083648
982 Ga0307411_10119633
983 Ga0307415_100043543
984 Ga0316583_10005700
985 Ga0373926_0003439
986 Ga0373929_0000015
987 Ga0373934_0000955
988 Ga0373941_0030388
989 Ga0373945_0003179
990 Ga0373954_0035757
991 Ga0373956_0001605
992 Ga0373943_0002139
993 Ga0373943_0113329
994 Ga0373946_0025624
995 Ga0373955_0001946
996 Ga0373961_0004755
997 Ga0316574_0008829
998 Ga0373924_0001674
999 Ga0373931_0043971
1000 Ga0373935_0001035
1001 Ga0373935_0001311
1002 Ga0373935_0003572
1003 Ga0373927_0012732
1004 Ga0373933_0000077
1005 Ga0373947_0000005
1006 Ga0373947_0000248
1007 Ga0373937_0000631
1008 Ga0373937_0127789
1009 Ga0373925_0001325
1010 Ga0395905_0214684
1011 Ga0400485_06752
1012 Ga0436362_0192171
1013 Ga0451837_0275603
1014 Ga0451577_0243714
1015 Ga0451577_0438107
1016 Ga0453683_0013102
1017 Ga0453683_0055177
1018 Ga0466958_0010688
1019 Ga0466967_0187002
1020 Ga0466967_0267225
1021 Ga0495592_0003964
1022 Ga0495603_0017950
1023 Ga0495603_0078749
1024 Ga0495629_0044552
1025 Ga0495641_0055257
1026 Ga0495651_0003616
1027 Ga0495653_0000979
1028 Ga0495580_0001174
1029 Ga0495582_0000561
1030 Ga0495582_0022588
1031 Ga0495639_0000384
1032 Ga0495594_0003732
1033 Ga0495594_0067431
1034 Ga0495608_0000171
1035 Ga0495628_0007771
1036 Ga0495630_0002204
1037 Ga0495630_0039448
1038 Ga0495666_0013410
1039 Ga0495652_0027732
1040 Ga0495665_0000214
1041 Ga0495640_0021626
1042 Ga0495586_0012262
1043 Ga0495586_0041077
1044 Ga0495587_0002687
1045 Ga0495645_0000542
1046 Ga0495667_0010545
1047 Ga0495634_0008010
1048 Ga0495635_0000238
1049 Ga0495588_0000501
1050 Ga0495657_0000272
1051 Ga0495599_0001923
1052 Ga0495623_0001621
1053 Ga0495646_0001689
1054 Ga0495647_0014566
1055 Ga0495658_0000251
1056 Ga0495658_0043075
1057 Ga0495669_0003354
1058 Ga0495613_0011972
1059 Ga0495600_0000187
1060 Ga0495581_0000380
1061 Ga0495581_0075418
1062 Ga0495604_0004999
1063 Ga0495674_0004356
1064 Ga0495674_0017834
1065 Ga0495676_0068210
1066 Ga0495680_0009937
1067 Ga0495680_0020393
1068 Ga0495675_0003846
1069 Ga0495684_0023051
1070 Ga0495593_0003069
1071 Ga0495593_0070874
1072 Ga0495602_0005260
1073 Ga0495614_0000990
1074 Ga0496101_0099717
1075 Ga0496102_0124485
1076 Ga0496104_0011801
1077 Ga0496104_0241091
1078 Ga0496107_0225346
1079 Ga0496107_0256275
1080 Ga0496108_0001761
1081 Ga0496108_0014218
1082 Ga0496109_0013539
1083 Ga0496109_0017451
1084 Ga0496109_0144954
1085 Ga0496110_0027663
1086 Ga0496110_0034731
1087 Ga0496110_0141366
1088 Ga0496111_0025787
1089 Ga0496111_0028065
1090 Ga0496112_0000138
1091 Ga0496112_0016819
1092 Ga0496112_0049371
1093 Ga0496112_0273084
1094 Ga0496113_0024363
1095 Ga0496113_0094192
1096 Ga0496113_0149545
1097 Ga0496114_0000032
1098 Ga0496114_0160806
1099 Ga0496115_0013042
1100 Ga0496121_0000026
1101 Ga0501031_0012869
1102 Ga0501031_0091345
1103 Ga0501031_0128270
1104 Ga0501033_0093957
1105 Ga0501034_0001000
1106 Ga0501034_0297927
1107 Ga0501036_0023671
1108 Ga0501036_0118085
1109 Ga0501036_0174287
1110 Ga0501036_0247746
1111 Ga0501038_0009314
1112 Ga0501038_0063412
1113 Ga0501038_0100387
1114 Ga0501039_0047346
1115 Ga0501040_0000935
1116 Ga0501040_0008554
1117 Ga0501040_0009190
1118 Ga0501041_0033421
1119 Ga0501042_0009935
1120 Ga0501042_0034501
1121 Ga0501043_0006437
1122 Ga0501046_0039985
1123 Ga0501046_0069070
1124 Ga0501046_0134872
1125 Ga0501048_0026240
1126 Ga0501048_0071020
1127 Ga0501071_0025654
1128 Ga0501071_0026836
1129 Ga0501072_0008703
1130 Ga0501072_0158695
1131 Ga0501074_0003251
1132 Ga0501074_0024793
1133 Ga0501074_0048563
1134 Ga0501075_0000304
1135 Ga0501075_0036068
1136 Ga0501075_0083067
1137 Ga0501075_0104082
1138 Ga0501076_0005829
1139 Ga0501076_0011684
1140 Ga0501076_0033975
1141 Ga0501076_0162948
1142 Ga0501077_0000381
1143 Ga0501077_0008797
1144 Ga0501077_0065751
1145 Ga0501202_000853
1146 Ga0501217_000770
1147 Ga0501235_001593
1148 Ga0501250_001980
1149 Ga0501257_012831
1150 Ga0501261_001255
1151 Ga0501079_0010627
1152 Ga0501079_0012513
1153 Ga0501079_0023357
1154 Ga0501080_0005114
1155 Ga0501080_0029748
1156 Ga0501081_0039330
1157 Ga0501081_0063701
1158 Ga0501081_0090351
1159 Ga0501081_0094515
1160 Ga0501083_0048278
1161 Ga0501268_000145
1162 Ga0501268_000721
1163 Ga0501268_001791
1164 Ga0501279_009138
1165 Ga0501035_0045820
1166 Ga0501044_0013418
1167 Ga0501045_0001148
1168 Ga0501045_0004349
1169 Ga0501045_0052740
1170 nmdc:mga05p37_170544_c1
1171 nmdc:mga05p37_2267_c1
1172 nmdc:mga05p37_248171_c1
1173 nmdc:mga05p37_2579_c1
1174 nmdc:mga05p37_38378_c1
1175 nmdc:mga05p37_64850_c1
1176 nmdc:mga09592_102127_c1
1177 nmdc:mga09592_27386_c1
1178 nmdc:mga09592_82478_c1
1179 nmdc:mga09592_9821_c2
1180 nmdc:mga0qj67_20040_c1
1181 nmdc:mga06r32_12931_c1
1182 nmdc:mga06r32_13755_c1
1183 nmdc:mga06r32_29452_c1
1184 nmdc:mga06r32_347399_c1
1185 nmdc:mga06r32_75598_c1
1186 nmdc:mga08y16_104300_c1
1187 nmdc:mga08y16_174568_c1
1188 nmdc:mga08y16_444014_c1
1189 nmdc:mga0n895_102302_c1
1190 nmdc:mga0n895_122674_c1
1191 nmdc:mga0n895_13314_c1
1192 nmdc:mga0n895_133563_c1
1193 nmdc:mga0n895_1492_c1
1194 nmdc:mga0n895_24919_c1
1195 nmdc:mga0n895_25338_c1
1196 nmdc:mga0n895_318294_c1
1197 nmdc:mga0n895_38271_c1
1198 nmdc:mga0n895_51752_c1
1199 nmdc:mga0n895_52111_c1
1200 nmdc:mga0rr50_111145_c1
1201 nmdc:mga0rr50_113966_c1
1202 nmdc:mga0rr50_205140_c1
1203 nmdc:mga08x19_115817_c1
1204 nmdc:mga08x19_119601_c1
1205 nmdc:mga08x19_16825_c1
1206 nmdc:mga08x19_47317_c1
1207 nmdc:mga08x19_805_c1
1208 nmdc:mga0a205_1379_c1
1209 nmdc:mga0a205_194568_c1
1210 nmdc:mga0a205_235_c2
1211 nmdc:mga0a205_54239_c1
1212 nmdc:mga0a205_7192_c1
1213 nmdc:mga0a205_75657_c1
1214 Ga0495612_0002278
1215 Ga0495655_0013407
1216 Ga0495619_0002024
1217 Ga0500616_0007586
1218 Ga0501084_0010556
1219 Ga0501084_0023004
1220 Ga0501082_0001047
1221 Ga0501082_0007625
1222 Ga0501082_0028612
1223 Ga0501082_0036933
1224 Ga0501082_0211292
1225 Ga0466962_0121042
1226 Ga0530510_0027457
1227 Ga0530510_0133591
1228 2819575779
1229 2821138331
1230 2904469129

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00266

Aminotran_5

Aminotransferase class-V

56

422

0.91

PF01041

DegT_DnrJ_EryC1

DegT/DnrJ/EryC1/StrS aminotransferase family

100

236

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5b7s-assembly1.cif.gz_A apo structure of cysteine desulfurase from thermococcus onnurineus na1 0.8842 9 369
6c9e-assembly1.cif.gz_A crystal structure of cysteine desulfurase from legionella pneumophila philadelphia 1 0.8826 5 368
5b87-assembly1.cif.gz_A crystal structure of a cysteine desulfurase from thermococcus onnurineus na1 in complex with alanine at 2.3 angstrom resolution 0.8814 6 370
1t3i-assembly1.cif.gz_B structure of slr0077/sufs, the essential cysteine desulfurase from synechocystis pcc 6803 0.8814 4 370
1t3i-assembly1.cif.gz_A structure of slr0077/sufs, the essential cysteine desulfurase from synechocystis pcc 6803 0.8801 4 370
ID Description Score Start End Superfamily
1elqB02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8999 30 282 3.40.640.10
af_Q10089_37_288_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8988 33 279 3.40.640.10
af_Q10089_37_288_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8785 33 279 3.40.640.10
4lw4B02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8741 33 282 3.40.640.10
5usrG02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8695 32 283 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A352VQU0-F1-model_v4 Aminotransferase 0.9796 1 243 GO:0008483
AF-D1CTW3-F1-model_v4 Probable acetyltransferase 0.9756 52 228 GO:0016740
AF-A0A352VQU0-F1-model_v4 Aminotransferase 0.9756 1 243 GO:0008483
AF-A0A3M1B087-F1-model_v4 Aminotransferase class V-fold PLP-dependent enzyme 0.9666 1 197 GO:0008483
AF-X1GD53-F1-model_v4 Aminotransferase class V domain-containing protein 0.9653 1 275

Map