F469412

General Info

Members Datasets Scaffolds Average Seq Length
615 260 1230 158

Family's Representative Sequence

Representative Sequence 3300003579|Ga0007429J51699_1037686|Ga0007429J51699_10376862
Length 155
Sequence MVEDDCLPDDPRALTPEVFEFVVSNELKRAMRSQNFVTLLLVDPMPRSTEHQRSELVRELARVIGRVVRETDILSPGRDGRLSVVLLDADFDSSMQVVDRLMTWVEHYEFRTPASFAIGAATSPTHGVDLTSLRSAAAARPVQPRREPRGSSHAQ

Samples

Sample ID Description Type Environment
1 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
91 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
120 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
185 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
186 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
187 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
188 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
189 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
190 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
191 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
192 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
193 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
194 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
195 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
196 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
197 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
198 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
199 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
200 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
201 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
202 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
203 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
204 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
205 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
206 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
207 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
208 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
209 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
210 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
211 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
212 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
213 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
214 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
215 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
216 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
217 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
218 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
219 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
220 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
221 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
222 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
236 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
237 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
238 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
239 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
240 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
241 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
242 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
243 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
244 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
245 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
246 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
247 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
248 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
249 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
250 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
251 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
252 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
253 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.77
Metatranscriptomes 4.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.09
Rhizosphere 96.91
Stem 0
Stem Tuber 0
Unclassified 14.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0007429J51699_1037686 3300003579 Bacteria 3204
2 MBSR1b_contig_3988905 2162886012 Unclassified 904
3 JGI24749J21850_1037714 3300002076 Bacteria 703
4 Ga0032354_1014169 3300003693 Bacteria 3001
5 Ga0032354_1023852 3300003693 Bacteria 1729
6 Ga0058863_11338496 3300004799 Unclassified 787
7 Ga0065712_10081966 3300005290 Bacteria 2959
8 Ga0065712_10135893 3300005290 Unclassified 1498
9 Ga0065715_10053684 3300005293 Bacteria 858
10 Ga0065715_10163139 3300005293 Bacteria 1610
11 Ga0065715_10172726 3300005293 Unclassified 1534
12 Ga0065715_10603088 3300005293 Unclassified 706
13 Ga0065715_10611770 3300005293 Unclassified 701
14 Ga0065715_10691630 3300005293 Bacteria 657
15 Ga0065715_10830547 3300005293 Bacteria 599
16 Ga0065707_10085075 3300005295 Bacteria 6486
17 Ga0065707_10940366 3300005295 Unclassified 555
18 Ga0070676_10000763 3300005328 Bacteria 15827
19 Ga0070683_100003522 3300005329 Bacteria 12743
20 Ga0070683_100288775 3300005329 Bacteria 1560
21 Ga0070690_100013551 3300005330 Bacteria 4821
22 Ga0070690_100361790 3300005330 Bacteria 1056
23 Ga0070690_100590382 3300005330 Bacteria 842
24 Ga0070670_100030473 3300005331 Bacteria 4646
25 Ga0070670_100086604 3300005331 Bacteria 2692
26 Ga0070670_100146759 3300005331 Bacteria 2041
27 Ga0070670_100770208 3300005331 Unclassified 868
28 Ga0070677_10110631 3300005333 Bacteria 1226
29 Ga0070677_10186267 3300005333 Bacteria 992
30 Ga0068869_100432993 3300005334 Bacteria 1087
31 Ga0070666_10005812 3300005335 Bacteria 7580
32 Ga0070666_10083749 3300005335 Bacteria 2182
33 Ga0070666_10420662 3300005335 Bacteria 962
34 Ga0070680_100188550 3300005336 Bacteria 1737
35 Ga0070682_100629760 3300005337 Bacteria 851
36 Ga0070660_100008449 3300005339 Bacteria 7200
37 Ga0070660_100487292 3300005339 Bacteria 1025
38 Ga0070689_100011222 3300005340 Bacteria 6413
39 Ga0070689_100409051 3300005340 Unclassified 1148
40 Ga0070691_10004968 3300005341 Bacteria 6053
41 Ga0070691_10588280 3300005341 Unclassified 655
42 Ga0070687_100277216 3300005343 Bacteria 1054
43 Ga0070661_100045046 3300005344 Bacteria 3224
44 Ga0070661_100121092 3300005344 Bacteria 1960
45 Ga0070661_100388134 3300005344 Bacteria 1102
46 Ga0070692_10105692 3300005345 Bacteria 1550
47 Ga0070692_10301965 3300005345 Bacteria 978
48 Ga0070668_100024615 3300005347 Bacteria 4561
49 Ga0070669_100000228 3300005353 Bacteria 46855
50 Ga0070669_100003701 3300005353 Bacteria 11034
51 Ga0070669_100013463 3300005353 Bacteria 5814
52 Ga0070669_100055379 3300005353 Bacteria 2906
53 Ga0070669_100292773 3300005353 Unclassified 1307
54 Ga0070669_100529076 3300005353 Bacteria 981
55 Ga0070669_101856832 3300005353 Bacteria 526
56 Ga0070675_100007889 3300005354 Bacteria 8252
57 Ga0070675_100067925 3300005354 Bacteria 2950
58 Ga0070675_100331687 3300005354 Bacteria 1346
59 Ga0070675_100336715 3300005354 Bacteria 1336
60 Ga0070675_100904085 3300005354 Unclassified 809
61 Ga0070671_100017318 3300005355 Bacteria 5835
62 Ga0070671_100529931 3300005355 Bacteria 1015
63 Ga0070674_100005875 3300005356 Bacteria 7135
64 Ga0070674_100014705 3300005356 Bacteria 4869
65 Ga0070674_100044893 3300005356 Bacteria 3017
66 Ga0070673_100020854 3300005364 Bacteria 4736
67 Ga0070673_100078663 3300005364 Bacteria 2668
68 Ga0070673_100387004 3300005364 Bacteria 1248
69 Ga0070673_101069737 3300005364 Bacteria 753
70 Ga0070688_100005127 3300005365 Bacteria 6870
71 Ga0070688_100372385 3300005365 Bacteria 1051
72 Ga0070659_100356421 3300005366 Unclassified 1228
73 Ga0070659_100857414 3300005366 Unclassified 792
74 Ga0070667_100059084 3300005367 Bacteria 3243
75 Ga0070667_100086979 3300005367 Bacteria 2682
76 Ga0070667_100226391 3300005367 Unclassified 1666
77 Ga0070667_101446192 3300005367 Bacteria 645
78 Ga0070714_100039469 3300005435 Bacteria 3975
79 Ga0070713_100042527 3300005436 Bacteria 3709
80 Ga0070701_10064551 3300005438 Bacteria 1941
81 Ga0070701_10191437 3300005438 Unclassified 1204
82 Ga0070705_100006125 3300005440 Bacteria 5889
83 Ga0070705_100007546 3300005440 Bacteria 5356
84 Ga0070705_100235739 3300005440 Bacteria 1276
85 Ga0070700_100401847 3300005441 Unclassified 1030
86 Ga0070700_100606181 3300005441 Bacteria 859
87 Ga0070700_100612460 3300005441 Bacteria 855
88 Ga0070700_101192520 3300005441 Bacteria 635
89 Ga0070694_100000362 3300005444 Bacteria 24335
90 Ga0070694_100002253 3300005444 Bacteria 11404
91 Ga0070694_100210420 3300005444 Bacteria 1454
92 Ga0070694_100300679 3300005444 Unclassified 1229
93 Ga0070663_100090165 3300005455 Bacteria 2270
94 Ga0070678_100306828 3300005456 Bacteria 1351
95 Ga0070678_100991389 3300005456 Unclassified 772
96 Ga0070662_100324998 3300005457 Bacteria 1255
97 Ga0070662_100411769 3300005457 Bacteria 1117
98 Ga0070662_100452372 3300005457 Bacteria 1066
99 Ga0070681_10063451 3300005458 Bacteria 3667
100 Ga0068867_100025932 3300005459 Bacteria 4205
101 Ga0068867_101609579 3300005459 Unclassified 607
102 Ga0070685_10062660 3300005466 Bacteria 2181
103 Ga0070707_100444031 3300005468 Bacteria 1258
104 Ga0070707_100692754 3300005468 Unclassified 982
105 Ga0070707_101553567 3300005468 Unclassified 629
106 Ga0070698_100004420 3300005471 Bacteria 15447
107 Ga0070698_100052870 3300005471 Bacteria 4130
108 Ga0070698_100288945 3300005471 Bacteria 1571
109 Ga0070698_100647452 3300005471 Unclassified 998
110 Ga0070698_100917603 3300005471 Bacteria 822
111 Ga0070699_100061651 3300005518 Bacteria 3250
112 Ga0070699_100375564 3300005518 Unclassified 1283
113 Ga0070699_100655005 3300005518 Bacteria 959
114 Ga0070679_100415137 3300005530 Bacteria 1291
115 Ga0070679_100466090 3300005530 Bacteria 1208
116 Ga0070684_100040909 3300005535 Bacteria 3993
117 Ga0070684_100800228 3300005535 Bacteria 881
118 Ga0070697_100038429 3300005536 Bacteria 3867
119 Ga0070697_100319653 3300005536 Bacteria 1336
120 Ga0068853_100622650 3300005539 Bacteria 1026
121 Ga0068853_100768770 3300005539 Bacteria 921
122 Ga0070672_100052904 3300005543 Bacteria 3172
123 Ga0070672_100094732 3300005543 Bacteria 2414
124 Ga0070672_100325404 3300005543 Bacteria 1307
125 Ga0070686_100000779 3300005544 Bacteria 18447
126 Ga0070686_100157815 3300005544 Bacteria 1595
127 Ga0070695_100000129 3300005545 Bacteria 34259
128 Ga0070695_100002942 3300005545 Bacteria 9925
129 Ga0070695_100085252 3300005545 Bacteria 2097
130 Ga0070695_101080253 3300005545 Bacteria 656
131 Ga0070695_101153404 3300005545 Bacteria 636
132 Ga0070696_100000326 3300005546 Bacteria 28984
133 Ga0070696_100000859 3300005546 Bacteria 19621
134 Ga0070696_100004309 3300005546 Bacteria 9483
135 Ga0070696_100093718 3300005546 Bacteria 2142
136 Ga0070696_100160161 3300005546 Bacteria 1658
137 Ga0070696_100218708 3300005546 Bacteria 1428
138 Ga0070665_100076698 3300005548 Bacteria 3349
139 Ga0070665_100082374 3300005548 Bacteria 3223
140 Ga0070665_100609266 3300005548 Bacteria 1105
141 Ga0070704_100000419 3300005549 Bacteria 19726
142 Ga0070704_100004925 3300005549 Bacteria 7752
143 Ga0070704_100050763 3300005549 Bacteria 2917
144 Ga0070704_100109400 3300005549 Bacteria 2100
145 Ga0070704_100752923 3300005549 Bacteria 867
146 Ga0070704_101866462 3300005549 Bacteria 557
147 Ga0068855_100014774 3300005563 Bacteria 9404
148 Ga0068855_100400680 3300005563 Bacteria 1504
149 Ga0070664_100002748 3300005564 Bacteria 14202
150 Ga0070664_100126123 3300005564 Bacteria 2246
151 Ga0070664_100822452 3300005564 Unclassified 869
152 Ga0070664_100925525 3300005564 Bacteria 818
153 Ga0068857_100118730 3300005577 Bacteria 2380
154 Ga0068854_100003229 3300005578 Bacteria 10163
155 Ga0068854_100025634 3300005578 Bacteria 4047
156 Ga0068854_100274011 3300005578 Bacteria 1356
157 Ga0068854_100751220 3300005578 Bacteria 846
158 Ga0068854_101163494 3300005578 Bacteria 690
159 Ga0070702_100001602 3300005615 Bacteria 9350
160 Ga0070702_100262423 3300005615 Bacteria 1177
161 Ga0068852_100100811 3300005616 Unclassified 2606
162 Ga0068859_100001505 3300005617 Bacteria 23755
163 Ga0068859_100134332 3300005617 Bacteria 2546
164 Ga0068859_100463966 3300005617 Bacteria 1362
165 Ga0068859_100678229 3300005617 Unclassified 1122
166 Ga0068864_100025835 3300005618 Bacteria 4948
167 Ga0068864_100548700 3300005618 Unclassified 1117
168 Ga0068864_101046066 3300005618 Bacteria 811
169 Ga0068864_101286781 3300005618 Bacteria 731
170 Ga0068866_10138178 3300005718 Unclassified 1395
171 Ga0068861_100001737 3300005719 Bacteria 13978
172 Ga0068861_100040889 3300005719 Bacteria 3470
173 Ga0068861_100100376 3300005719 Bacteria 2300
174 Ga0068870_10229694 3300005840 Bacteria 1140
175 Ga0068870_10299728 3300005840 Bacteria 1014
176 Ga0068870_10860298 3300005840 Bacteria 638
177 Ga0068863_100723859 3300005841 Bacteria 990
178 Ga0068858_100001553 3300005842 Bacteria 23546
179 Ga0068858_100019178 3300005842 Bacteria 6398
180 Ga0068858_100042658 3300005842 Bacteria 4206
181 Ga0068858_100054581 3300005842 Bacteria 3694
182 Ga0068858_100098239 3300005842 Bacteria 2730
183 Ga0068858_100137555 3300005842 Bacteria 2292
184 Ga0068858_100208587 3300005842 Bacteria 1849
185 Ga0068858_101199587 3300005842 Bacteria 746
186 Ga0068860_100002653 3300005843 Bacteria 18615
187 Ga0068860_100128405 3300005843 Bacteria 2431
188 Ga0068860_100247329 3300005843 Bacteria 1736
189 Ga0068860_100806161 3300005843 Unclassified 952
190 Ga0068862_100009142 3300005844 Bacteria 8204
191 Ga0068862_100078903 3300005844 Bacteria 2853
192 Ga0068862_100396555 3300005844 Unclassified 1290
193 Ga0081539_10017495 3300005985 Bacteria 5028
194 Ga0075432_10034441 3300006058 Bacteria 1759
195 Ga0075432_10167407 3300006058 Bacteria 853
196 Ga0070715_10128767 3300006163 Bacteria 1216
197 Ga0070716_100071612 3300006173 Bacteria 2038
198 Ga0070712_100923421 3300006175 Bacteria 753
199 Ga0097621_101150332 3300006237 Bacteria 730
200 Ga0068871_100058966 3300006358 Bacteria 3127
201 Ga0068871_100305010 3300006358 Bacteria 1399
202 Ga0068871_100506431 3300006358 Bacteria 1089
203 Ga0068871_100513054 3300006358 Unclassified 1082
204 Ga0075428_100006301 3300006844 Bacteria 13189
205 Ga0075428_100695633 3300006844 Bacteria 1083
206 Ga0075430_101058967 3300006846 Bacteria 668
207 Ga0075431_100020573 3300006847 Bacteria 6743
208 Ga0075431_100037241 3300006847 Bacteria 5013
209 Ga0075431_100155014 3300006847 Bacteria 2357
210 Ga0075433_10010180 3300006852 Bacteria 7543
211 Ga0075433_10086115 3300006852 Bacteria 2774
212 Ga0075433_10191313 3300006852 Bacteria 1820
213 Ga0075433_10223949 3300006852 Bacteria 1670
214 Ga0075433_10665800 3300006852 Unclassified 912
215 Ga0075433_10906027 3300006852 Unclassified 769
216 Ga0075434_100001876 3300006871 Bacteria 18188
217 Ga0075434_100028906 3300006871 Bacteria 5451
218 Ga0075434_100062315 3300006871 Unclassified 3712
219 Ga0075434_100066519 3300006871 Bacteria 3590
220 Ga0075434_100116737 3300006871 Bacteria 2682
221 Ga0075434_100283095 3300006871 Bacteria 1677
222 Ga0075434_100326118 3300006871 Bacteria 1556
223 Ga0075434_100420557 3300006871 Bacteria 1357
224 Ga0075434_100833781 3300006871 Bacteria 938
225 Ga0075429_100079979 3300006880 Bacteria 2849
226 Ga0075429_100488356 3300006880 Unclassified 1079
227 Ga0068865_100255791 3300006881 Unclassified 1384
228 Ga0068865_100404425 3300006881 Bacteria 1119
229 Ga0068865_100417836 3300006881 Unclassified 1102
230 Ga0068865_100612161 3300006881 Bacteria 922
231 Ga0075436_100011952 3300006914 Bacteria 5953
232 Ga0075436_100038151 3300006914 Bacteria 3316
233 Ga0075436_100105635 3300006914 Bacteria 1964
234 Ga0097620_100001505 3300006931 Bacteria 23755
235 Ga0097620_100134336 3300006931 Bacteria 2546
236 Ga0097620_100463986 3300006931 Bacteria 1362
237 Ga0097620_100678247 3300006931 Unclassified 1122
238 Ga0075435_100001224 3300007076 Bacteria 16438
239 Ga0075435_100001247 3300007076 Bacteria 16274
240 Ga0075435_100014978 3300007076 Bacteria 5817
241 Ga0075435_100022227 3300007076 Bacteria 4891
242 Ga0075435_100042996 3300007076 Unclassified 3616
243 Ga0075435_100049687 3300007076 Bacteria 3373
244 Ga0075435_100254587 3300007076 Bacteria 1495
245 Ga0075435_100270464 3300007076 Bacteria 1449
246 Ga0099794_10076408 3300007265 Bacteria 1646
247 Ga0105251_10099062 3300009011 Bacteria 1333
248 Ga0105240_10011240 3300009093 Bacteria 12482
249 Ga0105240_10019697 3300009093 Bacteria 9011
250 Ga0105240_10120866 3300009093 Unclassified 3154
251 Ga0105240_10620858 3300009093 Bacteria 1188
252 Ga0111539_10000909 3300009094 Bacteria 38680
253 Ga0111539_10001152 3300009094 Bacteria 34963
254 Ga0111539_10074895 3300009094 Unclassified 3989
255 Ga0111539_11155819 3300009094 Bacteria 899
256 Ga0105245_10204289 3300009098 Bacteria 1899
257 Ga0105245_10885126 3300009098 Bacteria 934
258 Ga0105245_10954133 3300009098 Unclassified 901
259 Ga0105245_11195785 3300009098 Unclassified 808
260 Ga0105247_10005097 3300009101 Bacteria 8326
261 Ga0114129_10000387 3300009147 Bacteria 51335
262 Ga0114129_10005534 3300009147 Bacteria 17866
263 Ga0114129_10009842 3300009147 Bacteria 13636
264 Ga0114129_10018948 3300009147 Bacteria 9802
265 Ga0114129_10023734 3300009147 Bacteria 8694
266 Ga0114129_10037493 3300009147 Bacteria 6843
267 Ga0114129_10064605 3300009147 Bacteria 5108
268 Ga0114129_10154822 3300009147 Bacteria 3135
269 Ga0114129_10336746 3300009147 Bacteria 2002
270 Ga0114129_11940761 3300009147 Unclassified 713
271 Ga0105243_10009972 3300009148 Bacteria 7219
272 Ga0105241_10096964 3300009174 Bacteria 2337
273 Ga0105241_10915337 3300009174 Bacteria 815
274 Ga0105242_10206416 3300009176 Bacteria 1748
275 Ga0105242_10256071 3300009176 Unclassified 1579
276 Ga0105242_10432959 3300009176 Unclassified 1235
277 Ga0105242_12004092 3300009176 Bacteria 621
278 Ga0105248_10011006 3300009177 Bacteria 9980
279 Ga0105248_10100655 3300009177 Bacteria 3257
280 Ga0105248_10125882 3300009177 Bacteria 2891
281 Ga0105248_10182805 3300009177 Bacteria 2362
282 Ga0105248_10241400 3300009177 Unclassified 2034
283 Ga0105248_10596074 3300009177 Bacteria 1247
284 Ga0105248_11993465 3300009177 Bacteria 659
285 Ga0105238_10211954 3300009551 Bacteria 1913
286 Ga0105249_10001512 3300009553 Bacteria 20401
287 Ga0105249_10377111 3300009553 Bacteria 1443
288 Ga0105249_10462924 3300009553 Bacteria 1308
289 Ga0105249_10756091 3300009553 Unclassified 1034
290 Ga0105249_11041907 3300009553 Bacteria 887
291 Ga0105239_10395175 3300010375 Bacteria 1564
292 Ga0105246_10342491 3300011119 Unclassified 1222
293 Ga0157370_10508646 3300013104 Bacteria 1106
294 Ga0157369_10464901 3300013105 Bacteria 1310
295 Ga0157378_11443137 3300013297 Bacteria 732
296 Ga0163162_10274419 3300013306 Bacteria 1818
297 Ga0163162_11075197 3300013306 Bacteria 911
298 Ga0163162_11744441 3300013306 Bacteria 711
299 Ga0157375_10137382 3300013308 Bacteria 2569
300 Ga0163163_10008666 3300014325 Bacteria 9045
301 Ga0163163_10248162 3300014325 Bacteria 1830
302 Ga0157380_10261095 3300014326 Bacteria 1573
303 Ga0157380_10344297 3300014326 Bacteria 1392
304 Ga0157380_10772221 3300014326 Unclassified 975
305 Ga0157380_11618850 3300014326 Bacteria 703
306 Ga0182008_10220919 3300014497 Bacteria 969
307 Ga0157377_10031601 3300014745 Bacteria 2878
308 Ga0157377_10331378 3300014745 Bacteria 1015
309 Ga0157379_10002707 3300014968 Bacteria 14945
310 Ga0157379_10221331 3300014968 Bacteria 1715
311 Ga0157379_10241067 3300014968 Bacteria 1640
312 Ga0157379_10746496 3300014968 Bacteria 921
313 Ga0157379_10942624 3300014968 Bacteria 821
314 Ga0182007_10115210 3300015262 Bacteria 897
315 Ga0163161_10236080 3300017792 Bacteria 1420
316 Ga0197907_11120794 3300020069 Bacteria 1808
317 Ga0206349_1626400 3300020075 Bacteria 586
318 Ga0206349_1670001 3300020075 Bacteria 815
319 Ga0206355_1040547 3300020076 Bacteria 605
320 Ga0206350_10255035 3300020080 Bacteria 866
321 Ga0224712_10005340 3300022467 Bacteria 3568
322 Ga0224712_10215309 3300022467 Bacteria 877
323 Ga0207666_1017931 3300025271 Bacteria 1025
324 Ga0207697_10048659 3300025315 Bacteria 1749
325 Ga0207697_10308463 3300025315 Bacteria 702
326 Ga0207682_10056606 3300025893 Bacteria 1633
327 Ga0207682_10139645 3300025893 Bacteria 1087
328 Ga0207642_10017151 3300025899 Bacteria 2747
329 Ga0207642_10375427 3300025899 Unclassified 845
330 Ga0207688_10249117 3300025901 Bacteria 1076
331 Ga0207688_10605111 3300025901 Bacteria 691
332 Ga0207680_10008430 3300025903 Bacteria 5060
333 Ga0207680_10068686 3300025903 Bacteria 2187
334 Ga0207685_10176312 3300025905 Unclassified 987
335 Ga0207645_10000346 3300025907 Bacteria 38743
336 Ga0207654_10053563 3300025911 Bacteria 2329
337 Ga0207695_10085672 3300025913 Bacteria 3179
338 Ga0207695_10172844 3300025913 Unclassified 2085
339 Ga0207695_10386202 3300025913 Unclassified 1285
340 Ga0207693_10392011 3300025915 Bacteria 1086
341 Ga0207693_10752108 3300025915 Bacteria 753
342 Ga0207660_10253835 3300025917 Unclassified 1388
343 Ga0207660_10449203 3300025917 Bacteria 1042
344 Ga0207662_10036020 3300025918 Bacteria 2891
345 Ga0207657_10002506 3300025919 Bacteria 19866
346 Ga0207657_10421778 3300025919 Bacteria 1049
347 Ga0207649_10087016 3300025920 Bacteria 2037
348 Ga0207649_10177964 3300025920 Bacteria 1487
349 Ga0207652_10079747 3300025921 Bacteria 2860
350 Ga0207652_10220857 3300025921 Bacteria 1707
351 Ga0207646_10116832 3300025922 Bacteria 2396
352 Ga0207646_10132814 3300025922 Bacteria 2241
353 Ga0207681_10007730 3300025923 Bacteria 6584
354 Ga0207681_10020412 3300025923 Bacteria 4198
355 Ga0207681_10262748 3300025923 Bacteria 1352
356 Ga0207681_10360790 3300025923 Bacteria 1165
357 Ga0207681_10829049 3300025923 Bacteria 773
358 Ga0207694_10145572 3300025924 Bacteria 1907
359 Ga0207650_10068841 3300025925 Bacteria 2659
360 Ga0207650_10136381 3300025925 Unclassified 1925
361 Ga0207659_10000069 3300025926 Bacteria 65505
362 Ga0207659_10256141 3300025926 Bacteria 1422
363 Ga0207659_10758355 3300025926 Bacteria 833
364 Ga0207687_10087390 3300025927 Bacteria 2265
365 Ga0207687_10392095 3300025927 Bacteria 1140
366 Ga0207687_10775139 3300025927 Unclassified 817
367 Ga0207700_10014835 3300025928 Bacteria 5118
368 Ga0207664_10480522 3300025929 Bacteria 1111
369 Ga0207644_10034270 3300025931 Bacteria 3552
370 Ga0207644_10199234 3300025931 Unclassified 1579
371 Ga0207644_10423287 3300025931 Bacteria 1091
372 Ga0207690_10040779 3300025932 Bacteria 3037
373 Ga0207706_10129428 3300025933 Bacteria 2220
374 Ga0207706_10177180 3300025933 Bacteria 1873
375 Ga0207706_10364972 3300025933 Bacteria 1254
376 Ga0207706_10391068 3300025933 Bacteria 1206
377 Ga0207706_10566248 3300025933 Unclassified 977
378 Ga0207706_11560479 3300025933 Bacteria 536
379 Ga0207686_10254491 3300025934 Bacteria 1285
380 Ga0207686_10370816 3300025934 Bacteria 1083
381 Ga0207709_10017859 3300025935 Bacteria 3966
382 Ga0207709_10020531 3300025935 Bacteria 3729
383 Ga0207670_10005697 3300025936 Bacteria 6862
384 Ga0207669_10003099 3300025937 Bacteria 7157
385 Ga0207669_10032896 3300025937 Bacteria 2919
386 Ga0207669_10060866 3300025937 Bacteria 2317
387 Ga0207704_10033119 3300025938 Bacteria 2935
388 Ga0207704_10511385 3300025938 Bacteria 970
389 Ga0207665_10071891 3300025939 Bacteria 2362
390 Ga0207691_10016350 3300025940 Bacteria 7043
391 Ga0207691_10306309 3300025940 Bacteria 1364
392 Ga0207691_10381783 3300025940 Bacteria 1203
393 Ga0207691_10625166 3300025940 Bacteria 911
394 Ga0207691_11181863 3300025940 Bacteria 635
395 Ga0207711_10066558 3300025941 Bacteria 3116
396 Ga0207711_10073119 3300025941 Bacteria 2979
397 Ga0207711_10322575 3300025941 Bacteria 1427
398 Ga0207711_10353778 3300025941 Bacteria 1360
399 Ga0207711_10719984 3300025941 Bacteria 931
400 Ga0207689_10431554 3300025942 Bacteria 1100
401 Ga0207689_10489783 3300025942 Bacteria 1030
402 Ga0207661_10035833 3300025944 Bacteria 3869
403 Ga0207661_10294103 3300025944 Bacteria 1454
404 Ga0207679_10068183 3300025945 Bacteria 2672
405 Ga0207679_10705853 3300025945 Unclassified 915
406 Ga0207679_11010163 3300025945 Unclassified 762
407 Ga0207667_10088858 3300025949 Bacteria 3195
408 Ga0207667_10235405 3300025949 Bacteria 1875
409 Ga0207667_11088976 3300025949 Bacteria 783
410 Ga0207651_10017921 3300025960 Bacteria 4198
411 Ga0207651_10021684 3300025960 Bacteria 3910
412 Ga0207651_10090277 3300025960 Bacteria 2239
413 Ga0207651_10494488 3300025960 Bacteria 1056
414 Ga0207651_10646492 3300025960 Bacteria 928
415 Ga0207712_10042225 3300025961 Unclassified 3139
416 Ga0207712_10352224 3300025961 Bacteria 1224
417 Ga0207668_10374012 3300025972 Bacteria 1197
418 Ga0207668_10391070 3300025972 Bacteria 1173
419 Ga0207640_10006369 3300025981 Bacteria 6474
420 Ga0207640_10204428 3300025981 Bacteria 1499
421 Ga0207640_10832009 3300025981 Bacteria 802
422 Ga0207658_10106920 3300025986 Bacteria 2204
423 Ga0207658_10282658 3300025986 Unclassified 1423
424 Ga0207658_10869418 3300025986 Bacteria 820
425 Ga0207677_10434350 3300026023 Bacteria 1121
426 Ga0207677_10867639 3300026023 Unclassified 812
427 Ga0207703_10028565 3300026035 Bacteria 4397
428 Ga0207703_10035651 3300026035 Bacteria 3954
429 Ga0207703_10060204 3300026035 Bacteria 3104
430 Ga0207703_10660885 3300026035 Unclassified 992
431 Ga0207639_10474314 3300026041 Bacteria 1139
432 Ga0207639_11092410 3300026041 Unclassified 748
433 Ga0207678_10097956 3300026067 Bacteria 2505
434 Ga0207708_10002322 3300026075 Bacteria 13972
435 Ga0207708_10067872 3300026075 Bacteria 2729
436 Ga0207708_10072644 3300026075 Bacteria 2636
437 Ga0207641_10152587 3300026088 Bacteria 2093
438 Ga0207648_10001795 3300026089 Bacteria 23516
439 Ga0207648_10029032 3300026089 Bacteria 4904
440 Ga0207676_10054172 3300026095 Bacteria 3142
441 Ga0207676_10343979 3300026095 Bacteria 1377
442 Ga0207676_10903645 3300026095 Bacteria 866
443 Ga0207674_10372236 3300026116 Bacteria 1381
444 Ga0207674_10970745 3300026116 Bacteria 818
445 Ga0207675_100000663 3300026118 Bacteria 33858
446 Ga0207675_100003988 3300026118 Bacteria 14320
447 Ga0207675_100155262 3300026118 Bacteria 2181
448 Ga0207675_100530686 3300026118 Unclassified 1174
449 Ga0207675_101216727 3300026118 Bacteria 774
450 Ga0207683_10018725 3300026121 Bacteria 5906
451 Ga0207683_10240755 3300026121 Bacteria 1650
452 Ga0207683_10279362 3300026121 Bacteria 1526
453 Ga0207683_10325090 3300026121 Unclassified 1409
454 Ga0207683_11022360 3300026121 Unclassified 767
455 Ga0207698_10133043 3300026142 Bacteria 2129
456 Ga0207428_10009208 3300027907 Bacteria 8870
457 Ga0207428_10198208 3300027907 Bacteria 1511
458 Ga0207428_10276975 3300027907 Bacteria 1246
459 Ga0207428_10731298 3300027907 Unclassified 706
460 Ga0268266_10223911 3300028379 Bacteria 1730
461 Ga0268266_10439317 3300028379 Bacteria 1239
462 Ga0268266_10559685 3300028379 Bacteria 1096
463 Ga0268265_10005488 3300028380 Bacteria 8656
464 Ga0268265_10246252 3300028380 Bacteria 1580
465 Ga0268265_10249064 3300028380 Bacteria 1572
466 Ga0268265_10404259 3300028380 Unclassified 1263
467 Ga0268265_11443110 3300028380 Bacteria 691
468 Ga0268264_10002477 3300028381 Bacteria 16225
469 Ga0268264_10183849 3300028381 Bacteria 1900
470 Ga0268264_10253912 3300028381 Bacteria 1635
471 Ga0268264_10308268 3300028381 Bacteria 1493
472 Ga0307409_101730548 3300031995 Bacteria 654
473 Ga0307416_100902246 3300032002 Bacteria 984
474 Ga0307411_10206745 3300032005 Bacteria 1512
475 Ga0373930_0002645 3300034816 Bacteria 2786
476 Ga0373948_0003490 3300034817 Bacteria 2424
477 Ga0373950_0007935 3300034818 Bacteria 1659
478 Ga0373958_0000787 3300034819 Bacteria 4058
479 Ga0373938_0000623 3300034957 Bacteria 5712
480 Ga0373928_0008276 3300035084 Bacteria 2017
481 Ga0373929_0002530 3300035085 Bacteria 3357
482 Ga0373940_0000877 3300035088 Bacteria 5057
483 Ga0373949_0000860 3300035090 Bacteria 9578
484 Ga0373951_0001874 3300035091 Bacteria 5416
485 Ga0373952_0001623 3300035092 Bacteria 4090
486 Ga0373932_0000249 3300035112 Bacteria 16351
487 Ga0373939_0002254 3300035114 Bacteria 4563
488 Ga0373939_0032839 3300035114 Bacteria 1511
489 Ga0373941_0000920 3300035115 Bacteria 6065
490 Ga0373960_0000159 3300035121 Bacteria 11700
491 Ga0373942_0000730 3300035207 Bacteria 9057
492 Ga0373961_0003649 3300035241 Bacteria 3777
493 Ga0373962_0006956 3300035242 Bacteria 2757
494 Ga0373931_0008703 3300035691 Bacteria 4828
495 Ga0373933_0403091 3300035724 Bacteria 892
496 Ga0373925_0388115 3300037068 Unclassified 1138
497 Ga0439431_0085534 3300041997 Bacteria 854
498 Ga0439433_0144563 3300041999 Bacteria 610
499 Ga0439442_065972 3300042002 Bacteria 769
500 Ga0439435_0016733 3300042436 Bacteria 1844
501 Ga0466963_0073914 3300044694 Bacteria 2299
502 Ga0451576_0007824 3300045051 Bacteria 12666
503 Ga0451576_0033391 3300045051 Bacteria 5470
504 Ga0451576_0049234 3300045051 Bacteria 4422
505 Ga0451576_0263670 3300045051 Bacteria 1801
506 Ga0466967_0272517 3300045976 Bacteria 1622
507 Ga0466967_0530812 3300045976 Bacteria 1157
508 Ga0466967_0726830 3300045976 Bacteria 984
509 Ga0495629_0186846 3300046459 Bacteria 1435
510 Ga0495584_0075797 3300046491 Bacteria 1691
511 Ga0495640_0842171 3300046533 Bacteria 545
512 Ga0495621_0008394 3300046539 Bacteria 3096
513 Ga0495621_0229042 3300046539 Unclassified 754
514 Ga0495670_0183028 3300046691 Bacteria 1107
515 Ga0495636_0535271 3300047318 Unclassified 569
516 Ga0495677_0226837 3300047445 Bacteria 728
517 Ga0496100_0481920 3300048903 Bacteria 954
518 Ga0496102_0039632 3300048905 Unclassified 4258
519 Ga0496102_0400797 3300048905 Bacteria 1290
520 Ga0496103_0867940 3300048906 Unclassified 567
521 Ga0496104_0001113 3300048907 Bacteria 22978
522 Ga0496104_0076862 3300048907 Bacteria 3180
523 Ga0496105_0041561 3300048908 Bacteria 3790
524 Ga0496106_0054924 3300048909 Bacteria 3010
525 Ga0496106_1400440 3300048909 Unclassified 540
526 Ga0496108_0034624 3300048911 Bacteria 4196
527 Ga0496108_0045266 3300048911 Bacteria 3675
528 Ga0496109_0002013 3300048912 Bacteria 16857
529 Ga0496109_0232921 3300048912 Bacteria 1733
530 Ga0496109_1224624 3300048912 Bacteria 687
531 Ga0496110_0278356 3300048913 Bacteria 1523
532 Ga0496112_0033905 3300048915 Bacteria 4966
533 Ga0496112_0038459 3300048915 Bacteria 4671
534 Ga0496112_1095568 3300048915 Unclassified 715
535 Ga0496114_0790357 3300048917 Unclassified 827
536 Ga0501034_0041021 3300049571 Bacteria 4683
537 Ga0501034_0094072 3300049571 Bacteria 2994
538 Ga0501036_0649227 3300049572 Bacteria 874
539 Ga0501041_0127805 3300049577 Bacteria 1583
540 Ga0501047_0051971 3300049581 Bacteria 3961
541 Ga0501068_0319824 3300049584 Bacteria 995
542 Ga0501071_0657025 3300049587 Bacteria 807
543 Ga0501073_0312991 3300049589 Bacteria 1083
544 Ga0501074_0409404 3300049590 Bacteria 962
545 Ga0501075_0624658 3300049591 Bacteria 822
546 Ga0501249_073628 3300049679 Unclassified 799
547 Ga0501080_0121081 3300049742 Bacteria 2425
548 Ga0501080_0253718 3300049742 Bacteria 1604
549 Ga0501044_0002441 3300049823 Bacteria 21195
550 nmdc:mga05p37_13615_c1 3300050507 Bacteria 3078
551 nmdc:mga05p37_1418972_c1 3300050507 Unclassified 698
552 nmdc:mga05p37_1630_c1 3300050507 Bacteria 26007
553 nmdc:mga05p37_168702_c1 3300050507 Bacteria 2670
554 nmdc:mga05p37_18081_c2 3300050507 Bacteria 6887
555 nmdc:mga05p37_252185_c1 3300050507 Bacteria 2116
556 nmdc:mga05p37_539047_c1 3300050507 Bacteria 1331
557 nmdc:mga05p37_6587_c1 3300050507 Bacteria 13693
558 nmdc:mga05p37_7760_c1 3300050507 Bacteria 12667
559 nmdc:mga05p37_8293_c1 3300050507 Bacteria 12284
560 nmdc:mga09592_101518_c1 3300050508 Bacteria 2464
561 nmdc:mga09592_404439_c1 3300050508 Unclassified 1180
562 nmdc:mga06r32_102334_c1 3300050510 Bacteria 2812
563 nmdc:mga06r32_141518_c1 3300050510 Bacteria 2382
564 nmdc:mga06r32_28797_c1 3300050510 Bacteria 5199
565 nmdc:mga08y16_1316_c1 3300050511 Bacteria 24685
566 nmdc:mga08y16_261850_c1 3300050511 Bacteria 1786
567 nmdc:mga08y16_300033_c1 3300050511 Bacteria 1656
568 nmdc:mga08y16_752177_c1 3300050511 Bacteria 971
569 nmdc:mga0n895_123_c1 3300050512 Bacteria 46084
570 nmdc:mga0n895_301474_c1 3300050512 Bacteria 1624
571 nmdc:mga0n895_30646_c1 3300050512 Bacteria 5143
572 nmdc:mga0n895_3171_c1 3300050512 Bacteria 13144
573 nmdc:mga0n895_325313_c1 3300050512 Bacteria 1558
574 nmdc:mga0n895_47488_c1 3300050512 Bacteria 4198
575 nmdc:mga0n895_62785_c1 3300050512 Bacteria 3673
576 nmdc:mga0n895_80794_c1 3300050512 Bacteria 3239
577 nmdc:mga0n895_891522_c1 3300050512 Bacteria 875
578 nmdc:mga0n895_94808_c1 3300050512 Bacteria 2988
579 nmdc:mga0rr50_11476_c1 3300050513 Bacteria 5676
580 nmdc:mga0rr50_15476_c1 3300050513 Bacteria 5038
581 nmdc:mga0rr50_1968_c1 3300050513 Bacteria 11401
582 nmdc:mga0rr50_27_c1 3300050513 Bacteria 109881
583 nmdc:mga0rr50_3578_c1 3300050513 Bacteria 8978
584 nmdc:mga0rr50_36918_c1 3300050513 Bacteria 3523
585 nmdc:mga0rr50_384260_c1 3300050513 Bacteria 1184
586 nmdc:mga0rr50_846440_c1 3300050513 Bacteria 780
587 nmdc:mga08x19_239398_c1 3300050514 Bacteria 1251
588 nmdc:mga08x19_337_c1 3300050514 Bacteria 33875
589 nmdc:mga08x19_6677_c1 3300050514 Bacteria 6844
590 nmdc:mga08x19_88899_c1 3300050514 Bacteria 2037
591 nmdc:mga08x19_91721_c1 3300050514 Bacteria 2006
592 nmdc:mga0a205_17852_c1 3300050515 Bacteria 6659
593 nmdc:mga0a205_35678_c1 3300050515 Bacteria 4775
594 nmdc:mga0a205_36439_c1 3300050515 Bacteria 4726
595 nmdc:mga0a205_49110_c1 3300050515 Bacteria 4072
596 nmdc:mga0a205_574340_c1 3300050515 Bacteria 982
597 nmdc:mga0a205_6379_c1 3300050515 Bacteria 10167
598 nmdc:mga0a205_704739_c1 3300050515 Unclassified 859
599 Ga0495619_0286831 3300053085 Bacteria 1141
600 Ga0501084_0802282 3300054114 Bacteria 793
601 Ga0587073_0007534 3300059492 Bacteria 1725
602 Ga0587073_0023664 3300059492 Unclassified 1205
603 Ga0587073_0071760 3300059492 Bacteria 838
604 Ga0587077_143344 3300059493 Bacteria 617
605 Ga0587082_014065 3300059504 Unclassified 1216
606 Ga0587082_043290 3300059504 Bacteria 834
607 Ga0587082_077822 3300059504 Bacteria 686
608 Ga0587083_0038016 3300059505 Unclassified 993
609 Ga0587083_0057191 3300059505 Bacteria 869
610 Ga0587085_037004 3300059506 Bacteria 832
611 Ga0587090_015437 3300059510 Unclassified 1130
612 Ga0587091_022568 3300059511 Unclassified 1113
613 Ga0587091_042294 3300059511 Bacteria 903
614 Ga0587091_112191 3300059511 Bacteria 653
615 Ga0587072_027388 3300059643 Bacteria 1046
616 Ga0007429J51699_1037686
617 MBSR1b_contig_3988905
618 JGI24749J21850_1037714
619 Ga0032354_1014169
620 Ga0032354_1023852
621 Ga0058863_11338496
622 Ga0065712_10081966
623 Ga0065712_10135893
624 Ga0065715_10053684
625 Ga0065715_10163139
626 Ga0065715_10172726
627 Ga0065715_10603088
628 Ga0065715_10611770
629 Ga0065715_10691630
630 Ga0065715_10830547
631 Ga0065707_10085075
632 Ga0065707_10940366
633 Ga0070676_10000763
634 Ga0070683_100003522
635 Ga0070683_100288775
636 Ga0070690_100013551
637 Ga0070690_100361790
638 Ga0070690_100590382
639 Ga0070670_100030473
640 Ga0070670_100086604
641 Ga0070670_100146759
642 Ga0070670_100770208
643 Ga0070677_10110631
644 Ga0070677_10186267
645 Ga0068869_100432993
646 Ga0070666_10005812
647 Ga0070666_10083749
648 Ga0070666_10420662
649 Ga0070680_100188550
650 Ga0070682_100629760
651 Ga0070660_100008449
652 Ga0070660_100487292
653 Ga0070689_100011222
654 Ga0070689_100409051
655 Ga0070691_10004968
656 Ga0070691_10588280
657 Ga0070687_100277216
658 Ga0070661_100045046
659 Ga0070661_100121092
660 Ga0070661_100388134
661 Ga0070692_10105692
662 Ga0070692_10301965
663 Ga0070668_100024615
664 Ga0070669_100000228
665 Ga0070669_100003701
666 Ga0070669_100013463
667 Ga0070669_100055379
668 Ga0070669_100292773
669 Ga0070669_100529076
670 Ga0070669_101856832
671 Ga0070675_100007889
672 Ga0070675_100067925
673 Ga0070675_100331687
674 Ga0070675_100336715
675 Ga0070675_100904085
676 Ga0070671_100017318
677 Ga0070671_100529931
678 Ga0070674_100005875
679 Ga0070674_100014705
680 Ga0070674_100044893
681 Ga0070673_100020854
682 Ga0070673_100078663
683 Ga0070673_100387004
684 Ga0070673_101069737
685 Ga0070688_100005127
686 Ga0070688_100372385
687 Ga0070659_100356421
688 Ga0070659_100857414
689 Ga0070667_100059084
690 Ga0070667_100086979
691 Ga0070667_100226391
692 Ga0070667_101446192
693 Ga0070714_100039469
694 Ga0070713_100042527
695 Ga0070701_10064551
696 Ga0070701_10191437
697 Ga0070705_100006125
698 Ga0070705_100007546
699 Ga0070705_100235739
700 Ga0070700_100401847
701 Ga0070700_100606181
702 Ga0070700_100612460
703 Ga0070700_101192520
704 Ga0070694_100000362
705 Ga0070694_100002253
706 Ga0070694_100210420
707 Ga0070694_100300679
708 Ga0070663_100090165
709 Ga0070678_100306828
710 Ga0070678_100991389
711 Ga0070662_100324998
712 Ga0070662_100411769
713 Ga0070662_100452372
714 Ga0070681_10063451
715 Ga0068867_100025932
716 Ga0068867_101609579
717 Ga0070685_10062660
718 Ga0070707_100444031
719 Ga0070707_100692754
720 Ga0070707_101553567
721 Ga0070698_100004420
722 Ga0070698_100052870
723 Ga0070698_100288945
724 Ga0070698_100647452
725 Ga0070698_100917603
726 Ga0070699_100061651
727 Ga0070699_100375564
728 Ga0070699_100655005
729 Ga0070679_100415137
730 Ga0070679_100466090
731 Ga0070684_100040909
732 Ga0070684_100800228
733 Ga0070697_100038429
734 Ga0070697_100319653
735 Ga0068853_100622650
736 Ga0068853_100768770
737 Ga0070672_100052904
738 Ga0070672_100094732
739 Ga0070672_100325404
740 Ga0070686_100000779
741 Ga0070686_100157815
742 Ga0070695_100000129
743 Ga0070695_100002942
744 Ga0070695_100085252
745 Ga0070695_101080253
746 Ga0070695_101153404
747 Ga0070696_100000326
748 Ga0070696_100000859
749 Ga0070696_100004309
750 Ga0070696_100093718
751 Ga0070696_100160161
752 Ga0070696_100218708
753 Ga0070665_100076698
754 Ga0070665_100082374
755 Ga0070665_100609266
756 Ga0070704_100000419
757 Ga0070704_100004925
758 Ga0070704_100050763
759 Ga0070704_100109400
760 Ga0070704_100752923
761 Ga0070704_101866462
762 Ga0068855_100014774
763 Ga0068855_100400680
764 Ga0070664_100002748
765 Ga0070664_100126123
766 Ga0070664_100822452
767 Ga0070664_100925525
768 Ga0068857_100118730
769 Ga0068854_100003229
770 Ga0068854_100025634
771 Ga0068854_100274011
772 Ga0068854_100751220
773 Ga0068854_101163494
774 Ga0070702_100001602
775 Ga0070702_100262423
776 Ga0068852_100100811
777 Ga0068859_100001505
778 Ga0068859_100134332
779 Ga0068859_100463966
780 Ga0068859_100678229
781 Ga0068864_100025835
782 Ga0068864_100548700
783 Ga0068864_101046066
784 Ga0068864_101286781
785 Ga0068866_10138178
786 Ga0068861_100001737
787 Ga0068861_100040889
788 Ga0068861_100100376
789 Ga0068870_10229694
790 Ga0068870_10299728
791 Ga0068870_10860298
792 Ga0068863_100723859
793 Ga0068858_100001553
794 Ga0068858_100019178
795 Ga0068858_100042658
796 Ga0068858_100054581
797 Ga0068858_100098239
798 Ga0068858_100137555
799 Ga0068858_100208587
800 Ga0068858_101199587
801 Ga0068860_100002653
802 Ga0068860_100128405
803 Ga0068860_100247329
804 Ga0068860_100806161
805 Ga0068862_100009142
806 Ga0068862_100078903
807 Ga0068862_100396555
808 Ga0081539_10017495
809 Ga0075432_10034441
810 Ga0075432_10167407
811 Ga0070715_10128767
812 Ga0070716_100071612
813 Ga0070712_100923421
814 Ga0097621_101150332
815 Ga0068871_100058966
816 Ga0068871_100305010
817 Ga0068871_100506431
818 Ga0068871_100513054
819 Ga0075428_100006301
820 Ga0075428_100695633
821 Ga0075430_101058967
822 Ga0075431_100020573
823 Ga0075431_100037241
824 Ga0075431_100155014
825 Ga0075433_10010180
826 Ga0075433_10086115
827 Ga0075433_10191313
828 Ga0075433_10223949
829 Ga0075433_10665800
830 Ga0075433_10906027
831 Ga0075434_100001876
832 Ga0075434_100028906
833 Ga0075434_100062315
834 Ga0075434_100066519
835 Ga0075434_100116737
836 Ga0075434_100283095
837 Ga0075434_100326118
838 Ga0075434_100420557
839 Ga0075434_100833781
840 Ga0075429_100079979
841 Ga0075429_100488356
842 Ga0068865_100255791
843 Ga0068865_100404425
844 Ga0068865_100417836
845 Ga0068865_100612161
846 Ga0075436_100011952
847 Ga0075436_100038151
848 Ga0075436_100105635
849 Ga0097620_100001505
850 Ga0097620_100134336
851 Ga0097620_100463986
852 Ga0097620_100678247
853 Ga0075435_100001224
854 Ga0075435_100001247
855 Ga0075435_100014978
856 Ga0075435_100022227
857 Ga0075435_100042996
858 Ga0075435_100049687
859 Ga0075435_100254587
860 Ga0075435_100270464
861 Ga0099794_10076408
862 Ga0105251_10099062
863 Ga0105240_10011240
864 Ga0105240_10019697
865 Ga0105240_10120866
866 Ga0105240_10620858
867 Ga0111539_10000909
868 Ga0111539_10001152
869 Ga0111539_10074895
870 Ga0111539_11155819
871 Ga0105245_10204289
872 Ga0105245_10885126
873 Ga0105245_10954133
874 Ga0105245_11195785
875 Ga0105247_10005097
876 Ga0114129_10000387
877 Ga0114129_10005534
878 Ga0114129_10009842
879 Ga0114129_10018948
880 Ga0114129_10023734
881 Ga0114129_10037493
882 Ga0114129_10064605
883 Ga0114129_10154822
884 Ga0114129_10336746
885 Ga0114129_11940761
886 Ga0105243_10009972
887 Ga0105241_10096964
888 Ga0105241_10915337
889 Ga0105242_10206416
890 Ga0105242_10256071
891 Ga0105242_10432959
892 Ga0105242_12004092
893 Ga0105248_10011006
894 Ga0105248_10100655
895 Ga0105248_10125882
896 Ga0105248_10182805
897 Ga0105248_10241400
898 Ga0105248_10596074
899 Ga0105248_11993465
900 Ga0105238_10211954
901 Ga0105249_10001512
902 Ga0105249_10377111
903 Ga0105249_10462924
904 Ga0105249_10756091
905 Ga0105249_11041907
906 Ga0105239_10395175
907 Ga0105246_10342491
908 Ga0157370_10508646
909 Ga0157369_10464901
910 Ga0157378_11443137
911 Ga0163162_10274419
912 Ga0163162_11075197
913 Ga0163162_11744441
914 Ga0157375_10137382
915 Ga0163163_10008666
916 Ga0163163_10248162
917 Ga0157380_10261095
918 Ga0157380_10344297
919 Ga0157380_10772221
920 Ga0157380_11618850
921 Ga0182008_10220919
922 Ga0157377_10031601
923 Ga0157377_10331378
924 Ga0157379_10002707
925 Ga0157379_10221331
926 Ga0157379_10241067
927 Ga0157379_10746496
928 Ga0157379_10942624
929 Ga0182007_10115210
930 Ga0163161_10236080
931 Ga0197907_11120794
932 Ga0206349_1626400
933 Ga0206349_1670001
934 Ga0206355_1040547
935 Ga0206350_10255035
936 Ga0224712_10005340
937 Ga0224712_10215309
938 Ga0207666_1017931
939 Ga0207697_10048659
940 Ga0207697_10308463
941 Ga0207682_10056606
942 Ga0207682_10139645
943 Ga0207642_10017151
944 Ga0207642_10375427
945 Ga0207688_10249117
946 Ga0207688_10605111
947 Ga0207680_10008430
948 Ga0207680_10068686
949 Ga0207685_10176312
950 Ga0207645_10000346
951 Ga0207654_10053563
952 Ga0207695_10085672
953 Ga0207695_10172844
954 Ga0207695_10386202
955 Ga0207693_10392011
956 Ga0207693_10752108
957 Ga0207660_10253835
958 Ga0207660_10449203
959 Ga0207662_10036020
960 Ga0207657_10002506
961 Ga0207657_10421778
962 Ga0207649_10087016
963 Ga0207649_10177964
964 Ga0207652_10079747
965 Ga0207652_10220857
966 Ga0207646_10116832
967 Ga0207646_10132814
968 Ga0207681_10007730
969 Ga0207681_10020412
970 Ga0207681_10262748
971 Ga0207681_10360790
972 Ga0207681_10829049
973 Ga0207694_10145572
974 Ga0207650_10068841
975 Ga0207650_10136381
976 Ga0207659_10000069
977 Ga0207659_10256141
978 Ga0207659_10758355
979 Ga0207687_10087390
980 Ga0207687_10392095
981 Ga0207687_10775139
982 Ga0207700_10014835
983 Ga0207664_10480522
984 Ga0207644_10034270
985 Ga0207644_10199234
986 Ga0207644_10423287
987 Ga0207690_10040779
988 Ga0207706_10129428
989 Ga0207706_10177180
990 Ga0207706_10364972
991 Ga0207706_10391068
992 Ga0207706_10566248
993 Ga0207706_11560479
994 Ga0207686_10254491
995 Ga0207686_10370816
996 Ga0207709_10017859
997 Ga0207709_10020531
998 Ga0207670_10005697
999 Ga0207669_10003099
1000 Ga0207669_10032896
1001 Ga0207669_10060866
1002 Ga0207704_10033119
1003 Ga0207704_10511385
1004 Ga0207665_10071891
1005 Ga0207691_10016350
1006 Ga0207691_10306309
1007 Ga0207691_10381783
1008 Ga0207691_10625166
1009 Ga0207691_11181863
1010 Ga0207711_10066558
1011 Ga0207711_10073119
1012 Ga0207711_10322575
1013 Ga0207711_10353778
1014 Ga0207711_10719984
1015 Ga0207689_10431554
1016 Ga0207689_10489783
1017 Ga0207661_10035833
1018 Ga0207661_10294103
1019 Ga0207679_10068183
1020 Ga0207679_10705853
1021 Ga0207679_11010163
1022 Ga0207667_10088858
1023 Ga0207667_10235405
1024 Ga0207667_11088976
1025 Ga0207651_10017921
1026 Ga0207651_10021684
1027 Ga0207651_10090277
1028 Ga0207651_10494488
1029 Ga0207651_10646492
1030 Ga0207712_10042225
1031 Ga0207712_10352224
1032 Ga0207668_10374012
1033 Ga0207668_10391070
1034 Ga0207640_10006369
1035 Ga0207640_10204428
1036 Ga0207640_10832009
1037 Ga0207658_10106920
1038 Ga0207658_10282658
1039 Ga0207658_10869418
1040 Ga0207677_10434350
1041 Ga0207677_10867639
1042 Ga0207703_10028565
1043 Ga0207703_10035651
1044 Ga0207703_10060204
1045 Ga0207703_10660885
1046 Ga0207639_10474314
1047 Ga0207639_11092410
1048 Ga0207678_10097956
1049 Ga0207708_10002322
1050 Ga0207708_10067872
1051 Ga0207708_10072644
1052 Ga0207641_10152587
1053 Ga0207648_10001795
1054 Ga0207648_10029032
1055 Ga0207676_10054172
1056 Ga0207676_10343979
1057 Ga0207676_10903645
1058 Ga0207674_10372236
1059 Ga0207674_10970745
1060 Ga0207675_100000663
1061 Ga0207675_100003988
1062 Ga0207675_100155262
1063 Ga0207675_100530686
1064 Ga0207675_101216727
1065 Ga0207683_10018725
1066 Ga0207683_10240755
1067 Ga0207683_10279362
1068 Ga0207683_10325090
1069 Ga0207683_11022360
1070 Ga0207698_10133043
1071 Ga0207428_10009208
1072 Ga0207428_10198208
1073 Ga0207428_10276975
1074 Ga0207428_10731298
1075 Ga0268266_10223911
1076 Ga0268266_10439317
1077 Ga0268266_10559685
1078 Ga0268265_10005488
1079 Ga0268265_10246252
1080 Ga0268265_10249064
1081 Ga0268265_10404259
1082 Ga0268265_11443110
1083 Ga0268264_10002477
1084 Ga0268264_10183849
1085 Ga0268264_10253912
1086 Ga0268264_10308268
1087 Ga0307409_101730548
1088 Ga0307416_100902246
1089 Ga0307411_10206745
1090 Ga0373930_0002645
1091 Ga0373948_0003490
1092 Ga0373950_0007935
1093 Ga0373958_0000787
1094 Ga0373938_0000623
1095 Ga0373928_0008276
1096 Ga0373929_0002530
1097 Ga0373940_0000877
1098 Ga0373949_0000860
1099 Ga0373951_0001874
1100 Ga0373952_0001623
1101 Ga0373932_0000249
1102 Ga0373939_0002254
1103 Ga0373939_0032839
1104 Ga0373941_0000920
1105 Ga0373960_0000159
1106 Ga0373942_0000730
1107 Ga0373961_0003649
1108 Ga0373962_0006956
1109 Ga0373931_0008703
1110 Ga0373933_0403091
1111 Ga0373925_0388115
1112 Ga0439431_0085534
1113 Ga0439433_0144563
1114 Ga0439442_065972
1115 Ga0439435_0016733
1116 Ga0466963_0073914
1117 Ga0451576_0007824
1118 Ga0451576_0033391
1119 Ga0451576_0049234
1120 Ga0451576_0263670
1121 Ga0466967_0272517
1122 Ga0466967_0530812
1123 Ga0466967_0726830
1124 Ga0495629_0186846
1125 Ga0495584_0075797
1126 Ga0495640_0842171
1127 Ga0495621_0008394
1128 Ga0495621_0229042
1129 Ga0495670_0183028
1130 Ga0495636_0535271
1131 Ga0495677_0226837
1132 Ga0496100_0481920
1133 Ga0496102_0039632
1134 Ga0496102_0400797
1135 Ga0496103_0867940
1136 Ga0496104_0001113
1137 Ga0496104_0076862
1138 Ga0496105_0041561
1139 Ga0496106_0054924
1140 Ga0496106_1400440
1141 Ga0496108_0034624
1142 Ga0496108_0045266
1143 Ga0496109_0002013
1144 Ga0496109_0232921
1145 Ga0496109_1224624
1146 Ga0496110_0278356
1147 Ga0496112_0033905
1148 Ga0496112_0038459
1149 Ga0496112_1095568
1150 Ga0496114_0790357
1151 Ga0501034_0041021
1152 Ga0501034_0094072
1153 Ga0501036_0649227
1154 Ga0501041_0127805
1155 Ga0501047_0051971
1156 Ga0501068_0319824
1157 Ga0501071_0657025
1158 Ga0501073_0312991
1159 Ga0501074_0409404
1160 Ga0501075_0624658
1161 Ga0501249_073628
1162 Ga0501080_0121081
1163 Ga0501080_0253718
1164 Ga0501044_0002441
1165 nmdc:mga05p37_13615_c1
1166 nmdc:mga05p37_1418972_c1
1167 nmdc:mga05p37_1630_c1
1168 nmdc:mga05p37_168702_c1
1169 nmdc:mga05p37_18081_c2
1170 nmdc:mga05p37_252185_c1
1171 nmdc:mga05p37_539047_c1
1172 nmdc:mga05p37_6587_c1
1173 nmdc:mga05p37_7760_c1
1174 nmdc:mga05p37_8293_c1
1175 nmdc:mga09592_101518_c1
1176 nmdc:mga09592_404439_c1
1177 nmdc:mga06r32_102334_c1
1178 nmdc:mga06r32_141518_c1
1179 nmdc:mga06r32_28797_c1
1180 nmdc:mga08y16_1316_c1
1181 nmdc:mga08y16_261850_c1
1182 nmdc:mga08y16_300033_c1
1183 nmdc:mga08y16_752177_c1
1184 nmdc:mga0n895_123_c1
1185 nmdc:mga0n895_301474_c1
1186 nmdc:mga0n895_30646_c1
1187 nmdc:mga0n895_3171_c1
1188 nmdc:mga0n895_325313_c1
1189 nmdc:mga0n895_47488_c1
1190 nmdc:mga0n895_62785_c1
1191 nmdc:mga0n895_80794_c1
1192 nmdc:mga0n895_891522_c1
1193 nmdc:mga0n895_94808_c1
1194 nmdc:mga0rr50_11476_c1
1195 nmdc:mga0rr50_15476_c1
1196 nmdc:mga0rr50_1968_c1
1197 nmdc:mga0rr50_27_c1
1198 nmdc:mga0rr50_3578_c1
1199 nmdc:mga0rr50_36918_c1
1200 nmdc:mga0rr50_384260_c1
1201 nmdc:mga0rr50_846440_c1
1202 nmdc:mga08x19_239398_c1
1203 nmdc:mga08x19_337_c1
1204 nmdc:mga08x19_6677_c1
1205 nmdc:mga08x19_88899_c1
1206 nmdc:mga08x19_91721_c1
1207 nmdc:mga0a205_17852_c1
1208 nmdc:mga0a205_35678_c1
1209 nmdc:mga0a205_36439_c1
1210 nmdc:mga0a205_49110_c1
1211 nmdc:mga0a205_574340_c1
1212 nmdc:mga0a205_6379_c1
1213 nmdc:mga0a205_704739_c1
1214 Ga0495619_0286831
1215 Ga0501084_0802282
1216 Ga0587073_0007534
1217 Ga0587073_0023664
1218 Ga0587073_0071760
1219 Ga0587077_143344
1220 Ga0587082_014065
1221 Ga0587082_043290
1222 Ga0587082_077822
1223 Ga0587083_0038016
1224 Ga0587083_0057191
1225 Ga0587085_037004
1226 Ga0587090_015437
1227 Ga0587091_022568
1228 Ga0587091_042294
1229 Ga0587091_112191
1230 Ga0587072_027388

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6khu-assembly1.cif.gz_A the crystal structure of a dgc protein from thermotoga maritima 0.8813 13 145
6khu-assembly1.cif.gz_A the crystal structure of a dgc protein from thermotoga maritima 0.8438 13 145
4urq-assembly1.cif.gz_Z crystal structure of ggdef domain (i site mutant) from t.maritima 0.8413 11 142
4iob-assembly1.cif.gz_A crystal structure of the ggdef domain of pa1120 (yfin or tpbb) from pseudomonas aeruginosa at 2.7 ang. 0.8398 13 142
5llw-assembly1.cif.gz_A bacteriophytochrome activated diguanylyl cyclase from idiomarina species a28l 0.819 7 142
ID Description Score Start End Superfamily
4iobA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain 0.8398 13 142 3.30.70.270
3ezuA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain 0.8359 14 142 3.30.70.270
af_P38097_675_846_3.30.70.270 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain 0.8243 4 142 3.30.70.270
4ursA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain 0.8134 6 142 3.30.70.270
af_P76330_387_561_3.30.70.270 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain 0.8117 6 142 3.30.70.270
ID Description Score Start End GO Terms
AF-A0A317HSI7-F1-model_v4 GGDEF domain-containing protein 0.9632 3 149
AF-A0A2V8HRI1-F1-model_v4 BioF2-like acetyltransferase domain-containing protein 0.946 1 149
AF-A0A317HSI7-F1-model_v4 GGDEF domain-containing protein 0.9443 3 149
AF-A0A1F2TC04-F1-model_v4 GGDEF domain-containing protein 0.9434 7 149
AF-A0A2V8HRI1-F1-model_v4 BioF2-like acetyltransferase domain-containing protein 0.9399 1 149

Map