F469368
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 614 | 280 | 1228 | 60 |
Family's Representative Sequence
| Representative Sequence | 3300037853|Ga0436364_0212727|Ga0436364_0212727_668_892 |
| Length | 74 |
| Sequence | MKSPLAGSVDGRKNMPNPKRRHSQRRTNNRRAHDALKTAGLSECPNCHEPKLPHRVCPHCGQYKGREVVEVVEE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 2 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 3 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 73 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 74 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 75 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 76 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 81 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 107 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 109 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 110 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 155 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 159 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 160 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 161 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 162 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 163 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 164 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 165 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 166 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 167 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 168 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 169 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 170 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 171 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 172 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 173 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 174 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 175 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 176 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 177 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 178 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 179 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 180 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 181 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 182 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 183 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 184 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 185 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 186 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 187 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 188 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 189 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 190 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 191 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 193 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 194 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 195 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 196 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 197 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 198 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 199 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 200 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 202 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 203 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 204 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 206 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 207 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 208 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 209 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 210 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 211 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 212 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 213 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 257 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 258 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 259 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 260 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 261 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 263 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 264 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 265 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 266 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 267 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 270 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.42 |
| Metatranscriptomes | 3.58 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.63 |
| Rhizosphere | 96.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 33.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0436364_0212727 | 3300037853 | Bacteria | 1015 |
| 2 | Ga0058859_11530728 | 3300004798 | Unclassified | 931 |
| 3 | Ga0058861_11368490 | 3300004800 | Unclassified | 506 |
| 4 | Ga0058861_11646697 | 3300004800 | Bacteria | 785 |
| 5 | Ga0058861_11938638 | 3300004800 | Unclassified | 618 |
| 6 | Ga0058862_12668913 | 3300004803 | Unclassified | 1032 |
| 7 | Ga0058862_12741556 | 3300004803 | Bacteria | 640 |
| 8 | Ga0070658_10247631 | 3300005327 | Bacteria | 1511 |
| 9 | Ga0070658_10778311 | 3300005327 | Bacteria | 831 |
| 10 | Ga0070658_11605699 | 3300005327 | Bacteria | 563 |
| 11 | Ga0070676_10367922 | 3300005328 | Bacteria | 992 |
| 12 | Ga0070676_11228428 | 3300005328 | Unclassified | 570 |
| 13 | Ga0070683_100000008 | 3300005329 | Bacteria | 329206 |
| 14 | Ga0070683_100078161 | 3300005329 | Unclassified | 3095 |
| 15 | Ga0070683_100106047 | 3300005329 | Bacteria | 2649 |
| 16 | Ga0070683_100285155 | 3300005329 | Bacteria | 1571 |
| 17 | Ga0070683_100588838 | 3300005329 | Bacteria | 1064 |
| 18 | Ga0070683_100784784 | 3300005329 | Unclassified | 913 |
| 19 | Ga0070683_101907295 | 3300005329 | Unclassified | 571 |
| 20 | Ga0070683_101934439 | 3300005329 | Bacteria | 567 |
| 21 | Ga0070683_102100315 | 3300005329 | Unclassified | 543 |
| 22 | Ga0070683_102452130 | 3300005329 | Bacteria | 500 |
| 23 | Ga0070690_101658229 | 3300005330 | Bacteria | 519 |
| 24 | Ga0070670_100762170 | 3300005331 | Bacteria | 872 |
| 25 | Ga0070670_100856344 | 3300005331 | Bacteria | 822 |
| 26 | Ga0070670_101258437 | 3300005331 | Unclassified | 677 |
| 27 | Ga0070670_101345311 | 3300005331 | Unclassified | 654 |
| 28 | Ga0070670_101443294 | 3300005331 | Unclassified | 631 |
| 29 | Ga0070677_10555126 | 3300005333 | Unclassified | 630 |
| 30 | Ga0068869_100209514 | 3300005334 | Bacteria | 1540 |
| 31 | Ga0068869_100648768 | 3300005334 | Bacteria | 896 |
| 32 | Ga0070666_10229563 | 3300005335 | Bacteria | 1310 |
| 33 | Ga0070666_10354796 | 3300005335 | Bacteria | 1050 |
| 34 | Ga0070666_10572116 | 3300005335 | Bacteria | 823 |
| 35 | Ga0070680_101993009 | 3300005336 | Unclassified | 503 |
| 36 | Ga0070682_100180756 | 3300005337 | Unclassified | 1473 |
| 37 | Ga0070682_101803337 | 3300005337 | Bacteria | 534 |
| 38 | Ga0068868_101057152 | 3300005338 | Bacteria | 745 |
| 39 | Ga0068868_101172964 | 3300005338 | Bacteria | 709 |
| 40 | Ga0070689_100050807 | 3300005340 | Bacteria | 3204 |
| 41 | Ga0070661_101857427 | 3300005344 | Unclassified | 512 |
| 42 | Ga0070668_100342557 | 3300005347 | Unclassified | 1263 |
| 43 | Ga0070669_100297992 | 3300005353 | Bacteria | 1296 |
| 44 | Ga0070669_101270639 | 3300005353 | Unclassified | 637 |
| 45 | Ga0070675_102161785 | 3300005354 | Unclassified | 513 |
| 46 | Ga0070671_100613779 | 3300005355 | Unclassified | 940 |
| 47 | Ga0070674_100258147 | 3300005356 | Bacteria | 1372 |
| 48 | Ga0070673_100308203 | 3300005364 | Bacteria | 1396 |
| 49 | Ga0070673_102392814 | 3300005364 | Unclassified | 502 |
| 50 | Ga0070688_100982688 | 3300005365 | Unclassified | 670 |
| 51 | Ga0070688_101482617 | 3300005365 | Unclassified | 552 |
| 52 | Ga0070659_101117636 | 3300005366 | Bacteria | 695 |
| 53 | Ga0070667_100546062 | 3300005367 | Bacteria | 1065 |
| 54 | Ga0070703_10048516 | 3300005406 | Bacteria | 1349 |
| 55 | Ga0070709_10473394 | 3300005434 | Unclassified | 947 |
| 56 | Ga0070709_10608713 | 3300005434 | Bacteria | 842 |
| 57 | Ga0070709_11320339 | 3300005434 | Bacteria | 582 |
| 58 | Ga0070714_100001865 | 3300005435 | Bacteria | 15359 |
| 59 | Ga0070713_100004733 | 3300005436 | Bacteria | 9201 |
| 60 | Ga0070713_100006834 | 3300005436 | Bacteria | 7950 |
| 61 | Ga0070713_100038960 | 3300005436 | Bacteria | 3855 |
| 62 | Ga0070713_100578911 | 3300005436 | Unclassified | 1065 |
| 63 | Ga0070713_100825875 | 3300005436 | Bacteria | 889 |
| 64 | Ga0070713_100865741 | 3300005436 | Bacteria | 868 |
| 65 | Ga0070713_101403976 | 3300005436 | Bacteria | 677 |
| 66 | Ga0070710_10701887 | 3300005437 | Unclassified | 714 |
| 67 | Ga0070711_100039075 | 3300005439 | Unclassified | 3194 |
| 68 | Ga0070711_100067335 | 3300005439 | Bacteria | 2512 |
| 69 | Ga0070711_100200656 | 3300005439 | Unclassified | 1539 |
| 70 | Ga0070711_100292203 | 3300005439 | Bacteria | 1293 |
| 71 | Ga0070705_100352088 | 3300005440 | Bacteria | 1074 |
| 72 | Ga0070705_101218164 | 3300005440 | Unclassified | 621 |
| 73 | Ga0070694_100129761 | 3300005444 | Bacteria | 1819 |
| 74 | Ga0070694_100791705 | 3300005444 | Bacteria | 777 |
| 75 | Ga0070694_101395289 | 3300005444 | Bacteria | 591 |
| 76 | Ga0070694_101476607 | 3300005444 | Bacteria | 575 |
| 77 | Ga0070708_100240383 | 3300005445 | Unclassified | 1700 |
| 78 | Ga0070708_100509083 | 3300005445 | Unclassified | 1136 |
| 79 | Ga0070708_100608102 | 3300005445 | Bacteria | 1031 |
| 80 | Ga0070708_100708125 | 3300005445 | Bacteria | 948 |
| 81 | Ga0070708_100743060 | 3300005445 | Unclassified | 923 |
| 82 | Ga0070708_101274304 | 3300005445 | Bacteria | 687 |
| 83 | Ga0070681_10003424 | 3300005458 | Bacteria | 14861 |
| 84 | Ga0070681_10173619 | 3300005458 | Bacteria | 2077 |
| 85 | Ga0070681_11465344 | 3300005458 | Bacteria | 607 |
| 86 | Ga0068867_100859587 | 3300005459 | Unclassified | 813 |
| 87 | Ga0068867_101727086 | 3300005459 | Unclassified | 587 |
| 88 | Ga0070706_100004126 | 3300005467 | Bacteria | 14129 |
| 89 | Ga0070706_100102052 | 3300005467 | Bacteria | 2666 |
| 90 | Ga0070707_100004479 | 3300005468 | Bacteria | 13087 |
| 91 | Ga0070707_100091249 | 3300005468 | Bacteria | 2949 |
| 92 | Ga0070707_100852731 | 3300005468 | Bacteria | 875 |
| 93 | Ga0070707_101137267 | 3300005468 | Bacteria | 747 |
| 94 | Ga0070698_100013772 | 3300005471 | Bacteria | 8559 |
| 95 | Ga0070698_100394927 | 3300005471 | Bacteria | 1316 |
| 96 | Ga0070699_100010462 | 3300005518 | Bacteria | 8027 |
| 97 | Ga0070699_100021996 | 3300005518 | Bacteria | 5493 |
| 98 | Ga0070699_100428360 | 3300005518 | Bacteria | 1198 |
| 99 | Ga0070699_100625563 | 3300005518 | Unclassified | 982 |
| 100 | Ga0070699_101168911 | 3300005518 | Bacteria | 706 |
| 101 | Ga0070699_101442518 | 3300005518 | Unclassified | 631 |
| 102 | Ga0070684_100000002 | 3300005535 | Bacteria | 257669 |
| 103 | Ga0070684_100083420 | 3300005535 | Unclassified | 2832 |
| 104 | Ga0070684_100099123 | 3300005535 | Unclassified | 2600 |
| 105 | Ga0070697_100438208 | 3300005536 | Bacteria | 1137 |
| 106 | Ga0070697_100583370 | 3300005536 | Bacteria | 982 |
| 107 | Ga0070697_100917039 | 3300005536 | Bacteria | 777 |
| 108 | Ga0068853_100774308 | 3300005539 | Unclassified | 918 |
| 109 | Ga0070672_101669448 | 3300005543 | Unclassified | 572 |
| 110 | Ga0070686_100897625 | 3300005544 | Unclassified | 721 |
| 111 | Ga0070695_100045336 | 3300005545 | Bacteria | 2802 |
| 112 | Ga0070695_100234855 | 3300005545 | Bacteria | 1327 |
| 113 | Ga0070695_100692876 | 3300005545 | Unclassified | 808 |
| 114 | Ga0070696_100001970 | 3300005546 | Bacteria | 13471 |
| 115 | Ga0070696_101132018 | 3300005546 | Unclassified | 659 |
| 116 | Ga0070665_100113476 | 3300005548 | Bacteria | 2713 |
| 117 | Ga0070665_100594381 | 3300005548 | Bacteria | 1120 |
| 118 | Ga0070665_100740813 | 3300005548 | Bacteria | 996 |
| 119 | Ga0070665_101272366 | 3300005548 | Unclassified | 746 |
| 120 | Ga0070665_102355495 | 3300005548 | Unclassified | 535 |
| 121 | Ga0070704_100095651 | 3300005549 | Bacteria | 2225 |
| 122 | Ga0070704_100363387 | 3300005549 | Unclassified | 1225 |
| 123 | Ga0070704_100761769 | 3300005549 | Bacteria | 863 |
| 124 | Ga0068855_100833928 | 3300005563 | Bacteria | 978 |
| 125 | Ga0068855_101770161 | 3300005563 | Bacteria | 628 |
| 126 | Ga0068856_100443170 | 3300005614 | Bacteria | 1319 |
| 127 | Ga0068856_100988266 | 3300005614 | Bacteria | 860 |
| 128 | Ga0070702_101734057 | 3300005615 | Bacteria | 520 |
| 129 | Ga0070702_101851128 | 3300005615 | Bacteria | 505 |
| 130 | Ga0068852_100184240 | 3300005616 | Bacteria | 1965 |
| 131 | Ga0068852_100278828 | 3300005616 | Unclassified | 1611 |
| 132 | Ga0068852_101775886 | 3300005616 | Bacteria | 639 |
| 133 | Ga0068852_101815335 | 3300005616 | Unclassified | 632 |
| 134 | Ga0068859_100230538 | 3300005617 | Bacteria | 1940 |
| 135 | Ga0068859_100890955 | 3300005617 | Unclassified | 975 |
| 136 | Ga0068864_100158580 | 3300005618 | Bacteria | 2055 |
| 137 | Ga0068864_100558001 | 3300005618 | Bacteria | 1108 |
| 138 | Ga0068864_102560904 | 3300005618 | Unclassified | 516 |
| 139 | Ga0068866_11126773 | 3300005718 | Unclassified | 563 |
| 140 | Ga0068861_101595699 | 3300005719 | Unclassified | 643 |
| 141 | Ga0068851_10257713 | 3300005834 | Bacteria | 991 |
| 142 | Ga0068863_100150771 | 3300005841 | Bacteria | 2224 |
| 143 | Ga0068863_100320115 | 3300005841 | Unclassified | 1506 |
| 144 | Ga0068863_100423182 | 3300005841 | Unclassified | 1305 |
| 145 | Ga0068863_100941645 | 3300005841 | Unclassified | 865 |
| 146 | Ga0068863_101192434 | 3300005841 | Bacteria | 767 |
| 147 | Ga0068858_100161171 | 3300005842 | Bacteria | 2112 |
| 148 | Ga0068858_100255060 | 3300005842 | Unclassified | 1666 |
| 149 | Ga0068858_101296544 | 3300005842 | Unclassified | 717 |
| 150 | Ga0068858_102543874 | 3300005842 | Bacteria | 506 |
| 151 | Ga0068860_100013772 | 3300005843 | Bacteria | 7929 |
| 152 | Ga0068860_100802316 | 3300005843 | Bacteria | 955 |
| 153 | Ga0068860_101149992 | 3300005843 | Bacteria | 796 |
| 154 | Ga0068862_100258869 | 3300005844 | Bacteria | 1588 |
| 155 | Ga0081455_10090065 | 3300005937 | Bacteria | 2488 |
| 156 | Ga0081539_10125248 | 3300005985 | Unclassified | 1270 |
| 157 | Ga0070717_10118673 | 3300006028 | Bacteria | 2264 |
| 158 | Ga0070717_10518443 | 3300006028 | Bacteria | 1078 |
| 159 | Ga0070717_10675492 | 3300006028 | Unclassified | 938 |
| 160 | Ga0070717_10945222 | 3300006028 | Bacteria | 785 |
| 161 | Ga0070717_12001756 | 3300006028 | Unclassified | 522 |
| 162 | Ga0070715_10192200 | 3300006163 | Unclassified | 1031 |
| 163 | Ga0070715_10652770 | 3300006163 | Unclassified | 623 |
| 164 | Ga0070716_100331545 | 3300006173 | Bacteria | 1070 |
| 165 | Ga0070716_101537895 | 3300006173 | Unclassified | 545 |
| 166 | Ga0070712_100617293 | 3300006175 | Bacteria | 919 |
| 167 | Ga0070712_101310340 | 3300006175 | Unclassified | 631 |
| 168 | Ga0097621_100038868 | 3300006237 | Bacteria | 3820 |
| 169 | Ga0097621_100282377 | 3300006237 | Unclassified | 1462 |
| 170 | Ga0097621_100855089 | 3300006237 | Unclassified | 845 |
| 171 | Ga0097621_102279318 | 3300006237 | Unclassified | 518 |
| 172 | Ga0097621_102361114 | 3300006237 | Unclassified | 509 |
| 173 | Ga0068871_100023635 | 3300006358 | Bacteria | 4758 |
| 174 | Ga0068871_100694306 | 3300006358 | Unclassified | 932 |
| 175 | Ga0068871_101232954 | 3300006358 | Unclassified | 702 |
| 176 | Ga0068871_101495811 | 3300006358 | Bacteria | 638 |
| 177 | Ga0075428_100010331 | 3300006844 | Bacteria | 10360 |
| 178 | Ga0075430_100023351 | 3300006846 | Bacteria | 5263 |
| 179 | Ga0075433_10642309 | 3300006852 | Bacteria | 931 |
| 180 | Ga0075433_10710063 | 3300006852 | Unclassified | 880 |
| 181 | Ga0075433_10957751 | 3300006852 | Unclassified | 746 |
| 182 | Ga0075433_11441863 | 3300006852 | Bacteria | 595 |
| 183 | Ga0075434_100117627 | 3300006871 | Unclassified | 2671 |
| 184 | Ga0075434_100158521 | 3300006871 | Bacteria | 2283 |
| 185 | Ga0075434_100240976 | 3300006871 | Bacteria | 1828 |
| 186 | Ga0075434_100436187 | 3300006871 | Bacteria | 1331 |
| 187 | Ga0075434_101425687 | 3300006871 | Unclassified | 702 |
| 188 | Ga0075434_101552650 | 3300006871 | Bacteria | 671 |
| 189 | Ga0075429_100005666 | 3300006880 | Bacteria | 10773 |
| 190 | Ga0075429_100429363 | 3300006880 | Bacteria | 1157 |
| 191 | Ga0068865_100528230 | 3300006881 | Unclassified | 988 |
| 192 | Ga0075436_100002134 | 3300006914 | Bacteria | 13623 |
| 193 | Ga0075436_100141375 | 3300006914 | Bacteria | 1692 |
| 194 | Ga0097620_100230531 | 3300006931 | Bacteria | 1940 |
| 195 | Ga0097620_100890850 | 3300006931 | Unclassified | 975 |
| 196 | Ga0075435_100340064 | 3300007076 | Bacteria | 1286 |
| 197 | Ga0075435_101954886 | 3300007076 | Bacteria | 515 |
| 198 | Ga0099794_10767714 | 3300007265 | Bacteria | 515 |
| 199 | Ga0105240_10003870 | 3300009093 | Bacteria | 23121 |
| 200 | Ga0105240_10005171 | 3300009093 | Bacteria | 19512 |
| 201 | Ga0105240_10037297 | 3300009093 | Bacteria | 6248 |
| 202 | Ga0105240_10609177 | 3300009093 | Bacteria | 1201 |
| 203 | Ga0105240_11084974 | 3300009093 | Bacteria | 852 |
| 204 | Ga0105245_10160527 | 3300009098 | Unclassified | 2133 |
| 205 | Ga0105245_10162783 | 3300009098 | Bacteria | 2118 |
| 206 | Ga0105245_12075950 | 3300009098 | Bacteria | 622 |
| 207 | Ga0105247_11194600 | 3300009101 | Bacteria | 605 |
| 208 | Ga0114129_10028718 | 3300009147 | Bacteria | 7881 |
| 209 | Ga0114129_10033666 | 3300009147 | Bacteria | 7239 |
| 210 | Ga0114129_10397764 | 3300009147 | Bacteria | 1816 |
| 211 | Ga0114129_10533653 | 3300009147 | Bacteria | 1528 |
| 212 | Ga0105241_10396939 | 3300009174 | Unclassified | 1209 |
| 213 | Ga0105241_10703967 | 3300009174 | Bacteria | 922 |
| 214 | Ga0105241_12480877 | 3300009174 | Bacteria | 519 |
| 215 | Ga0105242_10806193 | 3300009176 | Unclassified | 930 |
| 216 | Ga0105242_11178652 | 3300009176 | Bacteria | 784 |
| 217 | Ga0105242_11455595 | 3300009176 | Unclassified | 714 |
| 218 | Ga0105248_10348518 | 3300009177 | Unclassified | 1667 |
| 219 | Ga0105248_10354081 | 3300009177 | Unclassified | 1653 |
| 220 | Ga0105248_10427244 | 3300009177 | Bacteria | 1492 |
| 221 | Ga0105248_12049034 | 3300009177 | Bacteria | 650 |
| 222 | Ga0105237_10027300 | 3300009545 | Bacteria | 5829 |
| 223 | Ga0105237_10034703 | 3300009545 | Bacteria | 5106 |
| 224 | Ga0105237_10747694 | 3300009545 | Unclassified | 984 |
| 225 | Ga0105238_10264150 | 3300009551 | Bacteria | 1701 |
| 226 | Ga0105238_10503920 | 3300009551 | Unclassified | 1212 |
| 227 | Ga0105249_12109496 | 3300009553 | Unclassified | 636 |
| 228 | Ga0105239_10724623 | 3300010375 | Unclassified | 1138 |
| 229 | Ga0105246_10260657 | 3300011119 | Bacteria | 1381 |
| 230 | Ga0105246_11531669 | 3300011119 | Bacteria | 627 |
| 231 | Ga0157370_11342918 | 3300013104 | Bacteria | 644 |
| 232 | Ga0157369_10085114 | 3300013105 | Bacteria | 3379 |
| 233 | Ga0157369_10113891 | 3300013105 | Bacteria | 2873 |
| 234 | Ga0157369_10253541 | 3300013105 | Bacteria | 1836 |
| 235 | Ga0157369_10413331 | 3300013105 | Bacteria | 1399 |
| 236 | Ga0157374_10455548 | 3300013296 | Unclassified | 1281 |
| 237 | Ga0157374_12192065 | 3300013296 | Bacteria | 579 |
| 238 | Ga0157378_10026687 | 3300013297 | Bacteria | 5092 |
| 239 | Ga0157378_10187190 | 3300013297 | Unclassified | 1950 |
| 240 | Ga0157378_10289685 | 3300013297 | Bacteria | 1581 |
| 241 | Ga0157378_10800977 | 3300013297 | Bacteria | 968 |
| 242 | Ga0157378_10997131 | 3300013297 | Unclassified | 872 |
| 243 | Ga0157378_11851232 | 3300013297 | Bacteria | 652 |
| 244 | Ga0163162_10439964 | 3300013306 | Bacteria | 1436 |
| 245 | Ga0163162_11152398 | 3300013306 | Unclassified | 879 |
| 246 | Ga0163162_11554522 | 3300013306 | Unclassified | 754 |
| 247 | Ga0157372_10972437 | 3300013307 | Bacteria | 984 |
| 248 | Ga0157372_11025837 | 3300013307 | Bacteria | 955 |
| 249 | Ga0157372_12246148 | 3300013307 | Unclassified | 627 |
| 250 | Ga0157372_12689159 | 3300013307 | Bacteria | 571 |
| 251 | Ga0157375_11193493 | 3300013308 | Unclassified | 892 |
| 252 | Ga0157375_13046514 | 3300013308 | Unclassified | 559 |
| 253 | Ga0163163_10062107 | 3300014325 | Bacteria | 3701 |
| 254 | Ga0163163_10441772 | 3300014325 | Bacteria | 1361 |
| 255 | Ga0157379_10277485 | 3300014968 | Bacteria | 1525 |
| 256 | Ga0157379_10910779 | 3300014968 | Unclassified | 835 |
| 257 | Ga0157379_11021708 | 3300014968 | Bacteria | 789 |
| 258 | Ga0157379_11558139 | 3300014968 | Unclassified | 644 |
| 259 | Ga0157376_10331443 | 3300014969 | Bacteria | 1450 |
| 260 | Ga0157376_10472159 | 3300014969 | Unclassified | 1228 |
| 261 | Ga0157376_10712240 | 3300014969 | Bacteria | 1010 |
| 262 | Ga0157376_11267960 | 3300014969 | Bacteria | 766 |
| 263 | Ga0157376_12114165 | 3300014969 | Unclassified | 601 |
| 264 | Ga0163161_10565000 | 3300017792 | Bacteria | 934 |
| 265 | Ga0197907_10515109 | 3300020069 | Bacteria | 1746 |
| 266 | Ga0206355_1415746 | 3300020076 | Bacteria | 1882 |
| 267 | Ga0206355_1548908 | 3300020076 | Bacteria | 1076 |
| 268 | Ga0206352_10002734 | 3300020078 | Bacteria | 1985 |
| 269 | Ga0206352_10389846 | 3300020078 | Bacteria | 736 |
| 270 | Ga0213876_10210412 | 3300021384 | Bacteria | 1034 |
| 271 | Ga0213875_10028082 | 3300021388 | Bacteria | 2675 |
| 272 | Ga0224712_10031167 | 3300022467 | Bacteria | 1932 |
| 273 | Ga0224712_10187212 | 3300022467 | Bacteria | 935 |
| 274 | Ga0207653_10012107 | 3300025885 | Bacteria | 2692 |
| 275 | Ga0207680_10209935 | 3300025903 | Bacteria | 1331 |
| 276 | Ga0207685_10253190 | 3300025905 | Unclassified | 852 |
| 277 | Ga0207685_10384553 | 3300025905 | Bacteria | 716 |
| 278 | Ga0207645_11190053 | 3300025907 | Unclassified | 512 |
| 279 | Ga0207643_10503499 | 3300025908 | Unclassified | 774 |
| 280 | Ga0207705_10223709 | 3300025909 | Bacteria | 1430 |
| 281 | Ga0207684_10004973 | 3300025910 | Bacteria | 12393 |
| 282 | Ga0207684_10029493 | 3300025910 | Bacteria | 4671 |
| 283 | Ga0207654_10592884 | 3300025911 | Bacteria | 790 |
| 284 | Ga0207654_10606877 | 3300025911 | Unclassified | 781 |
| 285 | Ga0207707_10021404 | 3300025912 | Bacteria | 5653 |
| 286 | Ga0207707_10133977 | 3300025912 | Bacteria | 2167 |
| 287 | Ga0207695_10004029 | 3300025913 | Bacteria | 20229 |
| 288 | Ga0207695_10014070 | 3300025913 | Bacteria | 9501 |
| 289 | Ga0207695_10389484 | 3300025913 | Bacteria | 1278 |
| 290 | Ga0207695_10401164 | 3300025913 | Unclassified | 1256 |
| 291 | Ga0207695_10546389 | 3300025913 | Bacteria | 1040 |
| 292 | Ga0207671_10014573 | 3300025914 | Bacteria | 6202 |
| 293 | Ga0207671_10165940 | 3300025914 | Bacteria | 1712 |
| 294 | Ga0207671_10416952 | 3300025914 | Bacteria | 1068 |
| 295 | Ga0207693_10688895 | 3300025915 | Bacteria | 792 |
| 296 | Ga0207693_10722205 | 3300025915 | Unclassified | 771 |
| 297 | Ga0207663_10046686 | 3300025916 | Bacteria | 2670 |
| 298 | Ga0207657_10141862 | 3300025919 | Bacteria | 1962 |
| 299 | Ga0207652_10207013 | 3300025921 | Unclassified | 1766 |
| 300 | Ga0207646_10005837 | 3300025922 | Bacteria | 12877 |
| 301 | Ga0207646_11236047 | 3300025922 | Bacteria | 654 |
| 302 | Ga0207681_11810758 | 3300025923 | Unclassified | 509 |
| 303 | Ga0207694_10261094 | 3300025924 | Bacteria | 1419 |
| 304 | Ga0207694_10273710 | 3300025924 | Unclassified | 1385 |
| 305 | Ga0207694_11117147 | 3300025924 | Unclassified | 667 |
| 306 | Ga0207650_10724704 | 3300025925 | Unclassified | 841 |
| 307 | Ga0207687_10138228 | 3300025927 | Unclassified | 1845 |
| 308 | Ga0207687_11891608 | 3300025927 | Bacteria | 510 |
| 309 | Ga0207700_10005089 | 3300025928 | Bacteria | 7817 |
| 310 | Ga0207700_10005599 | 3300025928 | Bacteria | 7538 |
| 311 | Ga0207700_10544865 | 3300025928 | Bacteria | 1029 |
| 312 | Ga0207700_10668099 | 3300025928 | Bacteria | 927 |
| 313 | Ga0207700_10813255 | 3300025928 | Bacteria | 836 |
| 314 | Ga0207664_10000970 | 3300025929 | Bacteria | 19337 |
| 315 | Ga0207664_10560123 | 3300025929 | Bacteria | 1026 |
| 316 | Ga0207644_11552302 | 3300025931 | Unclassified | 556 |
| 317 | Ga0207690_11500671 | 3300025932 | Bacteria | 563 |
| 318 | Ga0207686_10330682 | 3300025934 | Unclassified | 1141 |
| 319 | Ga0207686_10371121 | 3300025934 | Bacteria | 1083 |
| 320 | Ga0207669_10409674 | 3300025937 | Bacteria | 1064 |
| 321 | Ga0207704_10954074 | 3300025938 | Bacteria | 723 |
| 322 | Ga0207665_10212083 | 3300025939 | Unclassified | 1415 |
| 323 | Ga0207665_11197890 | 3300025939 | Bacteria | 606 |
| 324 | Ga0207691_10736023 | 3300025940 | Unclassified | 831 |
| 325 | Ga0207711_10075778 | 3300025941 | Bacteria | 2928 |
| 326 | Ga0207711_10193965 | 3300025941 | Bacteria | 1852 |
| 327 | Ga0207711_10359995 | 3300025941 | Bacteria | 1348 |
| 328 | Ga0207711_10845724 | 3300025941 | Unclassified | 852 |
| 329 | Ga0207711_11071957 | 3300025941 | Unclassified | 746 |
| 330 | Ga0207689_10452862 | 3300025942 | Bacteria | 1073 |
| 331 | Ga0207661_10000008 | 3300025944 | Bacteria | 451211 |
| 332 | Ga0207661_10076445 | 3300025944 | Bacteria | 2750 |
| 333 | Ga0207661_10107153 | 3300025944 | Bacteria | 2357 |
| 334 | Ga0207661_11539240 | 3300025944 | Bacteria | 609 |
| 335 | Ga0207661_12119372 | 3300025944 | Unclassified | 508 |
| 336 | Ga0207667_10701224 | 3300025949 | Bacteria | 1015 |
| 337 | Ga0207668_10521983 | 3300025972 | Unclassified | 1025 |
| 338 | Ga0207658_10535508 | 3300025986 | Bacteria | 1047 |
| 339 | Ga0207658_11531144 | 3300025986 | Unclassified | 610 |
| 340 | Ga0207703_11311588 | 3300026035 | Unclassified | 696 |
| 341 | Ga0207639_10359308 | 3300026041 | Bacteria | 1303 |
| 342 | Ga0207708_11235556 | 3300026075 | Bacteria | 654 |
| 343 | Ga0207702_11375361 | 3300026078 | Unclassified | 700 |
| 344 | Ga0207641_10152649 | 3300026088 | Bacteria | 2093 |
| 345 | Ga0207641_10429362 | 3300026088 | Bacteria | 1274 |
| 346 | Ga0207641_10528678 | 3300026088 | Unclassified | 1148 |
| 347 | Ga0207676_10137831 | 3300026095 | Bacteria | 2085 |
| 348 | Ga0207675_102510587 | 3300026118 | Bacteria | 526 |
| 349 | Ga0207683_10759006 | 3300026121 | Bacteria | 900 |
| 350 | Ga0207683_10807106 | 3300026121 | Unclassified | 871 |
| 351 | Ga0207428_10609184 | 3300027907 | Bacteria | 786 |
| 352 | Ga0268266_10330279 | 3300028379 | Unclassified | 1429 |
| 353 | Ga0268266_10896109 | 3300028379 | Unclassified | 858 |
| 354 | Ga0268265_10251582 | 3300028380 | Unclassified | 1565 |
| 355 | Ga0268264_10010520 | 3300028381 | Bacteria | 7649 |
| 356 | Ga0268264_11392198 | 3300028381 | Unclassified | 712 |
| 357 | Ga0265323_10000589 | 3300028653 | Bacteria | 19976 |
| 358 | Ga0265336_10028362 | 3300028666 | Bacteria | 1750 |
| 359 | Ga0265336_10177824 | 3300028666 | Bacteria | 633 |
| 360 | Ga0265338_10057621 | 3300028800 | Bacteria | 3435 |
| 361 | Ga0265762_1019006 | 3300030760 | Bacteria | 1256 |
| 362 | Ga0265760_10266160 | 3300031090 | Unclassified | 598 |
| 363 | Ga0265330_10016635 | 3300031235 | Bacteria | 3391 |
| 364 | Ga0265330_10168206 | 3300031235 | Unclassified | 930 |
| 365 | Ga0265330_10188985 | 3300031235 | Unclassified | 872 |
| 366 | Ga0265332_10054697 | 3300031238 | Bacteria | 1712 |
| 367 | Ga0265328_10014121 | 3300031239 | Bacteria | 3149 |
| 368 | Ga0265320_10041477 | 3300031240 | Bacteria | 2287 |
| 369 | Ga0265320_10252759 | 3300031240 | Bacteria | 782 |
| 370 | Ga0265329_10039317 | 3300031242 | Bacteria | 1520 |
| 371 | Ga0265340_10053499 | 3300031247 | Bacteria | 1950 |
| 372 | Ga0265340_10108927 | 3300031247 | Unclassified | 1282 |
| 373 | Ga0265340_10402910 | 3300031247 | Unclassified | 603 |
| 374 | Ga0265339_10035968 | 3300031249 | Bacteria | 2773 |
| 375 | Ga0265331_10019862 | 3300031250 | Bacteria | 3460 |
| 376 | Ga0265331_10092875 | 3300031250 | Bacteria | 1394 |
| 377 | Ga0265331_10403255 | 3300031250 | Unclassified | 613 |
| 378 | Ga0265316_10001880 | 3300031344 | Bacteria | 22044 |
| 379 | Ga0265316_10021831 | 3300031344 | Bacteria | 5411 |
| 380 | Ga0265316_10037791 | 3300031344 | Unclassified | 3893 |
| 381 | Ga0265316_10049924 | 3300031344 | Bacteria | 3293 |
| 382 | Ga0265316_10060472 | 3300031344 | Bacteria | 2944 |
| 383 | Ga0265316_10094230 | 3300031344 | Bacteria | 2281 |
| 384 | Ga0265316_10268485 | 3300031344 | Bacteria | 1249 |
| 385 | Ga0265316_10270943 | 3300031344 | Unclassified | 1242 |
| 386 | Ga0265316_10534046 | 3300031344 | Unclassified | 836 |
| 387 | Ga0265316_10826262 | 3300031344 | Unclassified | 649 |
| 388 | Ga0265313_10342125 | 3300031595 | Bacteria | 594 |
| 389 | Ga0265314_10003050 | 3300031711 | Bacteria | 16520 |
| 390 | Ga0265314_10051013 | 3300031711 | Bacteria | 2884 |
| 391 | Ga0265314_10243363 | 3300031711 | Bacteria | 1036 |
| 392 | Ga0265314_10654260 | 3300031711 | Unclassified | 536 |
| 393 | Ga0265342_10072664 | 3300031712 | Bacteria | 2002 |
| 394 | Ga0265342_10098716 | 3300031712 | Bacteria | 1666 |
| 395 | Ga0265342_10486002 | 3300031712 | Unclassified | 631 |
| 396 | Ga0265342_10646857 | 3300031712 | Unclassified | 531 |
| 397 | Ga0265342_10700086 | 3300031712 | Bacteria | 506 |
| 398 | Ga0316576_10057678 | 3300031727 | Bacteria | 2838 |
| 399 | Ga0316576_10367621 | 3300031727 | Unclassified | 1069 |
| 400 | Ga0316578_10658520 | 3300031728 | Unclassified | 611 |
| 401 | Ga0316577_10006621 | 3300031733 | Bacteria | 6133 |
| 402 | Ga0307406_10323509 | 3300031901 | Unclassified | 1194 |
| 403 | Ga0307409_101549554 | 3300031995 | Unclassified | 690 |
| 404 | Ga0307416_101018178 | 3300032002 | Bacteria | 932 |
| 405 | Ga0307416_103522270 | 3300032002 | Unclassified | 524 |
| 406 | Ga0307411_11354734 | 3300032005 | Bacteria | 650 |
| 407 | Ga0316585_10285614 | 3300032137 | Unclassified | 548 |
| 408 | Ga0316596_1231439 | 3300033541 | Unclassified | 519 |
| 409 | Ga0373934_0188370 | 3300035086 | Bacteria | 849 |
| 410 | Ga0373934_0400539 | 3300035086 | Bacteria | 573 |
| 411 | Ga0373944_0335918 | 3300035089 | Bacteria | 573 |
| 412 | Ga0373923_0019318 | 3300035111 | Bacteria | 2637 |
| 413 | Ga0373923_0131634 | 3300035111 | Bacteria | 1125 |
| 414 | Ga0373923_0528062 | 3300035111 | Bacteria | 577 |
| 415 | Ga0373936_0245118 | 3300035113 | Unclassified | 799 |
| 416 | Ga0373936_0420005 | 3300035113 | Bacteria | 616 |
| 417 | Ga0373945_0104651 | 3300035116 | Unclassified | 1111 |
| 418 | Ga0373953_0127086 | 3300035117 | Bacteria | 1085 |
| 419 | Ga0373954_0103721 | 3300035118 | Unclassified | 1373 |
| 420 | Ga0373954_0105815 | 3300035118 | Bacteria | 1359 |
| 421 | Ga0373956_0085628 | 3300035119 | Bacteria | 1449 |
| 422 | Ga0373957_0360401 | 3300035120 | Unclassified | 622 |
| 423 | Ga0373957_0366319 | 3300035120 | Bacteria | 617 |
| 424 | Ga0373943_0006932 | 3300035170 | Bacteria | 5083 |
| 425 | Ga0373943_0155456 | 3300035170 | Unclassified | 1242 |
| 426 | Ga0373943_0224307 | 3300035170 | Bacteria | 1048 |
| 427 | Ga0373943_0258464 | 3300035170 | Bacteria | 980 |
| 428 | Ga0373955_0007578 | 3300035172 | Bacteria | 4997 |
| 429 | Ga0373955_0165892 | 3300035172 | Bacteria | 1306 |
| 430 | Ga0373955_0219361 | 3300035172 | Bacteria | 1136 |
| 431 | Ga0373955_0243068 | 3300035172 | Bacteria | 1078 |
| 432 | Ga0373955_0690928 | 3300035172 | Bacteria | 626 |
| 433 | Ga0316574_0277803 | 3300035398 | Unclassified | 1067 |
| 434 | Ga0316574_0784332 | 3300035398 | Unclassified | 581 |
| 435 | Ga0373935_0006632 | 3300035692 | Bacteria | 6916 |
| 436 | Ga0373935_0164526 | 3300035692 | Bacteria | 1514 |
| 437 | Ga0373935_0734018 | 3300035692 | Bacteria | 727 |
| 438 | Ga0373935_1315575 | 3300035692 | Bacteria | 540 |
| 439 | Ga0373927_0000378 | 3300035695 | Bacteria | 34466 |
| 440 | Ga0373927_0053422 | 3300035695 | Bacteria | 2614 |
| 441 | Ga0373927_0493284 | 3300035695 | Bacteria | 809 |
| 442 | Ga0373933_0425654 | 3300035724 | Unclassified | 867 |
| 443 | Ga0373933_0783402 | 3300035724 | Bacteria | 627 |
| 444 | Ga0373933_0983515 | 3300035724 | Unclassified | 556 |
| 445 | Ga0373947_0083417 | 3300035725 | Bacteria | 1982 |
| 446 | Ga0373947_0230910 | 3300035725 | Bacteria | 1219 |
| 447 | Ga0373947_0833703 | 3300035725 | Unclassified | 629 |
| 448 | Ga0373947_0904240 | 3300035725 | Bacteria | 603 |
| 449 | Ga0373947_1244254 | 3300035725 | Unclassified | 507 |
| 450 | Ga0373937_0014121 | 3300036401 | Bacteria | 7044 |
| 451 | Ga0373937_0061081 | 3300036401 | Bacteria | 3464 |
| 452 | Ga0373937_0074832 | 3300036401 | Bacteria | 3126 |
| 453 | Ga0373937_0122729 | 3300036401 | Bacteria | 2422 |
| 454 | Ga0373937_0125500 | 3300036401 | Unclassified | 2394 |
| 455 | Ga0373937_0270373 | 3300036401 | Bacteria | 1604 |
| 456 | Ga0373937_0379345 | 3300036401 | Unclassified | 1341 |
| 457 | Ga0373937_0494224 | 3300036401 | Bacteria | 1162 |
| 458 | Ga0373937_1042163 | 3300036401 | Bacteria | 767 |
| 459 | Ga0373937_1042847 | 3300036401 | Unclassified | 766 |
| 460 | Ga0265778_026025 | 3300036457 | Bacteria | 741 |
| 461 | Ga0265778_067284 | 3300036457 | Unclassified | 505 |
| 462 | Ga0316582_0105423 | 3300036647 | Bacteria | 1871 |
| 463 | Ga0316582_0561413 | 3300036647 | Bacteria | 786 |
| 464 | Ga0316584_0052484 | 3300036712 | Bacteria | 3049 |
| 465 | Ga0373925_0043565 | 3300037068 | Bacteria | 3332 |
| 466 | Ga0373925_0200747 | 3300037068 | Bacteria | 1586 |
| 467 | Ga0373925_0362648 | 3300037068 | Bacteria | 1178 |
| 468 | Ga0373925_0415043 | 3300037068 | Unclassified | 1099 |
| 469 | Ga0373925_0574430 | 3300037068 | Unclassified | 928 |
| 470 | Ga0373925_0721137 | 3300037068 | Bacteria | 822 |
| 471 | Ga0395900_1913945 | 3300037418 | Bacteria | 504 |
| 472 | Ga0395905_0576770 | 3300037471 | Bacteria | 1026 |
| 473 | Ga0436364_1082106 | 3300037853 | Bacteria | 6429 |
| 474 | Ga0436364_1560354 | 3300037853 | Bacteria | 3554 |
| 475 | Ga0436365_0090871 | 3300039437 | Bacteria | 4111 |
| 476 | Ga0436365_1649063 | 3300039437 | Bacteria | 1468 |
| 477 | Ga0436365_1712753 | 3300039437 | Unclassified | 1109 |
| 478 | Ga0436362_0822382 | 3300039453 | Bacteria | 666 |
| 479 | Ga0451839_0113558 | 3300041496 | Unclassified | 522 |
| 480 | Ga0466963_0263467 | 3300044694 | Unclassified | 1210 |
| 481 | Ga0451576_0313350 | 3300045051 | Bacteria | 1642 |
| 482 | Ga0451576_0347972 | 3300045051 | Unclassified | 1552 |
| 483 | Ga0451576_0382638 | 3300045051 | Bacteria | 1475 |
| 484 | Ga0451576_0885808 | 3300045051 | Bacteria | 937 |
| 485 | Ga0466958_0145803 | 3300045836 | Unclassified | 1492 |
| 486 | Ga0495592_0077000 | 3300046454 | Bacteria | 2419 |
| 487 | Ga0495592_0341926 | 3300046454 | Bacteria | 962 |
| 488 | Ga0495603_0631731 | 3300046455 | Bacteria | 613 |
| 489 | Ga0495629_0234113 | 3300046459 | Unclassified | 1266 |
| 490 | Ga0495629_0485254 | 3300046459 | Bacteria | 834 |
| 491 | Ga0495629_0604167 | 3300046459 | Unclassified | 733 |
| 492 | Ga0495651_0012118 | 3300046462 | Bacteria | 6635 |
| 493 | Ga0495653_0115061 | 3300046463 | Bacteria | 1926 |
| 494 | Ga0495653_0269500 | 3300046463 | Unclassified | 1122 |
| 495 | Ga0495580_0017307 | 3300046472 | Bacteria | 5393 |
| 496 | Ga0495580_0033811 | 3300046472 | Bacteria | 3682 |
| 497 | Ga0495580_0073198 | 3300046472 | Bacteria | 2392 |
| 498 | Ga0495580_0390805 | 3300046472 | Bacteria | 939 |
| 499 | Ga0495582_0354580 | 3300046473 | Bacteria | 845 |
| 500 | Ga0495582_0413079 | 3300046473 | Bacteria | 778 |
| 501 | Ga0495639_0288820 | 3300046475 | Unclassified | 816 |
| 502 | Ga0495639_0414372 | 3300046475 | Bacteria | 682 |
| 503 | Ga0495662_0015805 | 3300046476 | Bacteria | 3663 |
| 504 | Ga0495662_0543001 | 3300046476 | Unclassified | 569 |
| 505 | Ga0495664_0108206 | 3300046477 | Bacteria | 1677 |
| 506 | Ga0495608_0773399 | 3300046511 | Bacteria | 568 |
| 507 | Ga0495618_0084846 | 3300046514 | Bacteria | 2024 |
| 508 | Ga0495618_0261448 | 3300046514 | Unclassified | 1084 |
| 509 | Ga0495628_0086091 | 3300046516 | Bacteria | 2437 |
| 510 | Ga0495630_0022356 | 3300046517 | Bacteria | 4669 |
| 511 | Ga0495666_0145310 | 3300046526 | Bacteria | 1104 |
| 512 | Ga0495642_0124157 | 3300046528 | Unclassified | 1109 |
| 513 | Ga0495642_0508649 | 3300046528 | Bacteria | 533 |
| 514 | Ga0495652_0034391 | 3300046529 | Bacteria | 4417 |
| 515 | Ga0495654_0432077 | 3300046530 | Unclassified | 520 |
| 516 | Ga0495665_0065176 | 3300046531 | Bacteria | 1923 |
| 517 | Ga0495665_0171896 | 3300046531 | Unclassified | 1128 |
| 518 | Ga0495640_0099357 | 3300046533 | Bacteria | 1912 |
| 519 | Ga0495640_0167765 | 3300046533 | Bacteria | 1404 |
| 520 | Ga0495586_0609417 | 3300046535 | Bacteria | 631 |
| 521 | Ga0495587_0084992 | 3300046536 | Bacteria | 1832 |
| 522 | Ga0495587_0236643 | 3300046536 | Bacteria | 1028 |
| 523 | Ga0495645_0030836 | 3300046543 | Bacteria | 3906 |
| 524 | Ga0495645_0068838 | 3300046543 | Bacteria | 2555 |
| 525 | Ga0495645_0580977 | 3300046543 | Bacteria | 691 |
| 526 | Ga0495667_0055425 | 3300046559 | Bacteria | 2607 |
| 527 | Ga0495667_0210321 | 3300046559 | Unclassified | 1243 |
| 528 | Ga0495634_0056896 | 3300046642 | Bacteria | 2612 |
| 529 | Ga0495634_0382828 | 3300046642 | Bacteria | 838 |
| 530 | Ga0495635_0070641 | 3300046663 | Bacteria | 2393 |
| 531 | Ga0495635_0176209 | 3300046663 | Bacteria | 1454 |
| 532 | Ga0495635_0439099 | 3300046663 | Bacteria | 864 |
| 533 | Ga0495635_1034024 | 3300046663 | Bacteria | 522 |
| 534 | Ga0495657_0464450 | 3300046675 | Bacteria | 740 |
| 535 | Ga0495599_0019002 | 3300046678 | Bacteria | 4284 |
| 536 | Ga0495599_0207596 | 3300046678 | Bacteria | 1202 |
| 537 | Ga0495599_0413600 | 3300046678 | Unclassified | 802 |
| 538 | Ga0495623_0040082 | 3300046679 | Bacteria | 2992 |
| 539 | Ga0495623_0060758 | 3300046679 | Bacteria | 2371 |
| 540 | Ga0495623_0104834 | 3300046679 | Bacteria | 1719 |
| 541 | Ga0495623_0133988 | 3300046679 | Bacteria | 1480 |
| 542 | Ga0495623_0176719 | 3300046679 | Bacteria | 1243 |
| 543 | Ga0495623_0674728 | 3300046679 | Unclassified | 531 |
| 544 | Ga0495646_0141089 | 3300046680 | Bacteria | 1347 |
| 545 | Ga0495647_0220005 | 3300046681 | Unclassified | 838 |
| 546 | Ga0495658_0026815 | 3300046683 | Bacteria | 3093 |
| 547 | Ga0495658_0063066 | 3300046683 | Bacteria | 2132 |
| 548 | Ga0495658_0142347 | 3300046683 | Unclassified | 1467 |
| 549 | Ga0495658_0317875 | 3300046683 | Bacteria | 986 |
| 550 | Ga0495613_0114414 | 3300046689 | Bacteria | 1942 |
| 551 | Ga0495613_0239603 | 3300046689 | Bacteria | 1269 |
| 552 | Ga0495613_1013732 | 3300046689 | Unclassified | 533 |
| 553 | Ga0495604_0034758 | 3300047317 | Bacteria | 3986 |
| 554 | Ga0495604_0102250 | 3300047317 | Bacteria | 2104 |
| 555 | Ga0495604_0106906 | 3300047317 | Bacteria | 2046 |
| 556 | Ga0495636_0049886 | 3300047318 | Bacteria | 1751 |
| 557 | Ga0495674_0028929 | 3300047319 | Bacteria | 5048 |
| 558 | Ga0495674_0037262 | 3300047319 | Bacteria | 4369 |
| 559 | Ga0495674_0117155 | 3300047319 | Bacteria | 2253 |
| 560 | Ga0495674_0337517 | 3300047319 | Unclassified | 1225 |
| 561 | Ga0495674_0930258 | 3300047319 | Bacteria | 670 |
| 562 | Ga0495674_1183950 | 3300047319 | Unclassified | 578 |
| 563 | Ga0495680_0148763 | 3300047322 | Bacteria | 1708 |
| 564 | Ga0495675_0074143 | 3300047444 | Bacteria | 2145 |
| 565 | Ga0495675_0288526 | 3300047444 | Unclassified | 977 |
| 566 | Ga0495684_0010917 | 3300047471 | Bacteria | 7021 |
| 567 | Ga0495684_0063572 | 3300047471 | Bacteria | 2805 |
| 568 | Ga0495684_0086547 | 3300047471 | Bacteria | 2375 |
| 569 | Ga0495684_0318648 | 3300047471 | Bacteria | 1112 |
| 570 | Ga0495684_0424594 | 3300047471 | Unclassified | 929 |
| 571 | Ga0495684_0534122 | 3300047471 | Unclassified | 801 |
| 572 | Ga0495684_0801534 | 3300047471 | Unclassified | 615 |
| 573 | Ga0495602_0166255 | 3300048088 | Bacteria | 1717 |
| 574 | Ga0495602_0172685 | 3300048088 | Bacteria | 1676 |
| 575 | Ga0495614_0214149 | 3300048089 | Bacteria | 874 |
| 576 | Ga0496100_0134132 | 3300048903 | Unclassified | 1747 |
| 577 | Ga0496101_0000804 | 3300048904 | Bacteria | 18549 |
| 578 | Ga0496101_0919366 | 3300048904 | Bacteria | 689 |
| 579 | Ga0496102_0588402 | 3300048905 | Bacteria | 1036 |
| 580 | Ga0496104_0057520 | 3300048907 | Bacteria | 3679 |
| 581 | Ga0496105_0119484 | 3300048908 | Bacteria | 2174 |
| 582 | Ga0496106_0261992 | 3300048909 | Unclassified | 1383 |
| 583 | Ga0496107_0027201 | 3300048910 | Bacteria | 4061 |
| 584 | Ga0496108_1683387 | 3300048911 | Unclassified | 523 |
| 585 | Ga0496114_0001096 | 3300048917 | Bacteria | 20425 |
| 586 | Ga0501310_069184 | 3300049130 | Unclassified | 538 |
| 587 | Ga0501316_014636 | 3300049532 | Unclassified | 937 |
| 588 | Ga0501321_084558 | 3300049537 | Unclassified | 510 |
| 589 | Ga0501325_029243 | 3300049541 | Unclassified | 623 |
| 590 | Ga0501041_0367400 | 3300049577 | Unclassified | 910 |
| 591 | Ga0501079_0481772 | 3300049741 | Unclassified | 975 |
| 592 | Ga0501263_019490 | 3300049760 | Unclassified | 904 |
| 593 | Ga0501045_0214145 | 3300049824 | Unclassified | 1435 |
| 594 | Ga0501045_1257537 | 3300049824 | Bacteria | 539 |
| 595 | Ga0501045_1306131 | 3300049824 | Bacteria | 528 |
| 596 | nmdc:mga05p37_253177_c1 | 3300050507 | Bacteria | 2111 |
| 597 | nmdc:mga05p37_457944_c1 | 3300050507 | Bacteria | 1475 |
| 598 | nmdc:mga05p37_846874_c1 | 3300050507 | Unclassified | 994 |
| 599 | nmdc:mga05p37_956583_c1 | 3300050507 | Bacteria | 916 |
| 600 | nmdc:mga09592_418786_c1 | 3300050508 | Bacteria | 1157 |
| 601 | nmdc:mga09592_66644_c1 | 3300050508 | Bacteria | 3052 |
| 602 | nmdc:mga0qj67_62052_c1 | 3300050509 | Bacteria | 2969 |
| 603 | nmdc:mga08y16_1386511_c1 | 3300050511 | Bacteria | 667 |
| 604 | nmdc:mga0n895_1516912_c1 | 3300050512 | Bacteria | 636 |
| 605 | nmdc:mga0n895_170939_c1 | 3300050512 | Bacteria | 2205 |
| 606 | nmdc:mga0n895_181606_c1 | 3300050512 | Bacteria | 2135 |
| 607 | nmdc:mga0n895_436349_c1 | 3300050512 | Bacteria | 1323 |
| 608 | nmdc:mga08x19_10758_c1 | 3300050514 | Bacteria | 5500 |
| 609 | nmdc:mga08x19_1340125_c1 | 3300050514 | Bacteria | 507 |
| 610 | nmdc:mga08x19_16295_c1 | 3300050514 | Bacteria | 4530 |
| 611 | nmdc:mga0a205_264401_c1 | 3300050515 | Bacteria | 1598 |
| 612 | Ga0495601_0251946 | 3300053077 | Bacteria | 1153 |
| 613 | Ga0495595_0557049 | 3300053084 | Bacteria | 585 |
| 614 | Ga0495619_0147589 | 3300053085 | Unclassified | 1622 |
| 615 | Ga0436364_0212727 | |||
| 616 | Ga0058859_11530728 | |||
| 617 | Ga0058861_11368490 | |||
| 618 | Ga0058861_11646697 | |||
| 619 | Ga0058861_11938638 | |||
| 620 | Ga0058862_12668913 | |||
| 621 | Ga0058862_12741556 | |||
| 622 | Ga0070658_10247631 | |||
| 623 | Ga0070658_10778311 | |||
| 624 | Ga0070658_11605699 | |||
| 625 | Ga0070676_10367922 | |||
| 626 | Ga0070676_11228428 | |||
| 627 | Ga0070683_100000008 | |||
| 628 | Ga0070683_100078161 | |||
| 629 | Ga0070683_100106047 | |||
| 630 | Ga0070683_100285155 | |||
| 631 | Ga0070683_100588838 | |||
| 632 | Ga0070683_100784784 | |||
| 633 | Ga0070683_101907295 | |||
| 634 | Ga0070683_101934439 | |||
| 635 | Ga0070683_102100315 | |||
| 636 | Ga0070683_102452130 | |||
| 637 | Ga0070690_101658229 | |||
| 638 | Ga0070670_100762170 | |||
| 639 | Ga0070670_100856344 | |||
| 640 | Ga0070670_101258437 | |||
| 641 | Ga0070670_101345311 | |||
| 642 | Ga0070670_101443294 | |||
| 643 | Ga0070677_10555126 | |||
| 644 | Ga0068869_100209514 | |||
| 645 | Ga0068869_100648768 | |||
| 646 | Ga0070666_10229563 | |||
| 647 | Ga0070666_10354796 | |||
| 648 | Ga0070666_10572116 | |||
| 649 | Ga0070680_101993009 | |||
| 650 | Ga0070682_100180756 | |||
| 651 | Ga0070682_101803337 | |||
| 652 | Ga0068868_101057152 | |||
| 653 | Ga0068868_101172964 | |||
| 654 | Ga0070689_100050807 | |||
| 655 | Ga0070661_101857427 | |||
| 656 | Ga0070668_100342557 | |||
| 657 | Ga0070669_100297992 | |||
| 658 | Ga0070669_101270639 | |||
| 659 | Ga0070675_102161785 | |||
| 660 | Ga0070671_100613779 | |||
| 661 | Ga0070674_100258147 | |||
| 662 | Ga0070673_100308203 | |||
| 663 | Ga0070673_102392814 | |||
| 664 | Ga0070688_100982688 | |||
| 665 | Ga0070688_101482617 | |||
| 666 | Ga0070659_101117636 | |||
| 667 | Ga0070667_100546062 | |||
| 668 | Ga0070703_10048516 | |||
| 669 | Ga0070709_10473394 | |||
| 670 | Ga0070709_10608713 | |||
| 671 | Ga0070709_11320339 | |||
| 672 | Ga0070714_100001865 | |||
| 673 | Ga0070713_100004733 | |||
| 674 | Ga0070713_100006834 | |||
| 675 | Ga0070713_100038960 | |||
| 676 | Ga0070713_100578911 | |||
| 677 | Ga0070713_100825875 | |||
| 678 | Ga0070713_100865741 | |||
| 679 | Ga0070713_101403976 | |||
| 680 | Ga0070710_10701887 | |||
| 681 | Ga0070711_100039075 | |||
| 682 | Ga0070711_100067335 | |||
| 683 | Ga0070711_100200656 | |||
| 684 | Ga0070711_100292203 | |||
| 685 | Ga0070705_100352088 | |||
| 686 | Ga0070705_101218164 | |||
| 687 | Ga0070694_100129761 | |||
| 688 | Ga0070694_100791705 | |||
| 689 | Ga0070694_101395289 | |||
| 690 | Ga0070694_101476607 | |||
| 691 | Ga0070708_100240383 | |||
| 692 | Ga0070708_100509083 | |||
| 693 | Ga0070708_100608102 | |||
| 694 | Ga0070708_100708125 | |||
| 695 | Ga0070708_100743060 | |||
| 696 | Ga0070708_101274304 | |||
| 697 | Ga0070681_10003424 | |||
| 698 | Ga0070681_10173619 | |||
| 699 | Ga0070681_11465344 | |||
| 700 | Ga0068867_100859587 | |||
| 701 | Ga0068867_101727086 | |||
| 702 | Ga0070706_100004126 | |||
| 703 | Ga0070706_100102052 | |||
| 704 | Ga0070707_100004479 | |||
| 705 | Ga0070707_100091249 | |||
| 706 | Ga0070707_100852731 | |||
| 707 | Ga0070707_101137267 | |||
| 708 | Ga0070698_100013772 | |||
| 709 | Ga0070698_100394927 | |||
| 710 | Ga0070699_100010462 | |||
| 711 | Ga0070699_100021996 | |||
| 712 | Ga0070699_100428360 | |||
| 713 | Ga0070699_100625563 | |||
| 714 | Ga0070699_101168911 | |||
| 715 | Ga0070699_101442518 | |||
| 716 | Ga0070684_100000002 | |||
| 717 | Ga0070684_100083420 | |||
| 718 | Ga0070684_100099123 | |||
| 719 | Ga0070697_100438208 | |||
| 720 | Ga0070697_100583370 | |||
| 721 | Ga0070697_100917039 | |||
| 722 | Ga0068853_100774308 | |||
| 723 | Ga0070672_101669448 | |||
| 724 | Ga0070686_100897625 | |||
| 725 | Ga0070695_100045336 | |||
| 726 | Ga0070695_100234855 | |||
| 727 | Ga0070695_100692876 | |||
| 728 | Ga0070696_100001970 | |||
| 729 | Ga0070696_101132018 | |||
| 730 | Ga0070665_100113476 | |||
| 731 | Ga0070665_100594381 | |||
| 732 | Ga0070665_100740813 | |||
| 733 | Ga0070665_101272366 | |||
| 734 | Ga0070665_102355495 | |||
| 735 | Ga0070704_100095651 | |||
| 736 | Ga0070704_100363387 | |||
| 737 | Ga0070704_100761769 | |||
| 738 | Ga0068855_100833928 | |||
| 739 | Ga0068855_101770161 | |||
| 740 | Ga0068856_100443170 | |||
| 741 | Ga0068856_100988266 | |||
| 742 | Ga0070702_101734057 | |||
| 743 | Ga0070702_101851128 | |||
| 744 | Ga0068852_100184240 | |||
| 745 | Ga0068852_100278828 | |||
| 746 | Ga0068852_101775886 | |||
| 747 | Ga0068852_101815335 | |||
| 748 | Ga0068859_100230538 | |||
| 749 | Ga0068859_100890955 | |||
| 750 | Ga0068864_100158580 | |||
| 751 | Ga0068864_100558001 | |||
| 752 | Ga0068864_102560904 | |||
| 753 | Ga0068866_11126773 | |||
| 754 | Ga0068861_101595699 | |||
| 755 | Ga0068851_10257713 | |||
| 756 | Ga0068863_100150771 | |||
| 757 | Ga0068863_100320115 | |||
| 758 | Ga0068863_100423182 | |||
| 759 | Ga0068863_100941645 | |||
| 760 | Ga0068863_101192434 | |||
| 761 | Ga0068858_100161171 | |||
| 762 | Ga0068858_100255060 | |||
| 763 | Ga0068858_101296544 | |||
| 764 | Ga0068858_102543874 | |||
| 765 | Ga0068860_100013772 | |||
| 766 | Ga0068860_100802316 | |||
| 767 | Ga0068860_101149992 | |||
| 768 | Ga0068862_100258869 | |||
| 769 | Ga0081455_10090065 | |||
| 770 | Ga0081539_10125248 | |||
| 771 | Ga0070717_10118673 | |||
| 772 | Ga0070717_10518443 | |||
| 773 | Ga0070717_10675492 | |||
| 774 | Ga0070717_10945222 | |||
| 775 | Ga0070717_12001756 | |||
| 776 | Ga0070715_10192200 | |||
| 777 | Ga0070715_10652770 | |||
| 778 | Ga0070716_100331545 | |||
| 779 | Ga0070716_101537895 | |||
| 780 | Ga0070712_100617293 | |||
| 781 | Ga0070712_101310340 | |||
| 782 | Ga0097621_100038868 | |||
| 783 | Ga0097621_100282377 | |||
| 784 | Ga0097621_100855089 | |||
| 785 | Ga0097621_102279318 | |||
| 786 | Ga0097621_102361114 | |||
| 787 | Ga0068871_100023635 | |||
| 788 | Ga0068871_100694306 | |||
| 789 | Ga0068871_101232954 | |||
| 790 | Ga0068871_101495811 | |||
| 791 | Ga0075428_100010331 | |||
| 792 | Ga0075430_100023351 | |||
| 793 | Ga0075433_10642309 | |||
| 794 | Ga0075433_10710063 | |||
| 795 | Ga0075433_10957751 | |||
| 796 | Ga0075433_11441863 | |||
| 797 | Ga0075434_100117627 | |||
| 798 | Ga0075434_100158521 | |||
| 799 | Ga0075434_100240976 | |||
| 800 | Ga0075434_100436187 | |||
| 801 | Ga0075434_101425687 | |||
| 802 | Ga0075434_101552650 | |||
| 803 | Ga0075429_100005666 | |||
| 804 | Ga0075429_100429363 | |||
| 805 | Ga0068865_100528230 | |||
| 806 | Ga0075436_100002134 | |||
| 807 | Ga0075436_100141375 | |||
| 808 | Ga0097620_100230531 | |||
| 809 | Ga0097620_100890850 | |||
| 810 | Ga0075435_100340064 | |||
| 811 | Ga0075435_101954886 | |||
| 812 | Ga0099794_10767714 | |||
| 813 | Ga0105240_10003870 | |||
| 814 | Ga0105240_10005171 | |||
| 815 | Ga0105240_10037297 | |||
| 816 | Ga0105240_10609177 | |||
| 817 | Ga0105240_11084974 | |||
| 818 | Ga0105245_10160527 | |||
| 819 | Ga0105245_10162783 | |||
| 820 | Ga0105245_12075950 | |||
| 821 | Ga0105247_11194600 | |||
| 822 | Ga0114129_10028718 | |||
| 823 | Ga0114129_10033666 | |||
| 824 | Ga0114129_10397764 | |||
| 825 | Ga0114129_10533653 | |||
| 826 | Ga0105241_10396939 | |||
| 827 | Ga0105241_10703967 | |||
| 828 | Ga0105241_12480877 | |||
| 829 | Ga0105242_10806193 | |||
| 830 | Ga0105242_11178652 | |||
| 831 | Ga0105242_11455595 | |||
| 832 | Ga0105248_10348518 | |||
| 833 | Ga0105248_10354081 | |||
| 834 | Ga0105248_10427244 | |||
| 835 | Ga0105248_12049034 | |||
| 836 | Ga0105237_10027300 | |||
| 837 | Ga0105237_10034703 | |||
| 838 | Ga0105237_10747694 | |||
| 839 | Ga0105238_10264150 | |||
| 840 | Ga0105238_10503920 | |||
| 841 | Ga0105249_12109496 | |||
| 842 | Ga0105239_10724623 | |||
| 843 | Ga0105246_10260657 | |||
| 844 | Ga0105246_11531669 | |||
| 845 | Ga0157370_11342918 | |||
| 846 | Ga0157369_10085114 | |||
| 847 | Ga0157369_10113891 | |||
| 848 | Ga0157369_10253541 | |||
| 849 | Ga0157369_10413331 | |||
| 850 | Ga0157374_10455548 | |||
| 851 | Ga0157374_12192065 | |||
| 852 | Ga0157378_10026687 | |||
| 853 | Ga0157378_10187190 | |||
| 854 | Ga0157378_10289685 | |||
| 855 | Ga0157378_10800977 | |||
| 856 | Ga0157378_10997131 | |||
| 857 | Ga0157378_11851232 | |||
| 858 | Ga0163162_10439964 | |||
| 859 | Ga0163162_11152398 | |||
| 860 | Ga0163162_11554522 | |||
| 861 | Ga0157372_10972437 | |||
| 862 | Ga0157372_11025837 | |||
| 863 | Ga0157372_12246148 | |||
| 864 | Ga0157372_12689159 | |||
| 865 | Ga0157375_11193493 | |||
| 866 | Ga0157375_13046514 | |||
| 867 | Ga0163163_10062107 | |||
| 868 | Ga0163163_10441772 | |||
| 869 | Ga0157379_10277485 | |||
| 870 | Ga0157379_10910779 | |||
| 871 | Ga0157379_11021708 | |||
| 872 | Ga0157379_11558139 | |||
| 873 | Ga0157376_10331443 | |||
| 874 | Ga0157376_10472159 | |||
| 875 | Ga0157376_10712240 | |||
| 876 | Ga0157376_11267960 | |||
| 877 | Ga0157376_12114165 | |||
| 878 | Ga0163161_10565000 | |||
| 879 | Ga0197907_10515109 | |||
| 880 | Ga0206355_1415746 | |||
| 881 | Ga0206355_1548908 | |||
| 882 | Ga0206352_10002734 | |||
| 883 | Ga0206352_10389846 | |||
| 884 | Ga0213876_10210412 | |||
| 885 | Ga0213875_10028082 | |||
| 886 | Ga0224712_10031167 | |||
| 887 | Ga0224712_10187212 | |||
| 888 | Ga0207653_10012107 | |||
| 889 | Ga0207680_10209935 | |||
| 890 | Ga0207685_10253190 | |||
| 891 | Ga0207685_10384553 | |||
| 892 | Ga0207645_11190053 | |||
| 893 | Ga0207643_10503499 | |||
| 894 | Ga0207705_10223709 | |||
| 895 | Ga0207684_10004973 | |||
| 896 | Ga0207684_10029493 | |||
| 897 | Ga0207654_10592884 | |||
| 898 | Ga0207654_10606877 | |||
| 899 | Ga0207707_10021404 | |||
| 900 | Ga0207707_10133977 | |||
| 901 | Ga0207695_10004029 | |||
| 902 | Ga0207695_10014070 | |||
| 903 | Ga0207695_10389484 | |||
| 904 | Ga0207695_10401164 | |||
| 905 | Ga0207695_10546389 | |||
| 906 | Ga0207671_10014573 | |||
| 907 | Ga0207671_10165940 | |||
| 908 | Ga0207671_10416952 | |||
| 909 | Ga0207693_10688895 | |||
| 910 | Ga0207693_10722205 | |||
| 911 | Ga0207663_10046686 | |||
| 912 | Ga0207657_10141862 | |||
| 913 | Ga0207652_10207013 | |||
| 914 | Ga0207646_10005837 | |||
| 915 | Ga0207646_11236047 | |||
| 916 | Ga0207681_11810758 | |||
| 917 | Ga0207694_10261094 | |||
| 918 | Ga0207694_10273710 | |||
| 919 | Ga0207694_11117147 | |||
| 920 | Ga0207650_10724704 | |||
| 921 | Ga0207687_10138228 | |||
| 922 | Ga0207687_11891608 | |||
| 923 | Ga0207700_10005089 | |||
| 924 | Ga0207700_10005599 | |||
| 925 | Ga0207700_10544865 | |||
| 926 | Ga0207700_10668099 | |||
| 927 | Ga0207700_10813255 | |||
| 928 | Ga0207664_10000970 | |||
| 929 | Ga0207664_10560123 | |||
| 930 | Ga0207644_11552302 | |||
| 931 | Ga0207690_11500671 | |||
| 932 | Ga0207686_10330682 | |||
| 933 | Ga0207686_10371121 | |||
| 934 | Ga0207669_10409674 | |||
| 935 | Ga0207704_10954074 | |||
| 936 | Ga0207665_10212083 | |||
| 937 | Ga0207665_11197890 | |||
| 938 | Ga0207691_10736023 | |||
| 939 | Ga0207711_10075778 | |||
| 940 | Ga0207711_10193965 | |||
| 941 | Ga0207711_10359995 | |||
| 942 | Ga0207711_10845724 | |||
| 943 | Ga0207711_11071957 | |||
| 944 | Ga0207689_10452862 | |||
| 945 | Ga0207661_10000008 | |||
| 946 | Ga0207661_10076445 | |||
| 947 | Ga0207661_10107153 | |||
| 948 | Ga0207661_11539240 | |||
| 949 | Ga0207661_12119372 | |||
| 950 | Ga0207667_10701224 | |||
| 951 | Ga0207668_10521983 | |||
| 952 | Ga0207658_10535508 | |||
| 953 | Ga0207658_11531144 | |||
| 954 | Ga0207703_11311588 | |||
| 955 | Ga0207639_10359308 | |||
| 956 | Ga0207708_11235556 | |||
| 957 | Ga0207702_11375361 | |||
| 958 | Ga0207641_10152649 | |||
| 959 | Ga0207641_10429362 | |||
| 960 | Ga0207641_10528678 | |||
| 961 | Ga0207676_10137831 | |||
| 962 | Ga0207675_102510587 | |||
| 963 | Ga0207683_10759006 | |||
| 964 | Ga0207683_10807106 | |||
| 965 | Ga0207428_10609184 | |||
| 966 | Ga0268266_10330279 | |||
| 967 | Ga0268266_10896109 | |||
| 968 | Ga0268265_10251582 | |||
| 969 | Ga0268264_10010520 | |||
| 970 | Ga0268264_11392198 | |||
| 971 | Ga0265323_10000589 | |||
| 972 | Ga0265336_10028362 | |||
| 973 | Ga0265336_10177824 | |||
| 974 | Ga0265338_10057621 | |||
| 975 | Ga0265762_1019006 | |||
| 976 | Ga0265760_10266160 | |||
| 977 | Ga0265330_10016635 | |||
| 978 | Ga0265330_10168206 | |||
| 979 | Ga0265330_10188985 | |||
| 980 | Ga0265332_10054697 | |||
| 981 | Ga0265328_10014121 | |||
| 982 | Ga0265320_10041477 | |||
| 983 | Ga0265320_10252759 | |||
| 984 | Ga0265329_10039317 | |||
| 985 | Ga0265340_10053499 | |||
| 986 | Ga0265340_10108927 | |||
| 987 | Ga0265340_10402910 | |||
| 988 | Ga0265339_10035968 | |||
| 989 | Ga0265331_10019862 | |||
| 990 | Ga0265331_10092875 | |||
| 991 | Ga0265331_10403255 | |||
| 992 | Ga0265316_10001880 | |||
| 993 | Ga0265316_10021831 | |||
| 994 | Ga0265316_10037791 | |||
| 995 | Ga0265316_10049924 | |||
| 996 | Ga0265316_10060472 | |||
| 997 | Ga0265316_10094230 | |||
| 998 | Ga0265316_10268485 | |||
| 999 | Ga0265316_10270943 | |||
| 1000 | Ga0265316_10534046 | |||
| 1001 | Ga0265316_10826262 | |||
| 1002 | Ga0265313_10342125 | |||
| 1003 | Ga0265314_10003050 | |||
| 1004 | Ga0265314_10051013 | |||
| 1005 | Ga0265314_10243363 | |||
| 1006 | Ga0265314_10654260 | |||
| 1007 | Ga0265342_10072664 | |||
| 1008 | Ga0265342_10098716 | |||
| 1009 | Ga0265342_10486002 | |||
| 1010 | Ga0265342_10646857 | |||
| 1011 | Ga0265342_10700086 | |||
| 1012 | Ga0316576_10057678 | |||
| 1013 | Ga0316576_10367621 | |||
| 1014 | Ga0316578_10658520 | |||
| 1015 | Ga0316577_10006621 | |||
| 1016 | Ga0307406_10323509 | |||
| 1017 | Ga0307409_101549554 | |||
| 1018 | Ga0307416_101018178 | |||
| 1019 | Ga0307416_103522270 | |||
| 1020 | Ga0307411_11354734 | |||
| 1021 | Ga0316585_10285614 | |||
| 1022 | Ga0316596_1231439 | |||
| 1023 | Ga0373934_0188370 | |||
| 1024 | Ga0373934_0400539 | |||
| 1025 | Ga0373944_0335918 | |||
| 1026 | Ga0373923_0019318 | |||
| 1027 | Ga0373923_0131634 | |||
| 1028 | Ga0373923_0528062 | |||
| 1029 | Ga0373936_0245118 | |||
| 1030 | Ga0373936_0420005 | |||
| 1031 | Ga0373945_0104651 | |||
| 1032 | Ga0373953_0127086 | |||
| 1033 | Ga0373954_0103721 | |||
| 1034 | Ga0373954_0105815 | |||
| 1035 | Ga0373956_0085628 | |||
| 1036 | Ga0373957_0360401 | |||
| 1037 | Ga0373957_0366319 | |||
| 1038 | Ga0373943_0006932 | |||
| 1039 | Ga0373943_0155456 | |||
| 1040 | Ga0373943_0224307 | |||
| 1041 | Ga0373943_0258464 | |||
| 1042 | Ga0373955_0007578 | |||
| 1043 | Ga0373955_0165892 | |||
| 1044 | Ga0373955_0219361 | |||
| 1045 | Ga0373955_0243068 | |||
| 1046 | Ga0373955_0690928 | |||
| 1047 | Ga0316574_0277803 | |||
| 1048 | Ga0316574_0784332 | |||
| 1049 | Ga0373935_0006632 | |||
| 1050 | Ga0373935_0164526 | |||
| 1051 | Ga0373935_0734018 | |||
| 1052 | Ga0373935_1315575 | |||
| 1053 | Ga0373927_0000378 | |||
| 1054 | Ga0373927_0053422 | |||
| 1055 | Ga0373927_0493284 | |||
| 1056 | Ga0373933_0425654 | |||
| 1057 | Ga0373933_0783402 | |||
| 1058 | Ga0373933_0983515 | |||
| 1059 | Ga0373947_0083417 | |||
| 1060 | Ga0373947_0230910 | |||
| 1061 | Ga0373947_0833703 | |||
| 1062 | Ga0373947_0904240 | |||
| 1063 | Ga0373947_1244254 | |||
| 1064 | Ga0373937_0014121 | |||
| 1065 | Ga0373937_0061081 | |||
| 1066 | Ga0373937_0074832 | |||
| 1067 | Ga0373937_0122729 | |||
| 1068 | Ga0373937_0125500 | |||
| 1069 | Ga0373937_0270373 | |||
| 1070 | Ga0373937_0379345 | |||
| 1071 | Ga0373937_0494224 | |||
| 1072 | Ga0373937_1042163 | |||
| 1073 | Ga0373937_1042847 | |||
| 1074 | Ga0265778_026025 | |||
| 1075 | Ga0265778_067284 | |||
| 1076 | Ga0316582_0105423 | |||
| 1077 | Ga0316582_0561413 | |||
| 1078 | Ga0316584_0052484 | |||
| 1079 | Ga0373925_0043565 | |||
| 1080 | Ga0373925_0200747 | |||
| 1081 | Ga0373925_0362648 | |||
| 1082 | Ga0373925_0415043 | |||
| 1083 | Ga0373925_0574430 | |||
| 1084 | Ga0373925_0721137 | |||
| 1085 | Ga0395900_1913945 | |||
| 1086 | Ga0395905_0576770 | |||
| 1087 | Ga0436364_1082106 | |||
| 1088 | Ga0436364_1560354 | |||
| 1089 | Ga0436365_0090871 | |||
| 1090 | Ga0436365_1649063 | |||
| 1091 | Ga0436365_1712753 | |||
| 1092 | Ga0436362_0822382 | |||
| 1093 | Ga0451839_0113558 | |||
| 1094 | Ga0466963_0263467 | |||
| 1095 | Ga0451576_0313350 | |||
| 1096 | Ga0451576_0347972 | |||
| 1097 | Ga0451576_0382638 | |||
| 1098 | Ga0451576_0885808 | |||
| 1099 | Ga0466958_0145803 | |||
| 1100 | Ga0495592_0077000 | |||
| 1101 | Ga0495592_0341926 | |||
| 1102 | Ga0495603_0631731 | |||
| 1103 | Ga0495629_0234113 | |||
| 1104 | Ga0495629_0485254 | |||
| 1105 | Ga0495629_0604167 | |||
| 1106 | Ga0495651_0012118 | |||
| 1107 | Ga0495653_0115061 | |||
| 1108 | Ga0495653_0269500 | |||
| 1109 | Ga0495580_0017307 | |||
| 1110 | Ga0495580_0033811 | |||
| 1111 | Ga0495580_0073198 | |||
| 1112 | Ga0495580_0390805 | |||
| 1113 | Ga0495582_0354580 | |||
| 1114 | Ga0495582_0413079 | |||
| 1115 | Ga0495639_0288820 | |||
| 1116 | Ga0495639_0414372 | |||
| 1117 | Ga0495662_0015805 | |||
| 1118 | Ga0495662_0543001 | |||
| 1119 | Ga0495664_0108206 | |||
| 1120 | Ga0495608_0773399 | |||
| 1121 | Ga0495618_0084846 | |||
| 1122 | Ga0495618_0261448 | |||
| 1123 | Ga0495628_0086091 | |||
| 1124 | Ga0495630_0022356 | |||
| 1125 | Ga0495666_0145310 | |||
| 1126 | Ga0495642_0124157 | |||
| 1127 | Ga0495642_0508649 | |||
| 1128 | Ga0495652_0034391 | |||
| 1129 | Ga0495654_0432077 | |||
| 1130 | Ga0495665_0065176 | |||
| 1131 | Ga0495665_0171896 | |||
| 1132 | Ga0495640_0099357 | |||
| 1133 | Ga0495640_0167765 | |||
| 1134 | Ga0495586_0609417 | |||
| 1135 | Ga0495587_0084992 | |||
| 1136 | Ga0495587_0236643 | |||
| 1137 | Ga0495645_0030836 | |||
| 1138 | Ga0495645_0068838 | |||
| 1139 | Ga0495645_0580977 | |||
| 1140 | Ga0495667_0055425 | |||
| 1141 | Ga0495667_0210321 | |||
| 1142 | Ga0495634_0056896 | |||
| 1143 | Ga0495634_0382828 | |||
| 1144 | Ga0495635_0070641 | |||
| 1145 | Ga0495635_0176209 | |||
| 1146 | Ga0495635_0439099 | |||
| 1147 | Ga0495635_1034024 | |||
| 1148 | Ga0495657_0464450 | |||
| 1149 | Ga0495599_0019002 | |||
| 1150 | Ga0495599_0207596 | |||
| 1151 | Ga0495599_0413600 | |||
| 1152 | Ga0495623_0040082 | |||
| 1153 | Ga0495623_0060758 | |||
| 1154 | Ga0495623_0104834 | |||
| 1155 | Ga0495623_0133988 | |||
| 1156 | Ga0495623_0176719 | |||
| 1157 | Ga0495623_0674728 | |||
| 1158 | Ga0495646_0141089 | |||
| 1159 | Ga0495647_0220005 | |||
| 1160 | Ga0495658_0026815 | |||
| 1161 | Ga0495658_0063066 | |||
| 1162 | Ga0495658_0142347 | |||
| 1163 | Ga0495658_0317875 | |||
| 1164 | Ga0495613_0114414 | |||
| 1165 | Ga0495613_0239603 | |||
| 1166 | Ga0495613_1013732 | |||
| 1167 | Ga0495604_0034758 | |||
| 1168 | Ga0495604_0102250 | |||
| 1169 | Ga0495604_0106906 | |||
| 1170 | Ga0495636_0049886 | |||
| 1171 | Ga0495674_0028929 | |||
| 1172 | Ga0495674_0037262 | |||
| 1173 | Ga0495674_0117155 | |||
| 1174 | Ga0495674_0337517 | |||
| 1175 | Ga0495674_0930258 | |||
| 1176 | Ga0495674_1183950 | |||
| 1177 | Ga0495680_0148763 | |||
| 1178 | Ga0495675_0074143 | |||
| 1179 | Ga0495675_0288526 | |||
| 1180 | Ga0495684_0010917 | |||
| 1181 | Ga0495684_0063572 | |||
| 1182 | Ga0495684_0086547 | |||
| 1183 | Ga0495684_0318648 | |||
| 1184 | Ga0495684_0424594 | |||
| 1185 | Ga0495684_0534122 | |||
| 1186 | Ga0495684_0801534 | |||
| 1187 | Ga0495602_0166255 | |||
| 1188 | Ga0495602_0172685 | |||
| 1189 | Ga0495614_0214149 | |||
| 1190 | Ga0496100_0134132 | |||
| 1191 | Ga0496101_0000804 | |||
| 1192 | Ga0496101_0919366 | |||
| 1193 | Ga0496102_0588402 | |||
| 1194 | Ga0496104_0057520 | |||
| 1195 | Ga0496105_0119484 | |||
| 1196 | Ga0496106_0261992 | |||
| 1197 | Ga0496107_0027201 | |||
| 1198 | Ga0496108_1683387 | |||
| 1199 | Ga0496114_0001096 | |||
| 1200 | Ga0501310_069184 | |||
| 1201 | Ga0501316_014636 | |||
| 1202 | Ga0501321_084558 | |||
| 1203 | Ga0501325_029243 | |||
| 1204 | Ga0501041_0367400 | |||
| 1205 | Ga0501079_0481772 | |||
| 1206 | Ga0501263_019490 | |||
| 1207 | Ga0501045_0214145 | |||
| 1208 | Ga0501045_1257537 | |||
| 1209 | Ga0501045_1306131 | |||
| 1210 | nmdc:mga05p37_253177_c1 | |||
| 1211 | nmdc:mga05p37_457944_c1 | |||
| 1212 | nmdc:mga05p37_846874_c1 | |||
| 1213 | nmdc:mga05p37_956583_c1 | |||
| 1214 | nmdc:mga09592_418786_c1 | |||
| 1215 | nmdc:mga09592_66644_c1 | |||
| 1216 | nmdc:mga0qj67_62052_c1 | |||
| 1217 | nmdc:mga08y16_1386511_c1 | |||
| 1218 | nmdc:mga0n895_1516912_c1 | |||
| 1219 | nmdc:mga0n895_170939_c1 | |||
| 1220 | nmdc:mga0n895_181606_c1 | |||
| 1221 | nmdc:mga0n895_436349_c1 | |||
| 1222 | nmdc:mga08x19_10758_c1 | |||
| 1223 | nmdc:mga08x19_1340125_c1 | |||
| 1224 | nmdc:mga08x19_16295_c1 | |||
| 1225 | nmdc:mga0a205_264401_c1 | |||
| 1226 | Ga0495601_0251946 | |||
| 1227 | Ga0495595_0557049 | |||
| 1228 | Ga0495619_0147589 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy