metagRoot

F469344

General Info

Members	Datasets	Scaffolds	Average Seq Length
614	300	501	80

Family's Representative Sequence

Representative Sequence	3300006914\|Ga0075436_100788230\|Ga0075436_1007882302
Length	83
Sequence	MTIYVQVQFFARFRETLGIESERLEGTFATVDAVRQHLLQRGGVWDVLSEQSIMCARNQELCSLSEPLEQGDEVAFFPTVTGG

Samples

	Sample ID	Description	Type	Environment
1	2124908027	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1	Metagenome	Rhizosphere
2	2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1	Metagenome	Rhizosphere
3	2162886011	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
4	2510065053	Pseudomonas sp. MOIL14HWK12:I1	Isolate	Rhizosphere
5	2510065055	Pseudomonas sp. MOIL14HWK12:I2	Isolate	Rhizosphere
6	2510065058	Pseudomonas oleovorans MOIL14HWK12	Isolate	Rhizosphere
7	2511231006	Pseudomonas sp. GM17	Isolate	Nodule
8	2511231021	Pseudomonas sp. GM78	Isolate	Nodule
9	2511231156	Pseudomonas ogarae F113	Isolate	Rhizosphere
10	2512047018	Pseudomonas chlororaphis chlororaphis GP72	Isolate	Rhizosphere
11	2554235132	Pseudomonas aeruginosa PGPR2	Isolate	Unclassified
12	2582580891	Pseudomonas chlororaphis YL-1	Isolate	Unclassified
13	2597489887	Pseudomonas chlororaphis aureofaciens 30-84	Isolate	Rhizosphere
14	2599185185	Pseudomonas sp. NFPP07	Isolate	Rhizoplane
15	2599185188	Pseudomonas sp. NFACC45	Isolate	Rhizoplane
16	2599185248	Pseudomonas sp. NFACC08-1	Isolate	Rhizoplane
17	2599185257	Pseudomonas sp. NFACC41-3	Isolate	Rhizoplane
18	2599185289	Pseudomonas sp. NFACC51	Isolate	Rhizoplane
19	2599185291	Pseudomonas sp. NFACC48-1	Isolate	Rhizoplane
20	2599185300	Pseudomonas sp. NFACC39-1	Isolate	Rhizoplane
21	2599185305	Pseudomonas sp. NFACC07-1	Isolate	Rhizoplane
22	2599185306	Pseudomonas sp. NFACC16-2	Isolate	Rhizoplane
23	2599185307	Pseudomonas sp. NFACC02	Isolate	Rhizoplane
24	2599185308	Pseudomonas sp. NFACC17-2	Isolate	Rhizoplane
25	2599185311	Pseudomonas sp. NFACC04-2	Isolate	Rhizoplane
26	2599185313	Pseudomonas sp. NFACC05-1	Isolate	Rhizoplane
27	2599185314	Pseudomonas sp. NFACC23-1	Isolate	Rhizoplane
28	2599185315	Pseudomonas sp. NFACC44-2	Isolate	Rhizoplane
29	2599185316	Pseudomonas sp. NFACC52	Isolate	Rhizoplane
30	2599185317	Pseudomonas sp. NFACC06-1	Isolate	Rhizoplane
31	2599185319	Pseudomonas sp. NFACC24-1	Isolate	Rhizoplane
32	2599185321	Pseudomonas sp. NFACC54	Isolate	Rhizoplane
33	2599185323	Pseudomonas sp. NFACC37-1	Isolate	Rhizoplane
34	2599185324	Pseudomonas sp. NFACC46-3	Isolate	Rhizoplane
35	2599185325	Pseudomonas sp. NFACC56-3	Isolate	Rhizoplane
36	2600254930	Pseudomonas sp. NFIX10	Isolate	Rhizoplane
37	2600254954	Pseudomonas sp. NFACC19-2	Isolate	Rhizoplane
38	2600255283	Pseudomonas sp. NFR16	Isolate	Rhizoplane
39	2600255318	Pseudomonas putida NFIX47	Isolate	Rhizoplane
40	2600255389	Pseudomonas sp. NFPP33	Isolate	Rhizoplane
41	2603880185	Pseudomonas sp. NFIX46	Isolate	Rhizoplane
42	2603880199	Pseudomonas sp. NFIX49	Isolate	Rhizoplane
43	2606217733	Pseudomonas aeruginosa NFHH01	Isolate	Rhizoplane
44	2623620443	Pseudomonas sp. DR 5-09	Isolate	Unclassified
45	2623620446	Pseudomonas sp. GR 6-02	Isolate	Unclassified
46	2643221565	Pseudomonas sp. Root562	Isolate	Unclassified
47	2643221650	Pseudomonas sp. Root401	Isolate	Unclassified
48	2651869719	Genome Sequence of Pseudomonas fluorescens UM270	Isolate	Rhizosphere
49	2667528170	Pseudomonas sp. NFACC50-1	Isolate	Rhizoplane
50	2667528176	Pseudomonas sp. NFACC11-2	Isolate	Rhizoplane
51	2671180172	Pseudomonas sp. NFIX51	Isolate	Rhizoplane
52	2675903515	Pseudomonas thivervalensis DSM 13194	Isolate	Unclassified
53	2713897149	Pseudomonas fluorescens SF4c	Isolate	Rhizosphere
54	2718217725	Pseudomonas fluorescens CREA-C16	Isolate	Rhizosphere
55	2728369097	Stutzerimonas balearica st101	Isolate	Unclassified
56	2738541271	Pseudomonas sp. GV021	Isolate	Unclassified
57	2738543016	Pseudomonas sp. GV012	Isolate	Unclassified
58	2740892503	Pseudomonas chlororaphis piscium PCL1391	Isolate	Unclassified
59	2744054620	Pseudomonas thivervalensis LMG 21626	Isolate	Unclassified
60	2773857672	Pseudomonas sp. 1766	Isolate	Unclassified
61	2784132063	Pseudomonas sp. 424	Isolate	Unclassified
62	2791355520	Pseudomonas sp. s211(2017)	Isolate	Unclassified
63	2808606361	Pseudomonas sp. SJZ075	Isolate	Rhizosphere
64	2808606376	Pseudomonas sp. SJZ074	Isolate	Rhizosphere
65	2808606378	Pseudomonas sp. SJZ078	Isolate	Rhizosphere
66	2808606380	Pseudomonas sp. SJZ085	Isolate	Rhizosphere
67	2808606383	Pseudomonas sp. SJZ124	Isolate	Rhizosphere
68	2808606389	Pseudomonas sp. SJZ101	Isolate	Rhizosphere
69	2808606445	Pseudomonas sp. SJZ131	Isolate	Rhizosphere
70	2811994881	Pseudomonas sp. SLBN-26	Isolate	Unclassified
71	2823421272	Pseudomonas mendocina S5.2	Isolate	Rhizoplane
72	2825651385	Pseudomonas brassicacearum L13-6-12	Isolate	Rhizosphere
73	2826581358	Pseudomonas viridiflava CDRTc14	Isolate	Unclassified
74	2842805378	Pseudomonas sp. R-72599	Isolate	Unclassified
75	2842815866	Pseudomonas sp. R-72210	Isolate	Unclassified
76	2842849001	Pseudomonas sp. R-72008	Isolate	Unclassified
77	2852657418	Pseudomonas sp. JAI115	Isolate	Rhizosphere
78	2878029506	Pseudomonas fluorescens DR397	Isolate	Rhizosphere
79	2880230671	Pseudomonas fluorescens LBUM677	Isolate	Unclassified
80	2913036834	Pseudomonas viciae 11K1	Isolate	Rhizosphere
81	2917832318	Pseudomonas rhizoryzae RY24	Isolate	Unclassified
82	2919063839	Pseudomonas pharyngis 1098	Isolate	Rhizosphere
83	2919125081	Pseudomonas psychrotolerans 1545	Isolate	Rhizosphere
84	2919481497	Pseudomonas brassicacearum 3432	Isolate	Unclassified
85	2919501602	Pseudomonas alcaliphila 3512	Isolate	Unclassified
86	2919688452	Pararheinheimera soli 4138	Isolate	Unclassified
87	2919697872	Pseudomonas frederiksbergensis 4169	Isolate	Unclassified
88	2923153595	Pseudomonas chlororaphis piscium PCL1391	Isolate	Unclassified
89	2923519811	Pseudomonas otitidis SLBN-103	Isolate	Rhizosphere
90	2923586266	Pseudomonas fluorescens 1550	Isolate	Rhizosphere
91	2926063275	Pseudomonas sp. 3400	Isolate	Unclassified
92	2929144301	Pseudomonas sp. R-71838 Hybrid assembly	Isolate	Unclassified
93	2931369376	Pseudomonas fluorescens DR133	Isolate	Rhizosphere
94	2931396565	Pseudomonas sp. DR48	Isolate	Rhizosphere
95	2974298342	Pseudomonas sp. SORGH_AS 211	Isolate	Unclassified
96	2984286254	Pseudomonas chlororaphis aurantiaca JD37	Isolate	Rhizosphere
97	2984499530	Pseudomonas sp. SORGH_AS199	Isolate	Aerial Root
98	2984504281	Pseudomonas psychrotolerans SORGH_AS201	Isolate	Aerial Root
99	2988728565	Pseudomonas corrugata RM1-1-4	Isolate	Rhizosphere
100	3007395558	Pseudomonas chlororaphis PCL1601	Isolate	Rhizosphere
101	3007419365	Pseudomonas vanderleydeniana RW8P3	Isolate	Unclassified
102	3007861166	Pseudomonas hamedanensis SWRI65	Isolate	Rhizosphere
103	3007866637	Pseudomonas marvdashtae SWRI102	Isolate	Rhizosphere
104	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
105	3300002771	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB	Metagenome	Endosphere
106	3300002772	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS	Metagenome	Endosphere
107	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
108	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
109	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
110	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
111	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
112	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
113	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
114	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
115	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
116	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
117	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
118	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
119	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
120	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
121	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
122	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
123	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
124	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
125	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
126	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
127	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
128	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
129	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
130	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
131	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
132	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
133	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
134	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
135	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
136	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
137	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
138	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
139	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
140	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
141	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
142	3300025207	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
143	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
144	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
145	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
146	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
147	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
148	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
149	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
150	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
151	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
160	3300027378	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300027395	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300027471	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300027526	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300027552	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300027614	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
168	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
170	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
171	3300030733	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2	Metagenome	Rhizosphere
172	3300030742	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9	Metagenome	Rhizosphere
173	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
174	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
175	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
176	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
177	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
178	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
179	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
180	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
181	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
182	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
183	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
184	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
185	3300041405	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414	Metagenome	Rhizosphere
186	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
187	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
188	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
189	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
190	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
191	3300042009	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348	Metagenome	Rhizosphere
192	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
193	3300042013	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339	Metagenome	Rhizosphere
194	3300042016	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357	Metagenome	Rhizosphere
195	3300042137	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519	Metagenome	Rhizosphere
196	3300042138	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379	Metagenome	Rhizosphere
197	3300042139	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442	Metagenome	Rhizosphere
198	3300042142	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610	Metagenome	Rhizosphere
199	3300042185	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592	Metagenome	Rhizosphere
200	3300042993	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372	Metagenome	Rhizosphere
201	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
202	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
203	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
204	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
205	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
206	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
207	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
208	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
209	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
210	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
211	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
212	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
213	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
214	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
215	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
216	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
217	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
218	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
219	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
220	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
221	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
222	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
223	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
224	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
225	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
226	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
227	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
228	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
229	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
230	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
231	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
232	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
233	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
234	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
235	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
236	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
237	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
238	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
239	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
240	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
241	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
242	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
243	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
244	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
245	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
246	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
247	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
248	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
249	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
250	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
251	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
252	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
253	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
254	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
255	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
256	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
257	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
258	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
259	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
260	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
261	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
262	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
263	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
264	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
265	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
266	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
267	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
268	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
269	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
270	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
271	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
272	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
273	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
274	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
275	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
276	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
277	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
278	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
279	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
280	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
281	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
282	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
283	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
284	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
285	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
286	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
287	3300053145	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere	Metagenome	Endosphere
288	640427133	Stutzerimonas stutzeri A1501	Isolate	Rhizosphere
289	651053060	Stutzerimonas stutzeri CMT.A.9	Isolate	Rhizosphere
290	8011350971	Pseudomonas sp. 30_B	Isolate	Rhizosphere
291	8015687852	Pseudomonas chlororaphis aurantiaca RP4	Isolate	Rhizosphere
292	8016728285	Pseudomonas psychrotolerans SORGH_AS 227	Isolate	Unclassified
293	8019769354	Pseudomonas sp. MSSRFD41	Isolate	Rhizosphere
294	8019775933	Pseudomonas sp. PvR083	Isolate	Rhizosphere
295	8034962539	Pseudomonas sediminis PI11	Isolate	Rhizosphere
296	8055770955	Pseudomonas chlororaphis qlu-1	Isolate	Rhizosphere
297	8056125926	Pseudomonas azerbaijanorientalis SWRI123	Isolate	Rhizosphere
298	8056166840	Pseudomonas triticicola SWRI88	Isolate	Rhizosphere
299	8056177738	Pseudomonas azerbaijanoccidentalis SWRI74	Isolate	Rhizosphere
300	8057798959	Pseudomonas piscis BW16M1	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	81.6
Metatranscriptomes	0
Isolates	18.4

Biome Distribution

Category	Percentage (%)
Aerial Root	0.33
Bulb	0
Endosphere	5.86
Nodule	0.65
Rhizoplane	7.17
Rhizosphere	75.57
Stem	0
Stem Tuber	0
Unclassified	10.42

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	MRS2a_Contig_26571	2124908027	Bacteria	1090
2	SwRhRL2b_contig_3933257	2162886007	Bacteria	1350
3	MRS1b_contig_5523328	2162886011	Bacteria	1079
4	JGI25162J39368_1000101	3300002737	Bacteria	94481
5	JGI25163J39215_1001598	3300002771	Bacteria	3425
6	JGI25164J39214_1000097	3300002772	Bacteria	87008
7	JGI25165J46597_1000184	3300003214	Bacteria	94481
8	Ga0055536_1000062	3300003781	Bacteria	99169
9	Ga0055536_1004291	3300003781	Bacteria	7347
10	Ga0055536_1004565	3300003781	Bacteria	7032
11	Ga0055536_1077112	3300003781	Bacteria	641
12	Ga0055530_10000489	3300003791	Bacteria	34449
13	Ga0055530_10001123	3300003791	Bacteria	20903
14	Ga0055530_10001872	3300003791	Bacteria	14468
15	Ga0055540_1000512	3300003792	Bacteria	29296
16	Ga0055540_1000517	3300003792	Bacteria	29219
17	Ga0055540_1001386	3300003792	Bacteria	14468
18	Ga0055531_10000707	3300003794	Bacteria	28425
19	Ga0065714_10065211	3300005288	Bacteria	11846
20	Ga0065714_10084209	3300005288	Bacteria	2210
21	Ga0065714_10092360	3300005288	Bacteria	1880
22	Ga0065714_10193953	3300005288	Bacteria	918
23	Ga0065714_10412708	3300005288	Bacteria	581
24	Ga0065704_10074001	3300005289	Bacteria	6607
25	Ga0065704_10319196	3300005289	Bacteria	834
26	Ga0065704_10418785	3300005289	Bacteria	734
27	Ga0065712_10068146	3300005290	Bacteria	13871
28	Ga0070660_101049080	3300005339	Bacteria	689
29	Ga0070659_100492437	3300005366	Bacteria	1044
30	Ga0070662_100093553	3300005457	Bacteria	2261
31	Ga0070665_101498912	3300005548	Bacteria	683
32	Ga0075364_10116547	3300006051	Bacteria	1786
33	Ga0075432_10003100	3300006058	Bacteria	5609
34	Ga0075436_100788230	3300006914	Bacteria	707
35	Ga0079104_1000168	3300006946	Bacteria	93546
36	Ga0105251_10002077	3300009011	Bacteria	16166
37	Ga0105251_10002689	3300009011	Bacteria	13662
38	Ga0105251_10006770	3300009011	Bacteria	7231
39	Ga0105251_10016448	3300009011	Bacteria	3995
40	Ga0105251_10018937	3300009011	Bacteria	3648
41	Ga0105251_10066130	3300009011	Bacteria	1691
42	Ga0105251_10081560	3300009011	Bacteria	1495
43	Ga0105251_10598818	3300009011	Bacteria	523
44	Ga0105244_10008044	3300009036	Bacteria	6630
45	Ga0105244_10008373	3300009036	Bacteria	6463
46	Ga0105244_10011694	3300009036	Bacteria	5240
47	Ga0105244_10018004	3300009036	Bacteria	3976
48	Ga0105244_10041374	3300009036	Bacteria	2388
49	Ga0105244_10068511	3300009036	Bacteria	1773
50	Ga0105244_10087607	3300009036	Bacteria	1534
51	Ga0105244_10095250	3300009036	Bacteria	1461
52	Ga0105244_10298524	3300009036	Bacteria	746
53	Ga0105250_10192875	3300009092	Bacteria	858
54	Ga0105250_10199948	3300009092	Bacteria	843
55	Ga0105250_10428818	3300009092	Bacteria	590
56	Ga0105243_10605741	3300009148	Bacteria	1055
57	Ga0105243_10621165	3300009148	Bacteria	1043
58	Ga0105242_10025318	3300009176	Bacteria	4695
59	Ga0105239_11660460	3300010375	Bacteria	739
60	Ga0105246_10016015	3300011119	Bacteria	4742
61	Ga0157373_10002896	3300013100	Bacteria	12990
62	Ga0157373_10006826	3300013100	Bacteria	8499
63	Ga0157373_11449072	3300013100	Bacteria	523
64	Ga0157373_11453627	3300013100	Bacteria	522
65	Ga0157371_10000227	3300013102	Bacteria	81890
66	Ga0157371_10011585	3300013102	Bacteria	6778
67	Ga0157371_10127949	3300013102	Bacteria	1806
68	Ga0157371_11294953	3300013102	Bacteria	564
69	Ga0157371_11359297	3300013102	Bacteria	551
70	Ga0157370_10295969	3300013104	Bacteria	1495
71	Ga0157370_11089228	3300013104	Bacteria	722
72	Ga0157370_11338465	3300013104	Bacteria	645
73	Ga0157370_11350956	3300013104	Bacteria	642
74	Ga0157370_11666759	3300013104	Bacteria	572
75	Ga0157370_11825110	3300013104	Bacteria	546
76	Ga0157370_11890517	3300013104	Bacteria	535
77	Ga0157369_10056887	3300013105	Bacteria	4220
78	Ga0157369_11115807	3300013105	Bacteria	806
79	Ga0157369_12427194	3300013105	Bacteria	531
80	Ga0163162_10568419	3300013306	Bacteria	1261
81	Ga0163162_10574252	3300013306	Bacteria	1255
82	Ga0157372_10008456	3300013307	Bacteria	10926
83	Ga0157372_10509405	3300013307	Bacteria	1403
84	Ga0157372_11790512	3300013307	Bacteria	706
85	Ga0157375_10444339	3300013308	Bacteria	1462
86	Ga0182008_10004632	3300014497	Bacteria	8001
87	Ga0182008_10014112	3300014497	Bacteria	4189
88	Ga0182008_10084206	3300014497	Bacteria	1566
89	Ga0182008_10133247	3300014497	Bacteria	1240
90	Ga0182008_10298942	3300014497	Bacteria	842
91	Ga0182008_10472203	3300014497	Bacteria	685
92	Ga0182008_10480592	3300014497	Bacteria	680
93	Ga0182006_1001970	3300015261	Bacteria	11629
94	Ga0182006_1015490	3300015261	Bacteria	3268
95	Ga0182006_1018003	3300015261	Bacteria	2991
96	Ga0182006_1020370	3300015261	Bacteria	2780
97	Ga0182006_1045384	3300015261	Bacteria	1710
98	Ga0182006_1174369	3300015261	Bacteria	719
99	Ga0182007_10001632	3300015262	Bacteria	11887
100	Ga0182007_10012414	3300015262	Bacteria	3276
101	Ga0182005_1003973	3300015265	Bacteria	4875
102	Ga0182005_1052524	3300015265	Bacteria	1110
103	Ga0163161_10192617	3300017792	Bacteria	1568
104	Ga0163161_10206693	3300017792	Bacteria	1515
105	Ga0163161_10270521	3300017792	Bacteria	1329
106	Ga0163161_11003794	3300017792	Bacteria	713
107	Ga0163161_11903171	3300017792	Bacteria	529
108	Ga0209760_100124	3300025207	Bacteria	51804
109	Ga0207427_100004	3300025231	Bacteria	939600
110	Ga0209437_100028	3300025233	Bacteria	540136
111	Ga0209233_1000008	3300025261	Bacteria	1356712
112	Ga0209675_1001127	3300025291	Bacteria	16296
113	Ga0209676_1000056	3300025292	Bacteria	361329
114	Ga0209676_1000078	3300025292	Bacteria	296293
115	Ga0209676_1001035	3300025292	Bacteria	32260
116	Ga0209676_1006235	3300025292	Bacteria	5954
117	Ga0209050_1000027	3300025298	Bacteria	483261
118	Ga0209050_1000041	3300025298	Bacteria	408004
119	Ga0209050_1000181	3300025298	Bacteria	142533
120	Ga0209051_1000061	3300025303	Bacteria	253485
121	Ga0209051_1000065	3300025303	Bacteria	231445
122	Ga0209051_1000085	3300025303	Bacteria	189973
123	Ga0209257_1000105	3300025304	Bacteria	243729
124	Ga0209257_1004461	3300025304	Bacteria	10836
125	Ga0207696_1000032	3300025711	Bacteria	380071
126	Ga0207696_1006709	3300025711	Bacteria	4598
127	Ga0207655_1000021	3300025728	Bacteria	518596
128	Ga0207655_1001048	3300025728	Bacteria	27691
129	Ga0207655_1005118	3300025728	Bacteria	9037
130	Ga0207655_1008872	3300025728	Bacteria	6319
131	Ga0207655_1011665	3300025728	Bacteria	5208
132	Ga0207655_1015800	3300025728	Bacteria	4171
133	Ga0207655_1040828	3300025728	Bacteria	1996
134	Ga0207655_1041648	3300025728	Bacteria	1966
135	Ga0207655_1061465	3300025728	Bacteria	1450
136	Ga0207655_1140710	3300025728	Bacteria	775
137	Ga0207713_1000068	3300025735	Bacteria	192415
138	Ga0207713_1001346	3300025735	Bacteria	20027
139	Ga0207713_1003504	3300025735	Bacteria	10643
140	Ga0207713_1007206	3300025735	Bacteria	6622
141	Ga0207713_1024390	3300025735	Bacteria	2822
142	Ga0207713_1030609	3300025735	Bacteria	2394
143	Ga0207645_10642014	3300025907	Bacteria	721
144	Ga0207657_10646723	3300025919	Bacteria	823
145	Ga0207706_10039568	3300025933	Bacteria	4181
146	Ga0207686_10668888	3300025934	Bacteria	823
147	Ga0207709_10581134	3300025935	Bacteria	885
148	Ga0209281_1000015	3300027111	Bacteria	590084
149	Ga0209981_1020023	3300027378	Bacteria	953
150	Ga0209996_1012677	3300027395	Bacteria	1134
151	Ga0209995_1001947	3300027471	Bacteria	3231
152	Ga0209968_1005603	3300027526	Bacteria	1886
153	Ga0209982_1003799	3300027552	Bacteria	2157
154	Ga0209970_1002714	3300027614	Bacteria	2990
155	Ga0209983_1003503	3300027665	Bacteria	3345
156	Ga0209971_1001307	3300027682	Bacteria	6193
157	Ga0209974_10014967	3300027876	Bacteria	2576
158	Ga0209974_10326434	3300027876	Bacteria	591
159	Ga0207428_10069974	3300027907	Bacteria	2759
160	Ga0207428_10101136	3300027907	Bacteria	2228
161	Ga0268266_11421431	3300028379	Bacteria	669
162	Ga0314311_1153015	3300030733	Bacteria	3494
163	Ga0316183_1008369	3300030742	Bacteria	2567
164	Ga0316183_1132617	3300030742	Bacteria	2614
165	Ga0316181_1088452	3300030744	Bacteria	4411
166	Ga0307408_100011595	3300031548	Bacteria	5826
167	Ga0307408_100112529	3300031548	Bacteria	2093
168	Ga0307408_100139474	3300031548	Bacteria	1901
169	Ga0307408_100314167	3300031548	Bacteria	1317
170	Ga0307408_100416708	3300031548	Bacteria	1157
171	Ga0307408_100750233	3300031548	Bacteria	881
172	Ga0307405_10017378	3300031731	Bacteria	3945
173	Ga0307405_10029038	3300031731	Bacteria	3228
174	Ga0307405_10063449	3300031731	Bacteria	2343
175	Ga0307405_11045155	3300031731	Bacteria	699
176	Ga0307405_11724125	3300031731	Bacteria	555
177	Ga0307413_10132132	3300031824	Bacteria	1710
178	Ga0307413_10191575	3300031824	Bacteria	1468
179	Ga0307413_10312191	3300031824	Bacteria	1197
180	Ga0307410_10476538	3300031852	Bacteria	1023
181	Ga0307406_10153594	3300031901	Bacteria	1645
182	Ga0307406_10249303	3300031901	Bacteria	1336
183	Ga0307406_10789132	3300031901	Bacteria	800
184	Ga0307407_10004735	3300031903	Bacteria	5817
185	Ga0307407_11375526	3300031903	Bacteria	555
186	Ga0307412_10007521	3300031911	Bacteria	6186
187	Ga0307412_10007772	3300031911	Bacteria	6100
188	Ga0307412_10013040	3300031911	Bacteria	4859
189	Ga0307412_10018913	3300031911	Bacteria	4158
190	Ga0307412_10074453	3300031911	Bacteria	2326
191	Ga0307412_10942103	3300031911	Bacteria	759
192	Ga0307409_100095638	3300031995	Bacteria	2448
193	Ga0307409_100325397	3300031995	Bacteria	1440
194	Ga0307416_100182882	3300032002	Bacteria	1967
195	Ga0307416_100835961	3300032002	Bacteria	1018
196	Ga0307414_10034827	3300032004	Bacteria	3343
197	Ga0307414_10175237	3300032004	Bacteria	1719
198	Ga0307414_10842347	3300032004	Bacteria	838
199	Ga0307414_11711171	3300032004	Bacteria	586
200	Ga0307414_11897760	3300032004	Bacteria	556
201	Ga0307510_10205475	3300033180	Bacteria	1498
202	Ga0439438_020348	3300041405	Bacteria	1863
203	Ga0439438_037811	3300041405	Bacteria	1261
204	Ga0439447_003934	3300041407	Bacteria	5205
205	Ga0439447_012567	3300041407	Bacteria	2428
206	Ga0439447_026164	3300041407	Bacteria	1498
207	Ga0439466_0015817	3300041411	Bacteria	2737
208	Ga0439466_0018875	3300041411	Bacteria	2469
209	Ga0439466_0063127	3300041411	Bacteria	1189
210	Ga0439466_0101726	3300041411	Bacteria	895
211	Ga0439466_0174349	3300041411	Bacteria	656
212	Ga0439466_0228526	3300041411	Bacteria	564
213	Ga0439431_0001069	3300041997	Bacteria	5926
214	Ga0439445_0141131	3300042004	Bacteria	698
215	Ga0439445_0201044	3300042004	Bacteria	588
216	Ga0439432_020872	3300042006	Bacteria	2174
217	Ga0439432_027627	3300042006	Bacteria	1851
218	Ga0439432_045815	3300042006	Bacteria	1375
219	Ga0439451_028120	3300042009	Bacteria	1133
220	Ga0439451_125468	3300042009	Bacteria	523
221	Ga0439452_005092	3300042010	Bacteria	4288
222	Ga0439452_005122	3300042010	Bacteria	4268
223	Ga0439452_010065	3300042010	Bacteria	2764
224	Ga0439456_009361	3300042013	Bacteria	2024
225	Ga0439463_001288	3300042016	Bacteria	6665
226	Ga0439463_001880	3300042016	Bacteria	5447
227	Ga0439463_026157	3300042016	Bacteria	1465
228	Ga0439463_045680	3300042016	Bacteria	1115
229	Ga0439463_063404	3300042016	Bacteria	944
230	Ga0439463_175758	3300042016	Bacteria	556
231	Ga0450902_014848	3300042137	Bacteria	1260
232	Ga0450902_041512	3300042137	Bacteria	784
233	Ga0450903_018951	3300042138	Bacteria	1069
234	Ga0450904_027939	3300042139	Bacteria	585
235	Ga0450905_096274	3300042142	Bacteria	527
236	Ga0450909_041973	3300042185	Bacteria	705
237	Ga0439440_0024809	3300042993	Bacteria	1377
238	Ga0439440_0082687	3300042993	Bacteria	851
239	Ga0495617_045911	3300046452	Bacteria	1456
240	Ga0495617_064709	3300046452	Bacteria	1206
241	Ga0495627_000047	3300046453	Bacteria	170068
242	Ga0495627_001589	3300046453	Bacteria	12802
243	Ga0495627_054143	3300046453	Bacteria	1200
244	Ga0495603_0150066	3300046455	Bacteria	1354
245	Ga0495591_000681	3300046458	Bacteria	24804
246	Ga0495591_004731	3300046458	Bacteria	6528
247	Ga0495591_007185	3300046458	Bacteria	4771
248	Ga0495591_018208	3300046458	Bacteria	2386
249	Ga0495629_0173532	3300046459	Bacteria	1495
250	Ga0495638_0012161	3300046460	Bacteria	5909
251	Ga0495638_0025562	3300046460	Bacteria	3835
252	Ga0495638_0032760	3300046460	Bacteria	3328
253	Ga0495653_0066326	3300046463	Bacteria	2715
254	Ga0495650_0001459	3300046471	Bacteria	22664
255	Ga0495650_0011807	3300046471	Bacteria	4747
256	Ga0495650_0041187	3300046471	Bacteria	1977
257	Ga0495605_0000030	3300046474	Bacteria	213339
258	Ga0495605_0000428	3300046474	Bacteria	38189
259	Ga0495605_0020642	3300046474	Bacteria	3499
260	Ga0495605_0039130	3300046474	Bacteria	2376
261	Ga0495605_0083016	3300046474	Bacteria	1496
262	Ga0495605_0102753	3300046474	Bacteria	1311
263	Ga0495605_0324808	3300046474	Bacteria	648
264	Ga0495639_0000008	3300046475	Bacteria	97096
265	Ga0495639_0054464	3300046475	Bacteria	1823
266	Ga0495584_0003554	3300046491	Bacteria	8524
267	Ga0495584_0026799	3300046491	Bacteria	2920
268	Ga0495585_0008985	3300046492	Bacteria	6022
269	Ga0495594_0534417	3300046499	Bacteria	665
270	Ga0495596_0097168	3300046500	Bacteria	1143
271	Ga0495596_0225017	3300046500	Bacteria	728
272	Ga0495607_0000393	3300046501	Bacteria	44415
273	Ga0495607_0001642	3300046501	Bacteria	19379
274	Ga0495607_0005742	3300046501	Bacteria	8830
275	Ga0495607_0010127	3300046501	Bacteria	6345
276	Ga0495607_0011498	3300046501	Bacteria	5889
277	Ga0495607_0040969	3300046501	Bacteria	2753
278	Ga0495607_0060514	3300046501	Bacteria	2155
279	Ga0495607_0075541	3300046501	Bacteria	1867
280	Ga0495607_0099411	3300046501	Bacteria	1560
281	Ga0495607_0122121	3300046501	Bacteria	1365
282	Ga0495607_0128256	3300046501	Bacteria	1323
283	Ga0495607_0239951	3300046501	Bacteria	877
284	Ga0495607_0308291	3300046501	Bacteria	742
285	Ga0495607_0318491	3300046501	Bacteria	726
286	Ga0495607_0347412	3300046501	Bacteria	685
287	Ga0495607_0507617	3300046501	Bacteria	534
288	Ga0495583_0004575	3300046506	Bacteria	9815
289	Ga0495583_0005994	3300046506	Bacteria	8064
290	Ga0495583_0014323	3300046506	Bacteria	4380
291	Ga0495583_0073104	3300046506	Bacteria	1503
292	Ga0495583_0107724	3300046506	Bacteria	1183
293	Ga0495583_0108776	3300046506	Bacteria	1176
294	Ga0495606_0000086	3300046507	Bacteria	156764
295	Ga0495606_0001652	3300046507	Bacteria	28995
296	Ga0495606_0090651	3300046507	Bacteria	1881
297	Ga0495606_0155225	3300046507	Bacteria	1340
298	Ga0495606_0392819	3300046507	Bacteria	724
299	Ga0495606_0602804	3300046507	Bacteria	538
300	Ga0495610_0025827	3300046512	Bacteria	3145
301	Ga0495610_0048809	3300046512	Bacteria	2076
302	Ga0495610_0085470	3300046512	Bacteria	1439
303	Ga0495616_0035093	3300046513	Bacteria	2598
304	Ga0495616_0044896	3300046513	Bacteria	2239
305	Ga0495616_0112667	3300046513	Bacteria	1262
306	Ga0495620_0006262	3300046515	Bacteria	6552
307	Ga0495620_0010538	3300046515	Bacteria	4872
308	Ga0495620_0022519	3300046515	Bacteria	3032
309	Ga0495620_0124897	3300046515	Bacteria	1012
310	Ga0495631_0024961	3300046518	Bacteria	2755
311	Ga0495631_0035680	3300046518	Bacteria	2223
312	Ga0495631_0091496	3300046518	Bacteria	1310
313	Ga0495632_0006252	3300046519	Bacteria	7694
314	Ga0495632_0030812	3300046519	Bacteria	2780
315	Ga0495632_0038911	3300046519	Bacteria	2404
316	Ga0495632_0040490	3300046519	Bacteria	2346
317	Ga0495632_0040996	3300046519	Bacteria	2328
318	Ga0495632_0073758	3300046519	Bacteria	1635
319	Ga0495632_0155264	3300046519	Bacteria	1056
320	Ga0495632_0167221	3300046519	Bacteria	1011
321	Ga0495632_0458690	3300046519	Bacteria	552
322	Ga0495637_0000024	3300046520	Bacteria	169477
323	Ga0495637_0000780	3300046520	Bacteria	21471
324	Ga0495637_0042597	3300046520	Bacteria	1941
325	Ga0495637_0060248	3300046520	Bacteria	1559
326	Ga0495637_0074387	3300046520	Bacteria	1364
327	Ga0495637_0079202	3300046520	Bacteria	1312
328	Ga0495637_0081806	3300046520	Bacteria	1286
329	Ga0495637_0089900	3300046520	Bacteria	1212
330	Ga0495637_0143074	3300046520	Bacteria	906
331	Ga0495643_0032949	3300046522	Bacteria	2870
332	Ga0495643_0033625	3300046522	Bacteria	2835
333	Ga0495644_0001108	3300046523	Bacteria	11078
334	Ga0495644_0003971	3300046523	Bacteria	5814
335	Ga0495644_0119462	3300046523	Bacteria	1002
336	Ga0495648_0001813	3300046524	Bacteria	20584
337	Ga0495648_0007647	3300046524	Bacteria	8620
338	Ga0495648_0053282	3300046524	Bacteria	2451
339	Ga0495648_0346923	3300046524	Bacteria	679
340	Ga0495666_0059779	3300046526	Bacteria	1822
341	Ga0495654_0009382	3300046530	Bacteria	5364
342	Ga0495654_0017899	3300046530	Bacteria	3718
343	Ga0495654_0026745	3300046530	Bacteria	2963
344	Ga0495654_0034243	3300046530	Bacteria	2564
345	Ga0495654_0189067	3300046530	Bacteria	887
346	Ga0495586_0111428	3300046535	Bacteria	1523
347	Ga0495587_0065281	3300046536	Bacteria	2126
348	Ga0495609_0000006	3300046538	Bacteria	431833
349	Ga0495609_0000040	3300046538	Bacteria	177058
350	Ga0495609_0018202	3300046538	Bacteria	3257
351	Ga0495609_0307732	3300046538	Bacteria	644
352	Ga0495597_0047297	3300046542	Bacteria	1904
353	Ga0495597_0102226	3300046542	Bacteria	1208
354	Ga0495597_0381393	3300046542	Bacteria	537
355	Ga0495645_0057290	3300046543	Bacteria	2829
356	Ga0495645_0112316	3300046543	Bacteria	1927
357	Ga0495622_0001930	3300046557	Bacteria	10188
358	Ga0495622_0006998	3300046557	Bacteria	5236
359	Ga0495622_0343659	3300046557	Bacteria	646
360	Ga0495622_0483939	3300046557	Bacteria	529
361	Ga0495668_0034594	3300046616	Bacteria	2833
362	Ga0495668_0051585	3300046616	Bacteria	2277
363	Ga0495668_0182347	3300046616	Bacteria	1150
364	Ga0495668_0209008	3300046616	Bacteria	1068
365	Ga0495668_0836753	3300046616	Bacteria	510
366	Ga0495611_0001322	3300046648	Bacteria	12589
367	Ga0495611_0065531	3300046648	Bacteria	1655
368	Ga0495625_0000111	3300046660	Bacteria	124977
369	Ga0495625_0258659	3300046660	Bacteria	1127
370	Ga0495635_0110193	3300046663	Bacteria	1880
371	Ga0495659_0000746	3300046664	Bacteria	11682
372	Ga0495661_0000019	3300046665	Bacteria	200606
373	Ga0495661_0000054	3300046665	Bacteria	138979
374	Ga0495661_0067221	3300046665	Bacteria	2106
375	Ga0495661_0141460	3300046665	Bacteria	1308
376	Ga0495646_0065501	3300046680	Bacteria	2151
377	Ga0495613_0196368	3300046689	Bacteria	1424
378	Ga0495670_0435870	3300046691	Bacteria	709
379	Ga0495671_0008262	3300046692	Bacteria	5867
380	Ga0495671_0028692	3300046692	Bacteria	2863
381	Ga0495671_0072525	3300046692	Bacteria	1690
382	Ga0495671_0088581	3300046692	Bacteria	1515
383	Ga0495671_0166214	3300046692	Bacteria	1073
384	Ga0495671_0191753	3300046692	Bacteria	992
385	Ga0495671_0430216	3300046692	Bacteria	631
386	Ga0495671_0632552	3300046692	Bacteria	508
387	Ga0495649_0002197	3300046694	Bacteria	13930
388	Ga0495649_0107353	3300046694	Bacteria	1481
389	Ga0495649_0371459	3300046694	Bacteria	720
390	Ga0495649_0679226	3300046694	Bacteria	505
391	Ga0495589_0081854	3300046794	Bacteria	1570
392	Ga0495600_0026357	3300046809	Bacteria	3751
393	Ga0495660_0035190	3300046810	Bacteria	2799
394	Ga0495660_0054531	3300046810	Bacteria	2165
395	Ga0495660_0059614	3300046810	Bacteria	2051
396	Ga0495660_0100174	3300046810	Bacteria	1492
397	Ga0495660_0137182	3300046810	Bacteria	1221
398	Ga0495660_0144701	3300046810	Bacteria	1179
399	Ga0495660_0209809	3300046810	Bacteria	924
400	Ga0495660_0259000	3300046810	Bacteria	804
401	Ga0495660_0497825	3300046810	Bacteria	521
402	Ga0495581_0091910	3300047315	Bacteria	1761
403	Ga0495581_0135327	3300047315	Bacteria	1436
404	Ga0495604_0181440	3300047317	Bacteria	1472
405	Ga0495672_0008973	3300047320	Bacteria	7301
406	Ga0495672_0011918	3300047320	Bacteria	6097
407	Ga0495672_0017910	3300047320	Bacteria	4724
408	Ga0495672_0051402	3300047320	Bacteria	2427
409	Ga0495672_0107312	3300047320	Bacteria	1504
410	Ga0495672_0150505	3300047320	Bacteria	1207
411	Ga0495672_0179758	3300047320	Bacteria	1072
412	Ga0495672_0187600	3300047320	Bacteria	1042
413	Ga0495672_0212672	3300047320	Bacteria	959
414	Ga0495672_0315108	3300047320	Bacteria	736
415	Ga0495672_0346861	3300047320	Bacteria	690
416	Ga0495676_0000010	3300047321	Bacteria	242637
417	Ga0495676_0004193	3300047321	Bacteria	13167
418	Ga0495680_0007566	3300047322	Bacteria	9935
419	Ga0495680_0161057	3300047322	Bacteria	1629
420	Ga0495683_0057723	3300047323	Bacteria	1929
421	Ga0495683_0093961	3300047323	Bacteria	1449
422	Ga0495687_009825	3300047443	Bacteria	5311
423	Ga0495687_210118	3300047443	Bacteria	610
424	Ga0495675_0002375	3300047444	Bacteria	11244
425	Ga0495679_000092	3300047446	Bacteria	82121
426	Ga0495679_048016	3300047446	Bacteria	1292
427	Ga0495673_0002515	3300047469	Bacteria	12827
428	Ga0495673_0004155	3300047469	Bacteria	9159
429	Ga0495673_0005341	3300047469	Bacteria	7791
430	Ga0495673_0014619	3300047469	Bacteria	4076
431	Ga0495673_0033296	3300047469	Bacteria	2393
432	Ga0495673_0035361	3300047469	Bacteria	2303
433	Ga0495673_0043480	3300047469	Bacteria	2010
434	Ga0495673_0065029	3300047469	Bacteria	1549
435	Ga0495673_0117367	3300047469	Bacteria	1057
436	Ga0495681_0039227	3300047470	Bacteria	2315
437	Ga0495681_0086851	3300047470	Bacteria	1387
438	Ga0495681_0139881	3300047470	Bacteria	1023
439	Ga0495681_0156487	3300047470	Bacteria	952
440	Ga0495686_0059012	3300047472	Bacteria	2390
441	Ga0495686_0244142	3300047472	Bacteria	1011
442	Ga0495593_0075907	3300047673	Bacteria	1742
443	Ga0495593_0277740	3300047673	Bacteria	838
444	Ga0495626_0000013	3300048091	Bacteria	248164
445	Ga0495626_0006739	3300048091	Bacteria	6497
446	Ga0496102_0007726	3300048905	Bacteria	9188
447	Ga0496102_0524216	3300048905	Bacteria	1107
448	Ga0496102_1719176	3300048905	Bacteria	545
449	Ga0496103_0010383	3300048906	Bacteria	5511
450	Ga0496110_0570902	3300048913	Bacteria	1027
451	Ga0496110_1053153	3300048913	Bacteria	721
452	Ga0496111_0416075	3300048914	Bacteria	993
453	Ga0496111_0436012	3300048914	Bacteria	967
454	Ga0496112_0332651	3300048915	Bacteria	1463
455	Ga0496113_1553180	3300048916	Bacteria	510
456	Ga0496116_0005341	3300048919	Bacteria	11967
457	Ga0496116_0010688	3300048919	Bacteria	7664
458	Ga0496116_0187530	3300048919	Bacteria	1099
459	Ga0496116_0440068	3300048919	Bacteria	562
460	Ga0496117_0114044	3300048920	Bacteria	1676
461	Ga0496117_0155435	3300048920	Bacteria	1347
462	Ga0496117_0204057	3300048920	Bacteria	1114
463	Ga0496117_0207987	3300048920	Bacteria	1099
464	Ga0496118_0020497	3300048921	Bacteria	5858
465	Ga0496118_0103865	3300048921	Bacteria	1909
466	Ga0496118_0148972	3300048921	Bacteria	1468
467	Ga0496118_0220609	3300048921	Bacteria	1104
468	Ga0496119_0070568	3300048922	Bacteria	2048
469	Ga0496120_0130268	3300048923	Bacteria	1289
470	Ga0496121_0012622	3300048924	Bacteria	9178
471	Ga0496121_0031784	3300048924	Bacteria	4814
472	Ga0496121_0255642	3300048924	Bacteria	1212
473	Ga0496121_0263772	3300048924	Bacteria	1188
474	Ga0496122_0000297	3300048925	Bacteria	110041
475	Ga0496122_0093673	3300048925	Bacteria	2037
476	Ga0496122_0194989	3300048925	Bacteria	1191
477	Ga0496122_0242606	3300048925	Bacteria	1014
478	Ga0496123_0001365	3300048926	Bacteria	34358
479	Ga0496123_0185535	3300048926	Bacteria	1081
480	Ga0496123_0190717	3300048926	Bacteria	1060
481	Ga0496124_0000051	3300048927	Bacteria	255802
482	Ga0496124_0025162	3300048927	Bacteria	5396
483	Ga0496124_0061155	3300048927	Bacteria	3157
484	Ga0496124_0069295	3300048927	Bacteria	2929
485	Ga0496124_0168979	3300048927	Bacteria	1696
486	Ga0496126_0501571	3300048929	Bacteria	970
487	Ga0495678_000063	3300049459	Bacteria	140183
488	Ga0495678_009996	3300049459	Bacteria	4642
489	Ga0495678_018502	3300049459	Bacteria	3130
490	Ga0495678_074283	3300049459	Bacteria	1237
491	Ga0495678_103730	3300049459	Bacteria	982
492	Ga0495678_189980	3300049459	Bacteria	639
493	Ga0495682_0000635	3300049460	Bacteria	23482
494	Ga0495682_0361803	3300049460	Bacteria	511
495	Ga0501032_0034939	3300049569	Bacteria	3438
496	Ga0501034_0493852	3300049571	Bacteria	1138
497	Ga0501039_0346194	3300049575	Bacteria	1168
498	nmdc:mga08x19_722932_c1	3300050514	Bacteria	707
499	Ga0500618_027062	3300053125	Bacteria	1365
500	Ga0500573_0091476	3300053140	Bacteria	1718
501	Ga0500586_189162	3300053145	Bacteria	682

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	iso_pu_bacteria	2919688452	2919691769	74
2	iso_pu_bacteria	2510065053	2510284795	75
3	iso_pu_bacteria	2510065055	2510295105	75
4	iso_pu_bacteria	2510065058	2510312173	75
5	iso_pu_bacteria	2554235132	2554813367	75
6	iso_pu_bacteria	2600254954	2600443411	75
7	iso_pu_bacteria	2600255389	2602009134	75
8	iso_pu_bacteria	2606217733	2608381456	75
9	iso_pu_bacteria	2728369097	2729145957	75
10	iso_pu_bacteria	2773857672	2774131360	75
11	iso_pu_bacteria	2811994881	2812370792	75
12	iso_pu_bacteria	2823421272	2823425023	75
13	iso_pu_bacteria	2842805378	2842809279	75
14	iso_pu_bacteria	2917832318	2917834220	75
15	iso_pu_bacteria	2919125081	2919127776	75
16	iso_pu_bacteria	2919501602	2919501739	75
17	iso_pu_bacteria	2923519811	2923524896	75
18	iso_pu_bacteria	2926063275	2926063412	75
19	iso_pu_bacteria	2974298342	2974298624	75
20	iso_pu_bacteria	2984499530	2984500869	75
21	iso_pu_bacteria	2984504281	2984505687	75
22	iso_pu_bacteria	640427133	640487130	75
23	iso_pu_bacteria	651053060	651175002	75
24	iso_pu_bacteria	8011350971	8011353732	75
25	iso_pu_bacteria	8016728285	8016732381	75
26	iso_pu_bacteria	8034962539	8034962996	75
27	iso_pu_bacteria	2511231006	2511268737	76
28	iso_pu_bacteria	2511231021	2511357175	76
29	iso_pu_bacteria	2511231156	2511826740	76
30	iso_pu_bacteria	2512047018	2512328270	76
31	iso_pu_bacteria	2582580891	2583790443	76
32	iso_pu_bacteria	2597489887	2597856216	76
33	iso_pu_bacteria	2599185185	2599483527	76
34	iso_pu_bacteria	2599185188	2599502908	76
35	iso_pu_bacteria	2599185248	2599771262	76
36	iso_pu_bacteria	2599185257	2599805434	76
37	iso_pu_bacteria	2599185289	2599885966	76
38	iso_pu_bacteria	2599185291	2599897680	76
39	iso_pu_bacteria	2599185300	2599930064	76
40	iso_pu_bacteria	2599185305	2599961048	76
41	iso_pu_bacteria	2599185306	2599969403	76
42	iso_pu_bacteria	2599185308	2599980737	76
43	iso_pu_bacteria	2599185311	2599996005	76
44	iso_pu_bacteria	2599185313	2600005654	76
45	iso_pu_bacteria	2599185314	2600014614	76
46	iso_pu_bacteria	2599185315	2600019100	76
47	iso_pu_bacteria	2599185316	2600025577	76
48	iso_pu_bacteria	2599185317	2600027807	76
49	iso_pu_bacteria	2599185319	2600040239	76
50	iso_pu_bacteria	2599185321	2600055719	76
51	iso_pu_bacteria	2599185323	2600064277	76
52	iso_pu_bacteria	2599185324	2600073517	76
53	iso_pu_bacteria	2599185325	2600077274	76
54	iso_pu_bacteria	2600254930	2600356974	76
55	iso_pu_bacteria	2600255318	2601800034	76
56	iso_pu_bacteria	2603880185	2606074702	76
57	iso_pu_bacteria	2603880199	2606127565	76
58	iso_pu_bacteria	2623620443	2624478780	76
59	iso_pu_bacteria	2623620446	2624494170	76
60	iso_pu_bacteria	2643221565	2643842503	76
61	iso_pu_bacteria	2643221650	2644282433	76
62	iso_pu_bacteria	2651869719	2652545875	76
63	iso_pu_bacteria	2667528170	2671089775	76
64	iso_pu_bacteria	2667528176	2671125593	76
65	iso_pu_bacteria	2671180172	2671767830	76
66	iso_pu_bacteria	2675903515	2678265108	76
67	iso_pu_bacteria	2713897149	2715757498	76
68	iso_pu_bacteria	2718217725	2718632665	76
69	iso_pu_bacteria	2740892503	2743735626	76
70	iso_pu_bacteria	2744054620	2745005564	76
71	iso_pu_bacteria	2784132063	2784260494	76
72	iso_pu_bacteria	2791355520	2794598234	76
73	iso_pu_bacteria	2808606361	2808855876	76
74	iso_pu_bacteria	2808606376	2808921917	76
75	iso_pu_bacteria	2808606378	2808935956	76
76	iso_pu_bacteria	2808606380	2808944038	76
77	iso_pu_bacteria	2808606383	2808964251	76
78	iso_pu_bacteria	2808606389	2808999139	76
79	iso_pu_bacteria	2808606445	2809215721	76
80	iso_pu_bacteria	2825651385	2825655997	76
81	iso_pu_bacteria	2826581358	2826583768	76
82	iso_pu_bacteria	2842815866	2842821028	76
83	iso_pu_bacteria	2842849001	2842853453	76
84	iso_pu_bacteria	2852657418	2852662861	76
85	iso_pu_bacteria	2878029506	2878030745	76
86	iso_pu_bacteria	2880230671	2880231658	76
87	iso_pu_bacteria	2913036834	2913041717	76
88	iso_pu_bacteria	2919063839	2919067305	76
89	iso_pu_bacteria	2919481497	2919484655	76
90	iso_pu_bacteria	2919697872	2919699913	76
91	iso_pu_bacteria	2923153595	2923154634	76
92	iso_pu_bacteria	2923586266	2923590364	76
93	iso_pu_bacteria	2929144301	2929149037	76
94	iso_pu_bacteria	2931369376	2931373542	76
95	iso_pu_bacteria	2931396565	2931399423	76
96	iso_pu_bacteria	2984286254	2984291396	76
97	iso_pu_bacteria	2988728565	2988730635	76
98	iso_pu_bacteria	3007395558	3007400164	76
99	iso_pu_bacteria	3007419365	3007424962	76
100	iso_pu_bacteria	3007861166	3007863771	76
101	iso_pu_bacteria	3007866637	3007867622	76
102	iso_pu_bacteria	8015687852	8015688870	76
103	iso_pu_bacteria	8019769354	8019772415	76
104	iso_pu_bacteria	8019775933	8019776579	76
105	iso_pu_bacteria	8055770955	8055771987	76
106	iso_pu_bacteria	8056125926	8056130830	76
107	iso_pu_bacteria	8056166840	8056170044	76
108	iso_pu_bacteria	8056177738	8056183443	76
109	iso_pu_bacteria	8057798959	8057803283	76
110	iso_pu_bacteria	2599185307	2599974642	78
111	iso_pu_bacteria	2600255283	2601626001	78
112	iso_pu_bacteria	2738541271	2738689470	78
113	iso_pu_bacteria	2738543016	2739265244	78
114	3300009011	Ga0105251_10016448	Ga0105251_100164484	79
115	3300009036	Ga0105244_10041374	Ga0105244_100413743	79
116	3300013100	Ga0157373_11449072	Ga0157373_114490721	79
117	3300013102	Ga0157371_10011585	Ga0157371_100115855	79
118	3300013102	Ga0157371_10127949	Ga0157371_101279492	79
119	3300013104	Ga0157370_11338465	Ga0157370_113384652	79
120	3300013105	Ga0157369_10056887	Ga0157369_100568873	79
121	3300013307	Ga0157372_10509405	Ga0157372_105094052	79
122	3300013307	Ga0157372_11790512	Ga0157372_117905122	79
123	3300025728	Ga0207655_1040828	Ga0207655_10408283	79
124	3300025735	Ga0207713_1024390	Ga0207713_10243903	79
125	3300027378	Ga0209981_1020023	Ga0209981_10200232	79
126	3300027395	Ga0209996_1012677	Ga0209996_10126772	79
127	3300027471	Ga0209995_1001947	Ga0209995_10019472	79
128	3300027526	Ga0209968_1005603	Ga0209968_10056033	79
129	3300027552	Ga0209982_1003799	Ga0209982_10037992	79
130	3300027614	Ga0209970_1002714	Ga0209970_10027142	79
131	3300027665	Ga0209983_1003503	Ga0209983_10035033	79
132	3300027682	Ga0209971_1001307	Ga0209971_10013075	79
133	3300027876	Ga0209974_10014967	Ga0209974_100149673	79
134	3300027876	Ga0209974_10326434	Ga0209974_103264342	79
135	3300032002	Ga0307416_100182882	Ga0307416_1001828823	79
136	3300046543	Ga0495645_0112316	Ga0495645_0112316_1084_1326	79
137	3300049569	Ga0501032_0034939	Ga0501032_0034939_2519_2767	79
138	3300049571	Ga0501034_0493852	Ga0501034_0493852_748_996	79
139	3300049575	Ga0501039_0346194	Ga0501039_0346194_523_771	79
140	2124908027	MRS2a_Contig_26571	MRS2a_00444810	80
141	2162886007	SwRhRL2b_contig_3933257	SwRhRL2b_0215.00005570	80
142	2162886011	MRS1b_contig_5523328	MRS1b_0941.00000680	80
143	3300002737	JGI25162J39368_1000101	JGI25162J39368_100010162	80
144	3300002771	JGI25163J39215_1001598	JGI25163J39215_10015983	80
145	3300002772	JGI25164J39214_1000097	JGI25164J39214_100009730	80
146	3300003214	JGI25165J46597_1000184	JGI25165J46597_100018462	80
147	3300003781	Ga0055536_1000062	Ga0055536_100006238	80
148	3300003781	Ga0055536_1004291	Ga0055536_10042917	80
149	3300003781	Ga0055536_1004565	Ga0055536_10045657	80
150	3300003781	Ga0055536_1077112	Ga0055536_10771122	80
151	3300003791	Ga0055530_10000489	Ga0055530_100004897	80
152	3300003791	Ga0055530_10001123	Ga0055530_100011239	80
153	3300003791	Ga0055530_10001872	Ga0055530_100018727	80
154	3300003792	Ga0055540_1000512	Ga0055540_100051217	80
155	3300003792	Ga0055540_1000517	Ga0055540_100051724	80
156	3300003792	Ga0055540_1001386	Ga0055540_10013867	80
157	3300003794	Ga0055531_10000707	Ga0055531_1000070711	80
158	3300005288	Ga0065714_10065211	Ga0065714_100652112	80
159	3300005288	Ga0065714_10084209	Ga0065714_100842092	80
160	3300005288	Ga0065714_10092360	Ga0065714_100923603	80
161	3300005288	Ga0065714_10193953	Ga0065714_101939532	80
162	3300005288	Ga0065714_10412708	Ga0065714_104127082	80
163	3300005289	Ga0065704_10074001	Ga0065704_100740012	80
164	3300005289	Ga0065704_10319196	Ga0065704_103191962	80
165	3300005289	Ga0065704_10418785	Ga0065704_104187852	80
166	3300005290	Ga0065712_10068146	Ga0065712_100681463	80
167	3300005339	Ga0070660_101049080	Ga0070660_1010490802	80
168	3300005366	Ga0070659_100492437	Ga0070659_1004924372	80
169	3300005457	Ga0070662_100093553	Ga0070662_1000935533	80
170	3300005548	Ga0070665_101498912	Ga0070665_1014989122	80
171	3300006051	Ga0075364_10116547	Ga0075364_101165473	80
172	3300006058	Ga0075432_10003100	Ga0075432_100031003	80
173	3300006914	Ga0075436_100788230	Ga0075436_1007882302	80
174	3300006946	Ga0079104_1000168	Ga0079104_100016874	80
175	3300009011	Ga0105251_10002077	Ga0105251_100020778	80
176	3300009011	Ga0105251_10002689	Ga0105251_100026897	80
177	3300009011	Ga0105251_10006770	Ga0105251_100067703	80
178	3300009011	Ga0105251_10018937	Ga0105251_100189373	80
179	3300009011	Ga0105251_10066130	Ga0105251_100661303	80
180	3300009011	Ga0105251_10081560	Ga0105251_100815603	80
181	3300009011	Ga0105251_10598818	Ga0105251_105988182	80
182	3300009036	Ga0105244_10008044	Ga0105244_100080442	80
183	3300009036	Ga0105244_10008373	Ga0105244_100083737	80
184	3300009036	Ga0105244_10011694	Ga0105244_100116947	80
185	3300009036	Ga0105244_10018004	Ga0105244_100180044	80
186	3300009036	Ga0105244_10068511	Ga0105244_100685113	80
187	3300009036	Ga0105244_10087607	Ga0105244_100876073	80
188	3300009036	Ga0105244_10095250	Ga0105244_100952502	80
189	3300009036	Ga0105244_10298524	Ga0105244_102985242	80
190	3300009092	Ga0105250_10192875	Ga0105250_101928752	80
191	3300009092	Ga0105250_10199948	Ga0105250_101999482	80
192	3300009092	Ga0105250_10428818	Ga0105250_104288182	80
193	3300009148	Ga0105243_10605741	Ga0105243_106057411	80
194	3300009148	Ga0105243_10621165	Ga0105243_106211652	80
195	3300009176	Ga0105242_10025318	Ga0105242_100253182	80
196	3300010375	Ga0105239_11660460	Ga0105239_116604602	80
197	3300011119	Ga0105246_10016015	Ga0105246_100160154	80
198	3300013100	Ga0157373_10002896	Ga0157373_1000289611	80
199	3300013100	Ga0157373_10006826	Ga0157373_100068263	80
200	3300013100	Ga0157373_11453627	Ga0157373_114536272	80
201	3300013102	Ga0157371_10000227	Ga0157371_100002279	80
202	3300013102	Ga0157371_11294953	Ga0157371_112949532	80
203	3300013102	Ga0157371_11359297	Ga0157371_113592971	80
204	3300013104	Ga0157370_10295969	Ga0157370_102959693	80
205	3300013104	Ga0157370_11089228	Ga0157370_110892282	80
206	3300013104	Ga0157370_11350956	Ga0157370_113509562	80
207	3300013104	Ga0157370_11666759	Ga0157370_116667592	80
208	3300013104	Ga0157370_11825110	Ga0157370_118251102	80
209	3300013104	Ga0157370_11890517	Ga0157370_118905172	80
210	3300013105	Ga0157369_11115807	Ga0157369_111158072	80
211	3300013105	Ga0157369_12427194	Ga0157369_124271942	80
212	3300013306	Ga0163162_10568419	Ga0163162_105684193	80
213	3300013306	Ga0163162_10574252	Ga0163162_105742522	80
214	3300013307	Ga0157372_10008456	Ga0157372_100084562	80
215	3300013308	Ga0157375_10444339	Ga0157375_104443393	80
216	3300014497	Ga0182008_10004632	Ga0182008_100046328	80
217	3300014497	Ga0182008_10014112	Ga0182008_100141122	80
218	3300014497	Ga0182008_10084206	Ga0182008_100842062	80
219	3300014497	Ga0182008_10133247	Ga0182008_101332472	80
220	3300014497	Ga0182008_10298942	Ga0182008_102989422	80
221	3300014497	Ga0182008_10472203	Ga0182008_104722032	80
222	3300014497	Ga0182008_10480592	Ga0182008_104805922	80
223	3300015261	Ga0182006_1001970	Ga0182006_10019703	80
224	3300015261	Ga0182006_1015490	Ga0182006_10154904	80
225	3300015261	Ga0182006_1018003	Ga0182006_10180034	80
226	3300015261	Ga0182006_1020370	Ga0182006_10203702	80
227	3300015261	Ga0182006_1045384	Ga0182006_10453842	80
228	3300015261	Ga0182006_1174369	Ga0182006_11743692	80
229	3300015262	Ga0182007_10001632	Ga0182007_100016323	80
230	3300015262	Ga0182007_10012414	Ga0182007_100124144	80
231	3300015265	Ga0182005_1003973	Ga0182005_10039736	80
232	3300015265	Ga0182005_1052524	Ga0182005_10525242	80
233	3300017792	Ga0163161_10192617	Ga0163161_101926173	80
234	3300017792	Ga0163161_10206693	Ga0163161_102066932	80
235	3300017792	Ga0163161_10270521	Ga0163161_102705212	80
236	3300017792	Ga0163161_11003794	Ga0163161_110037942	80
237	3300017792	Ga0163161_11903171	Ga0163161_119031712	80
238	3300025207	Ga0209760_100124	Ga0209760_10012414	80
239	3300025231	Ga0207427_100004	Ga0207427_100004437	80
240	3300025233	Ga0209437_100028	Ga0209437_100028273	80
241	3300025261	Ga0209233_1000008	Ga0209233_1000008984	80
242	3300025291	Ga0209675_1001127	Ga0209675_100112712	80
243	3300025292	Ga0209676_1000056	Ga0209676_1000056137	80
244	3300025292	Ga0209676_1000078	Ga0209676_1000078210	80
245	3300025292	Ga0209676_1001035	Ga0209676_10010353	80
246	3300025292	Ga0209676_1006235	Ga0209676_10062353	80
247	3300025298	Ga0209050_1000027	Ga0209050_1000027240	80
248	3300025298	Ga0209050_1000041	Ga0209050_100004186	80
249	3300025298	Ga0209050_1000181	Ga0209050_100018138	80
250	3300025303	Ga0209051_1000061	Ga0209051_1000061137	80
251	3300025303	Ga0209051_1000065	Ga0209051_1000065152	80
252	3300025303	Ga0209051_1000085	Ga0209051_100008586	80
253	3300025304	Ga0209257_1000105	Ga0209257_100010537	80
254	3300025304	Ga0209257_1004461	Ga0209257_10044613	80
255	3300025711	Ga0207696_1000032	Ga0207696_1000032117	80
256	3300025711	Ga0207696_1006709	Ga0207696_10067096	80
257	3300025728	Ga0207655_1000021	Ga0207655_1000021223	80
258	3300025728	Ga0207655_1001048	Ga0207655_10010489	80
259	3300025728	Ga0207655_1005118	Ga0207655_10051187	80
260	3300025728	Ga0207655_1008872	Ga0207655_10088725	80
261	3300025728	Ga0207655_1011665	Ga0207655_10116656	80
262	3300025728	Ga0207655_1015800	Ga0207655_10158004	80
263	3300025728	Ga0207655_1041648	Ga0207655_10416482	80
264	3300025728	Ga0207655_1061465	Ga0207655_10614653	80
265	3300025728	Ga0207655_1140710	Ga0207655_11407101	80
266	3300025735	Ga0207713_1000068	Ga0207713_1000068160	80
267	3300025735	Ga0207713_1001346	Ga0207713_10013468	80
268	3300025735	Ga0207713_1003504	Ga0207713_10035045	80
269	3300025735	Ga0207713_1007206	Ga0207713_10072067	80
270	3300025735	Ga0207713_1030609	Ga0207713_10306094	80
271	3300025907	Ga0207645_10642014	Ga0207645_106420142	80
272	3300025919	Ga0207657_10646723	Ga0207657_106467232	80
273	3300025933	Ga0207706_10039568	Ga0207706_100395682	80
274	3300025934	Ga0207686_10668888	Ga0207686_106688882	80
275	3300025935	Ga0207709_10581134	Ga0207709_105811342	80
276	3300027111	Ga0209281_1000015	Ga0209281_1000015337	80
277	3300027907	Ga0207428_10069974	Ga0207428_100699744	80
278	3300027907	Ga0207428_10101136	Ga0207428_101011363	80
279	3300028379	Ga0268266_11421431	Ga0268266_114214312	80
280	3300030733	Ga0314311_1153015	Ga0314311_11530155	80
281	3300030742	Ga0316183_1008369	Ga0316183_10083694	80
282	3300030742	Ga0316183_1132617	Ga0316183_11326173	80
283	3300030744	Ga0316181_1088452	Ga0316181_10884523	80
284	3300031548	Ga0307408_100011595	Ga0307408_1000115953	80
285	3300031548	Ga0307408_100112529	Ga0307408_1001125292	80
286	3300031548	Ga0307408_100139474	Ga0307408_1001394743	80
287	3300031548	Ga0307408_100314167	Ga0307408_1003141672	80
288	3300031548	Ga0307408_100416708	Ga0307408_1004167081	80
289	3300031548	Ga0307408_100750233	Ga0307408_1007502332	80
290	3300031731	Ga0307405_10017378	Ga0307405_100173785	80
291	3300031731	Ga0307405_10029038	Ga0307405_100290383	80
292	3300031731	Ga0307405_10063449	Ga0307405_100634493	80
293	3300031731	Ga0307405_11045155	Ga0307405_110451552	80
294	3300031731	Ga0307405_11724125	Ga0307405_117241252	80
295	3300031824	Ga0307413_10132132	Ga0307413_101321323	80
296	3300031824	Ga0307413_10191575	Ga0307413_101915752	80
297	3300031824	Ga0307413_10312191	Ga0307413_103121912	80
298	3300031852	Ga0307410_10476538	Ga0307410_104765383	80
299	3300031901	Ga0307406_10153594	Ga0307406_101535943	80
300	3300031901	Ga0307406_10249303	Ga0307406_102493033	80
301	3300031901	Ga0307406_10789132	Ga0307406_107891322	80
302	3300031903	Ga0307407_10004735	Ga0307407_100047353	80
303	3300031903	Ga0307407_11375526	Ga0307407_113755262	80
304	3300031911	Ga0307412_10007521	Ga0307412_100075217	80
305	3300031911	Ga0307412_10007772	Ga0307412_100077727	80
306	3300031911	Ga0307412_10013040	Ga0307412_100130403	80
307	3300031911	Ga0307412_10018913	Ga0307412_100189132	80
308	3300031911	Ga0307412_10074453	Ga0307412_100744532	80
309	3300031911	Ga0307412_10942103	Ga0307412_109421032	80
310	3300031995	Ga0307409_100095638	Ga0307409_1000956383	80
311	3300031995	Ga0307409_100325397	Ga0307409_1003253973	80
312	3300032002	Ga0307416_100835961	Ga0307416_1008359612	80
313	3300032004	Ga0307414_10034827	Ga0307414_100348273	80
314	3300032004	Ga0307414_10175237	Ga0307414_101752372	80
315	3300032004	Ga0307414_10842347	Ga0307414_108423472	80
316	3300032004	Ga0307414_11711171	Ga0307414_117111712	80
317	3300032004	Ga0307414_11897760	Ga0307414_118977602	80
318	3300033180	Ga0307510_10205475	Ga0307510_102054752	80
319	3300041405	Ga0439438_020348	Ga0439438_020348_573_815	80
320	3300041405	Ga0439438_037811	Ga0439438_037811_1002_1244	80
321	3300041407	Ga0439447_003934	Ga0439447_003934_278_520	80
322	3300041407	Ga0439447_012567	Ga0439447_012567_39_281	80
323	3300041407	Ga0439447_026164	Ga0439447_026164_405_647	80
324	3300041411	Ga0439466_0015817	Ga0439466_0015817_150_392	80
325	3300041411	Ga0439466_0018875	Ga0439466_0018875_914_1156	80
326	3300041411	Ga0439466_0063127	Ga0439466_0063127_871_1113	80
327	3300041411	Ga0439466_0101726	Ga0439466_0101726_124_369	80
328	3300041411	Ga0439466_0174349	Ga0439466_0174349_178_420	80
329	3300041411	Ga0439466_0228526	Ga0439466_0228526_71_313	80
330	3300041997	Ga0439431_0001069	Ga0439431_0001069_5244_5486	80
331	3300042004	Ga0439445_0141131	Ga0439445_0141131_219_461	80
332	3300042004	Ga0439445_0201044	Ga0439445_0201044_304_546	80
333	3300042006	Ga0439432_020872	Ga0439432_020872_1122_1364	80
334	3300042006	Ga0439432_027627	Ga0439432_027627_859_1101	80
335	3300042006	Ga0439432_045815	Ga0439432_045815_430_672	80
336	3300042009	Ga0439451_028120	Ga0439451_028120_153_395	80
337	3300042009	Ga0439451_125468	Ga0439451_125468_129_371	80
338	3300042010	Ga0439452_005092	Ga0439452_005092_847_1089	80
339	3300042010	Ga0439452_005122	Ga0439452_005122_379_621	80
340	3300042010	Ga0439452_010065	Ga0439452_010065_871_1113	80
341	3300042013	Ga0439456_009361	Ga0439456_009361_77_319	80
342	3300042016	Ga0439463_001288	Ga0439463_001288_5178_5420	80
343	3300042016	Ga0439463_001880	Ga0439463_001880_1098_1349	80
344	3300042016	Ga0439463_026157	Ga0439463_026157_368_610	80
345	3300042016	Ga0439463_045680	Ga0439463_045680_345_587	80
346	3300042016	Ga0439463_063404	Ga0439463_063404_160_411	80
347	3300042016	Ga0439463_175758	Ga0439463_175758_294_536	80
348	3300042137	Ga0450902_014848	Ga0450902_014848_115_357	80
349	3300042137	Ga0450902_041512	Ga0450902_041512_353_595	80
350	3300042138	Ga0450903_018951	Ga0450903_018951_208_450	80
351	3300042139	Ga0450904_027939	Ga0450904_027939_232_474	80
352	3300042142	Ga0450905_096274	Ga0450905_096274_16_267	80
353	3300042185	Ga0450909_041973	Ga0450909_041973_452_694	80
354	3300042993	Ga0439440_0024809	Ga0439440_0024809_917_1159	80
355	3300042993	Ga0439440_0082687	Ga0439440_0082687_570_812	80
356	3300046452	Ga0495617_045911	Ga0495617_045911_583_834	80
357	3300046452	Ga0495617_064709	Ga0495617_064709_306_548	80
358	3300046453	Ga0495627_000047	Ga0495627_000047_90227_90472	80
359	3300046453	Ga0495627_001589	Ga0495627_001589_11689_11931	80
360	3300046453	Ga0495627_054143	Ga0495627_054143_689_940	80
361	3300046455	Ga0495603_0150066	Ga0495603_0150066_609_851	80
362	3300046458	Ga0495591_000681	Ga0495591_000681_20398_20649	80
363	3300046458	Ga0495591_004731	Ga0495591_004731_551_802	80
364	3300046458	Ga0495591_007185	Ga0495591_007185_3707_3958	80
365	3300046458	Ga0495591_018208	Ga0495591_018208_1151_1402	80
366	3300046459	Ga0495629_0173532	Ga0495629_0173532_589_831	80
367	3300046460	Ga0495638_0012161	Ga0495638_0012161_755_997	80
368	3300046460	Ga0495638_0025562	Ga0495638_0025562_390_632	80
369	3300046460	Ga0495638_0032760	Ga0495638_0032760_2816_3067	80
370	3300046463	Ga0495653_0066326	Ga0495653_0066326_1569_1811	80
371	3300046471	Ga0495650_0001459	Ga0495650_0001459_22019_22270	80
372	3300046471	Ga0495650_0011807	Ga0495650_0011807_653_904	80
373	3300046471	Ga0495650_0041187	Ga0495650_0041187_636_878	80
374	3300046474	Ga0495605_0000030	Ga0495605_0000030_169938_170189	80
375	3300046474	Ga0495605_0000428	Ga0495605_0000428_31221_31472	80
376	3300046474	Ga0495605_0020642	Ga0495605_0020642_2279_2530	80
377	3300046474	Ga0495605_0039130	Ga0495605_0039130_1166_1411	80
378	3300046474	Ga0495605_0083016	Ga0495605_0083016_156_401	80
379	3300046474	Ga0495605_0102753	Ga0495605_0102753_601_846	80
380	3300046474	Ga0495605_0324808	Ga0495605_0324808_14_265	80
381	3300046475	Ga0495639_0000008	Ga0495639_0000008_10574_10816	80
382	3300046475	Ga0495639_0054464	Ga0495639_0054464_607_849	80
383	3300046491	Ga0495584_0003554	Ga0495584_0003554_3231_3482	80
384	3300046491	Ga0495584_0026799	Ga0495584_0026799_613_855	80
385	3300046492	Ga0495585_0008985	Ga0495585_0008985_896_1138	80
386	3300046499	Ga0495594_0534417	Ga0495594_0534417_271_513	80
387	3300046500	Ga0495596_0097168	Ga0495596_0097168_76_327	80
388	3300046500	Ga0495596_0225017	Ga0495596_0225017_55_306	80
389	3300046501	Ga0495607_0000393	Ga0495607_0000393_22635_22880	80
390	3300046501	Ga0495607_0001642	Ga0495607_0001642_5664_5915	80
391	3300046501	Ga0495607_0005742	Ga0495607_0005742_3129_3380	80
392	3300046501	Ga0495607_0010127	Ga0495607_0010127_608_850	80
393	3300046501	Ga0495607_0011498	Ga0495607_0011498_4607_4852	80
394	3300046501	Ga0495607_0040969	Ga0495607_0040969_661_912	80
395	3300046501	Ga0495607_0060514	Ga0495607_0060514_938_1189	80
396	3300046501	Ga0495607_0075541	Ga0495607_0075541_708_959	80
397	3300046501	Ga0495607_0099411	Ga0495607_0099411_750_1001	80
398	3300046501	Ga0495607_0122121	Ga0495607_0122121_560_811	80
399	3300046501	Ga0495607_0128256	Ga0495607_0128256_110_352	80
400	3300046501	Ga0495607_0239951	Ga0495607_0239951_545_787	80
401	3300046501	Ga0495607_0308291	Ga0495607_0308291_263_514	80
402	3300046501	Ga0495607_0318491	Ga0495607_0318491_54_299	80
403	3300046501	Ga0495607_0347412	Ga0495607_0347412_84_335	80
404	3300046501	Ga0495607_0507617	Ga0495607_0507617_140_391	80
405	3300046506	Ga0495583_0004575	Ga0495583_0004575_1848_2099	80
406	3300046506	Ga0495583_0005994	Ga0495583_0005994_6585_6836	80
407	3300046506	Ga0495583_0014323	Ga0495583_0014323_3719_3970	80
408	3300046506	Ga0495583_0073104	Ga0495583_0073104_256_507	80
409	3300046506	Ga0495583_0107724	Ga0495583_0107724_375_626	80
410	3300046506	Ga0495583_0108776	Ga0495583_0108776_163_405	80
411	3300046507	Ga0495606_0000086	Ga0495606_0000086_144140_144391	80
412	3300046507	Ga0495606_0001652	Ga0495606_0001652_22005_22256	80
413	3300046507	Ga0495606_0090651	Ga0495606_0090651_903_1154	80
414	3300046507	Ga0495606_0155225	Ga0495606_0155225_216_458	80
415	3300046507	Ga0495606_0392819	Ga0495606_0392819_143_394	80
416	3300046507	Ga0495606_0602804	Ga0495606_0602804_256_507	80
417	3300046512	Ga0495610_0025827	Ga0495610_0025827_2104_2346	80
418	3300046512	Ga0495610_0048809	Ga0495610_0048809_981_1232	80
419	3300046512	Ga0495610_0085470	Ga0495610_0085470_289_540	80
420	3300046513	Ga0495616_0035093	Ga0495616_0035093_908_1150	80
421	3300046513	Ga0495616_0044896	Ga0495616_0044896_1556_1807	80
422	3300046513	Ga0495616_0112667	Ga0495616_0112667_174_425	80
423	3300046515	Ga0495620_0006262	Ga0495620_0006262_5753_6004	80
424	3300046515	Ga0495620_0010538	Ga0495620_0010538_1017_1268	80
425	3300046515	Ga0495620_0022519	Ga0495620_0022519_993_1244	80
426	3300046515	Ga0495620_0124897	Ga0495620_0124897_579_830	80
427	3300046518	Ga0495631_0024961	Ga0495631_0024961_1973_2224	80
428	3300046518	Ga0495631_0035680	Ga0495631_0035680_828_1070	80
429	3300046518	Ga0495631_0091496	Ga0495631_0091496_535_786	80
430	3300046519	Ga0495632_0006252	Ga0495632_0006252_2053_2304	80
431	3300046519	Ga0495632_0030812	Ga0495632_0030812_931_1182	80
432	3300046519	Ga0495632_0038911	Ga0495632_0038911_934_1176	80
433	3300046519	Ga0495632_0040490	Ga0495632_0040490_89_331	80
434	3300046519	Ga0495632_0040996	Ga0495632_0040996_1831_2073	80
435	3300046519	Ga0495632_0073758	Ga0495632_0073758_560_811	80
436	3300046519	Ga0495632_0155264	Ga0495632_0155264_264_506	80
437	3300046519	Ga0495632_0167221	Ga0495632_0167221_733_984	80
438	3300046519	Ga0495632_0458690	Ga0495632_0458690_97_348	80
439	3300046520	Ga0495637_0000024	Ga0495637_0000024_98826_99077	80
440	3300046520	Ga0495637_0000780	Ga0495637_0000780_1898_2149	80
441	3300046520	Ga0495637_0042597	Ga0495637_0042597_740_985	80
442	3300046520	Ga0495637_0060248	Ga0495637_0060248_219_470	80
443	3300046520	Ga0495637_0074387	Ga0495637_0074387_997_1248	80
444	3300046520	Ga0495637_0079202	Ga0495637_0079202_518_760	80
445	3300046520	Ga0495637_0081806	Ga0495637_0081806_493_735	80
446	3300046520	Ga0495637_0089900	Ga0495637_0089900_932_1174	80
447	3300046520	Ga0495637_0143074	Ga0495637_0143074_518_760	80
448	3300046522	Ga0495643_0032949	Ga0495643_0032949_1947_2198	80
449	3300046522	Ga0495643_0033625	Ga0495643_0033625_532_783	80
450	3300046523	Ga0495644_0001108	Ga0495644_0001108_2908_3159	80
451	3300046523	Ga0495644_0003971	Ga0495644_0003971_4884_5126	80
452	3300046523	Ga0495644_0119462	Ga0495644_0119462_27_269	80
453	3300046524	Ga0495648_0001813	Ga0495648_0001813_7235_7477	80
454	3300046524	Ga0495648_0007647	Ga0495648_0007647_7962_8213	80
455	3300046524	Ga0495648_0053282	Ga0495648_0053282_1997_2248	80
456	3300046524	Ga0495648_0346923	Ga0495648_0346923_314_565	80
457	3300046526	Ga0495666_0059779	Ga0495666_0059779_1001_1243	80
458	3300046530	Ga0495654_0009382	Ga0495654_0009382_426_668	80
459	3300046530	Ga0495654_0017899	Ga0495654_0017899_560_811	80
460	3300046530	Ga0495654_0026745	Ga0495654_0026745_768_1010	80
461	3300046530	Ga0495654_0034243	Ga0495654_0034243_1571_1813	80
462	3300046530	Ga0495654_0189067	Ga0495654_0189067_77_328	80
463	3300046535	Ga0495586_0111428	Ga0495586_0111428_676_918	80
464	3300046536	Ga0495587_0065281	Ga0495587_0065281_865_1107	80
465	3300046538	Ga0495609_0000006	Ga0495609_0000006_169677_169928	80
466	3300046538	Ga0495609_0000040	Ga0495609_0000040_148659_148910	80
467	3300046538	Ga0495609_0018202	Ga0495609_0018202_2107_2358	80
468	3300046538	Ga0495609_0307732	Ga0495609_0307732_356_607	80
469	3300046542	Ga0495597_0047297	Ga0495597_0047297_754_996	80
470	3300046542	Ga0495597_0102226	Ga0495597_0102226_205_456	80
471	3300046542	Ga0495597_0381393	Ga0495597_0381393_114_356	80
472	3300046543	Ga0495645_0057290	Ga0495645_0057290_872_1114	80
473	3300046557	Ga0495622_0001930	Ga0495622_0001930_5093_5344	80
474	3300046557	Ga0495622_0006998	Ga0495622_0006998_945_1187	80
475	3300046557	Ga0495622_0343659	Ga0495622_0343659_315_557	80
476	3300046557	Ga0495622_0483939	Ga0495622_0483939_67_309	80
477	3300046616	Ga0495668_0034594	Ga0495668_0034594_560_811	80
478	3300046616	Ga0495668_0051585	Ga0495668_0051585_21_272	80
479	3300046616	Ga0495668_0182347	Ga0495668_0182347_390_641	80
480	3300046616	Ga0495668_0209008	Ga0495668_0209008_560_811	80
481	3300046616	Ga0495668_0836753	Ga0495668_0836753_38_283	80
482	3300046648	Ga0495611_0001322	Ga0495611_0001322_1999_2250	80
483	3300046648	Ga0495611_0065531	Ga0495611_0065531_857_1108	80
484	3300046660	Ga0495625_0000111	Ga0495625_0000111_25785_26036	80
485	3300046660	Ga0495625_0258659	Ga0495625_0258659_397_642	80
486	3300046663	Ga0495635_0110193	Ga0495635_0110193_617_859	80
487	3300046664	Ga0495659_0000746	Ga0495659_0000746_874_1116	80
488	3300046665	Ga0495661_0000019	Ga0495661_0000019_139783_140034	80
489	3300046665	Ga0495661_0000054	Ga0495661_0000054_19045_19296	80
490	3300046665	Ga0495661_0067221	Ga0495661_0067221_586_837	80
491	3300046665	Ga0495661_0141460	Ga0495661_0141460_498_749	80
492	3300046680	Ga0495646_0065501	Ga0495646_0065501_1042_1284	80
493	3300046689	Ga0495613_0196368	Ga0495613_0196368_644_886	80
494	3300046691	Ga0495670_0435870	Ga0495670_0435870_269_520	80
495	3300046692	Ga0495671_0008262	Ga0495671_0008262_4713_4955	80
496	3300046692	Ga0495671_0028692	Ga0495671_0028692_560_811	80
497	3300046692	Ga0495671_0072525	Ga0495671_0072525_73_324	80
498	3300046692	Ga0495671_0088581	Ga0495671_0088581_708_950	80
499	3300046692	Ga0495671_0166214	Ga0495671_0166214_816_1058	80
500	3300046692	Ga0495671_0191753	Ga0495671_0191753_426_671	80
501	3300046692	Ga0495671_0430216	Ga0495671_0430216_55_297	80
502	3300046692	Ga0495671_0632552	Ga0495671_0632552_219_470	80
503	3300046694	Ga0495649_0002197	Ga0495649_0002197_596_838	80
504	3300046694	Ga0495649_0107353	Ga0495649_0107353_1034_1276	80
505	3300046694	Ga0495649_0371459	Ga0495649_0371459_75_326	80
506	3300046694	Ga0495649_0679226	Ga0495649_0679226_180_431	80
507	3300046794	Ga0495589_0081854	Ga0495589_0081854_187_429	80
508	3300046809	Ga0495600_0026357	Ga0495600_0026357_3303_3545	80
509	3300046810	Ga0495660_0035190	Ga0495660_0035190_989_1240	80
510	3300046810	Ga0495660_0054531	Ga0495660_0054531_1312_1557	80
511	3300046810	Ga0495660_0059614	Ga0495660_0059614_914_1159	80
512	3300046810	Ga0495660_0100174	Ga0495660_0100174_1167_1418	80
513	3300046810	Ga0495660_0137182	Ga0495660_0137182_412_654	80
514	3300046810	Ga0495660_0144701	Ga0495660_0144701_875_1117	80
515	3300046810	Ga0495660_0209809	Ga0495660_0209809_232_483	80
516	3300046810	Ga0495660_0259000	Ga0495660_0259000_333_584	80
517	3300046810	Ga0495660_0497825	Ga0495660_0497825_173_415	80
518	3300047315	Ga0495581_0091910	Ga0495581_0091910_614_856	80
519	3300047315	Ga0495581_0135327	Ga0495581_0135327_927_1169	80
520	3300047317	Ga0495604_0181440	Ga0495604_0181440_628_870	80
521	3300047320	Ga0495672_0008973	Ga0495672_0008973_2359_2601	80
522	3300047320	Ga0495672_0011918	Ga0495672_0011918_5089_5331	80
523	3300047320	Ga0495672_0017910	Ga0495672_0017910_912_1154	80
524	3300047320	Ga0495672_0051402	Ga0495672_0051402_966_1208	80
525	3300047320	Ga0495672_0107312	Ga0495672_0107312_745_990	80
526	3300047320	Ga0495672_0150505	Ga0495672_0150505_757_1002	80
527	3300047320	Ga0495672_0179758	Ga0495672_0179758_160_405	80
528	3300047320	Ga0495672_0187600	Ga0495672_0187600_535_786	80
529	3300047320	Ga0495672_0212672	Ga0495672_0212672_187_438	80
530	3300047320	Ga0495672_0315108	Ga0495672_0315108_187_438	80
531	3300047320	Ga0495672_0346861	Ga0495672_0346861_33_275	80
532	3300047321	Ga0495676_0000010	Ga0495676_0000010_97860_98111	80
533	3300047321	Ga0495676_0004193	Ga0495676_0004193_3160_3402	80
534	3300047322	Ga0495680_0007566	Ga0495680_0007566_5469_5711	80
535	3300047322	Ga0495680_0161057	Ga0495680_0161057_590_832	80
536	3300047323	Ga0495683_0057723	Ga0495683_0057723_604_855	80
537	3300047323	Ga0495683_0093961	Ga0495683_0093961_218_460	80
538	3300047443	Ga0495687_009825	Ga0495687_009825_4371_4613	80
539	3300047443	Ga0495687_210118	Ga0495687_210118_137_379	80
540	3300047444	Ga0495675_0002375	Ga0495675_0002375_4194_4436	80
541	3300047446	Ga0495679_000092	Ga0495679_000092_71671_71922	80
542	3300047446	Ga0495679_048016	Ga0495679_048016_1007_1249	80
543	3300047469	Ga0495673_0002515	Ga0495673_0002515_6425_6676	80
544	3300047469	Ga0495673_0004155	Ga0495673_0004155_545_796	80
545	3300047469	Ga0495673_0005341	Ga0495673_0005341_1684_1929	80
546	3300047469	Ga0495673_0014619	Ga0495673_0014619_1773_2024	80
547	3300047469	Ga0495673_0033296	Ga0495673_0033296_888_1139	80
548	3300047469	Ga0495673_0035361	Ga0495673_0035361_966_1217	80
549	3300047469	Ga0495673_0043480	Ga0495673_0043480_485_736	80
550	3300047469	Ga0495673_0065029	Ga0495673_0065029_332_574	80
551	3300047469	Ga0495673_0117367	Ga0495673_0117367_127_378	80
552	3300047470	Ga0495681_0039227	Ga0495681_0039227_443_685	80
553	3300047470	Ga0495681_0086851	Ga0495681_0086851_517_759	80
554	3300047470	Ga0495681_0139881	Ga0495681_0139881_614_865	80
555	3300047470	Ga0495681_0156487	Ga0495681_0156487_532_783	80
556	3300047472	Ga0495686_0059012	Ga0495686_0059012_508_750	80
557	3300047472	Ga0495686_0244142	Ga0495686_0244142_165_416	80
558	3300047673	Ga0495593_0075907	Ga0495593_0075907_1075_1317	80
559	3300047673	Ga0495593_0277740	Ga0495593_0277740_197_439	80
560	3300048091	Ga0495626_0000013	Ga0495626_0000013_99482_99733	80
561	3300048091	Ga0495626_0006739	Ga0495626_0006739_817_1059	80
562	3300048905	Ga0496102_0007726	Ga0496102_0007726_7947_8189	80
563	3300048905	Ga0496102_0524216	Ga0496102_0524216_422_673	80
564	3300048905	Ga0496102_1719176	Ga0496102_1719176_185_436	80
565	3300048906	Ga0496103_0010383	Ga0496103_0010383_207_449	80
566	3300048913	Ga0496110_0570902	Ga0496110_0570902_223_474	80
567	3300048913	Ga0496110_1053153	Ga0496110_1053153_419_670	80
568	3300048914	Ga0496111_0416075	Ga0496111_0416075_329_580	80
569	3300048914	Ga0496111_0436012	Ga0496111_0436012_392_643	80
570	3300048915	Ga0496112_0332651	Ga0496112_0332651_146_397	80
571	3300048916	Ga0496113_1553180	Ga0496113_1553180_89_340	80
572	3300048919	Ga0496116_0005341	Ga0496116_0005341_795_1037	80
573	3300048919	Ga0496116_0010688	Ga0496116_0010688_6787_7029	80
574	3300048919	Ga0496116_0187530	Ga0496116_0187530_329_580	80
575	3300048919	Ga0496116_0440068	Ga0496116_0440068_188_430	80
576	3300048920	Ga0496117_0114044	Ga0496117_0114044_1100_1342	80
577	3300048920	Ga0496117_0155435	Ga0496117_0155435_536_787	80
578	3300048920	Ga0496117_0204057	Ga0496117_0204057_835_1077	80
579	3300048920	Ga0496117_0207987	Ga0496117_0207987_38_280	80
580	3300048921	Ga0496118_0020497	Ga0496118_0020497_207_449	80
581	3300048921	Ga0496118_0103865	Ga0496118_0103865_848_1090	80
582	3300048921	Ga0496118_0148972	Ga0496118_0148972_349_600	80
583	3300048921	Ga0496118_0220609	Ga0496118_0220609_538_789	80
584	3300048922	Ga0496119_0070568	Ga0496119_0070568_959_1201	80
585	3300048923	Ga0496120_0130268	Ga0496120_0130268_220_462	80
586	3300048924	Ga0496121_0012622	Ga0496121_0012622_8430_8672	80
587	3300048924	Ga0496121_0031784	Ga0496121_0031784_3786_4028	80
588	3300048924	Ga0496121_0255642	Ga0496121_0255642_428_679	80
589	3300048924	Ga0496121_0263772	Ga0496121_0263772_562_813	80
590	3300048925	Ga0496122_0000297	Ga0496122_0000297_91539_91790	80
591	3300048925	Ga0496122_0093673	Ga0496122_0093673_989_1231	80
592	3300048925	Ga0496122_0194989	Ga0496122_0194989_421_672	80
593	3300048925	Ga0496122_0242606	Ga0496122_0242606_84_326	80
594	3300048926	Ga0496123_0001365	Ga0496123_0001365_18259_18510	80
595	3300048926	Ga0496123_0185535	Ga0496123_0185535_549_800	80
596	3300048926	Ga0496123_0190717	Ga0496123_0190717_38_280	80
597	3300048927	Ga0496124_0000051	Ga0496124_0000051_168833_169084	80
598	3300048927	Ga0496124_0025162	Ga0496124_0025162_198_440	80
599	3300048927	Ga0496124_0061155	Ga0496124_0061155_546_788	80
600	3300048927	Ga0496124_0069295	Ga0496124_0069295_2116_2367	80
601	3300048927	Ga0496124_0168979	Ga0496124_0168979_546_797	80
602	3300048929	Ga0496126_0501571	Ga0496126_0501571_414_662	80
603	3300049459	Ga0495678_000063	Ga0495678_000063_15567_15818	80
604	3300049459	Ga0495678_009996	Ga0495678_009996_529_780	80
605	3300049459	Ga0495678_018502	Ga0495678_018502_522_773	80
606	3300049459	Ga0495678_074283	Ga0495678_074283_741_983	80
607	3300049459	Ga0495678_103730	Ga0495678_103730_21_263	80
608	3300049459	Ga0495678_189980	Ga0495678_189980_194_436	80
609	3300049460	Ga0495682_0000635	Ga0495682_0000635_15571_15822	80
610	3300049460	Ga0495682_0361803	Ga0495682_0361803_172_414	80
611	3300050514	nmdc:mga08x19_722932_c1	nmdc:mga08x19_722932_c1_334_585	80
612	3300053125	Ga0500618_027062	Ga0500618_027062_514_756	80
613	3300053140	Ga0500573_0091476	Ga0500573_0091476_1012_1257	80
614	3300053145	Ga0500586_189162	Ga0500586_189162_42_287	80

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02597

ThiS

ThiS family

7

83

0.99 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
1jwb-assembly1.cif.gz_D-2	structure of the covalent acyl-adenylate form of the moeb-moad protein complex	0.9027	4	80
1vjk-assembly1.cif.gz_A	putative molybdopterin converting factor, subunit 1 from pyrococcus furiosus, pfu-562899-001	0.8518	1	77
6jc0-assembly1.cif.gz_A	structural analysis of molybdopterin synthases from two mycobacteria pathogens	0.8505	2	80
6jbz-assembly1.cif.gz_D	structural analysis of molybdopterin synthases from two mycobacteria pathogens	0.8344	1	80
2l52-assembly1.cif.gz_A	solution structure of the small archaeal modifier protein 1 (samp1) from methanosarcina acetivorans	0.8336	2	80

ID	Description	Score	Start	End	Superfamily
af_P30748_1_81_3.10.20.30	Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain	0.9248	3	80	3.10.20.30
af_P30748_1_81_3.10.20.30	Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain	0.8922	3	80	3.10.20.30
af_Q6MWY3_4_79_3.10.20.30	Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain	0.8719	4	77	3.10.20.30
af_A0A0B4J391_26_106_3.10.20.30	Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain	0.87	1	80	3.10.20.30
af_A0A0B4J391_26_106_3.10.20.30	Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain	0.8602	1	80	3.10.20.30

ID	Description	Score	Start	End	GO Terms
AF-Q88NB9-F1-model_v4	Molybdopterin synthase sulfur carrier subunit	0.9747	1	80	GO:0000166 GO:0006777 GO:0016740 GO:1990133
AF-Q88NB9-F1-model_v4	Molybdopterin synthase sulfur carrier subunit	0.9629	1	80	GO:0000166 GO:0006777 GO:0016740 GO:1990133
AF-A0A078MAB5-F1-model_v4	Molybdopterin converting factor, small subunit	0.9514	3	80
AF-A0A7V7GTJ3-F1-model_v4	Molybdopterin synthase sulfur carrier subunit	0.9509	3	80	GO:0000166 GO:0006777 GO:1990133
AF-A0A1F4KD36-F1-model_v4	Molybdopterin synthase sulfur carrier subunit	0.943	1	80	GO:0000166 GO:0006777 GO:1990133

Feature Viewer

pLDDT	pTM	Quality
91.29	0.78	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F469344

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF02597

ThiS

ThiS family

7

83

0.99

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map