F469247

General Info

Members Datasets Scaffolds Average Seq Length
613 235 1226 256

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10873430|Ga0105245_108734301
Length 288
Sequence MQPMDTEPVASPHAAAQGHPGPVPAVTTTGRPKTTFYQRHDAVILGGXSMXXXLALWEWAWQAKLISPLFFSGPSAIAKQFVYAWTKGNLKADIAYSGINFIVGFGGAVIAGVVLGVIIGWYRLARLLMDPFLNALYATPRIAMIPLIIIWFGVEMWSKIFIVFISAFFPVLVNTVGGMRAIDRDLLRAARSFCASDWQIFKTVAIPGSVPFILTGIRQGVALGLIGVVVGEMFGGSQGVGFMVAYGGQTFATDTLFVGVIIIAFSGIVLTWFAERLERRFSRWRPER

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
163 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
164 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
165 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
166 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
167 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
168 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
169 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
173 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
177 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
184 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
185 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
186 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
187 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
188 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
189 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
190 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
191 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
192 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
193 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
194 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
195 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
196 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
197 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
198 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
199 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
200 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
201 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
202 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
203 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
204 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
205 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
206 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
207 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
208 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
209 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
210 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
217 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
218 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
219 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
220 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
221 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
222 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
223 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
224 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
225 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
226 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
231 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
232 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
233 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
234 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
235 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.16
Nodule 0
Rhizoplane 1.31
Rhizosphere 97.39
Stem 0
Stem Tuber 0
Unclassified 10.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10873430 3300009098 Bacteria 940
2 JGI25406J46586_10000393 3300003203 Bacteria 20038
3 Ga0065712_10000297 3300005290 Bacteria 20117
4 Ga0065712_10003090 3300005290 Bacteria 4219
5 Ga0065715_10004180 3300005293 Bacteria 4120
6 Ga0065715_10006344 3300005293 Bacteria 3274
7 Ga0065715_10162050 3300005293 Unclassified 1620
8 Ga0065707_10152114 3300005295 Bacteria 1644
9 Ga0065707_10153272 3300005295 Bacteria 1635
10 Ga0065707_10195050 3300005295 Bacteria 1340
11 Ga0070658_10166623 3300005327 Bacteria 1850
12 Ga0070683_100009079 3300005329 Bacteria 8485
13 Ga0070683_100046211 3300005329 Bacteria 4021
14 Ga0070683_100259668 3300005329 Bacteria 1652
15 Ga0070690_100012640 3300005330 Bacteria 4970
16 Ga0070690_100078899 3300005330 Bacteria 2152
17 Ga0070690_100238604 3300005330 Bacteria 1281
18 Ga0070690_100303608 3300005330 Unclassified 1145
19 Ga0070670_100000974 3300005331 Bacteria 22427
20 Ga0070670_100024356 3300005331 Bacteria 5204
21 Ga0070670_100031116 3300005331 Bacteria 4596
22 Ga0070670_100043489 3300005331 Unclassified 3861
23 Ga0070670_100513959 3300005331 Bacteria 1066
24 Ga0070677_10036578 3300005333 Bacteria 1911
25 Ga0070677_10066905 3300005333 Bacteria 1499
26 Ga0068869_100115470 3300005334 Unclassified 2047
27 Ga0068869_100278252 3300005334 Bacteria 1345
28 Ga0068869_100339849 3300005334 Bacteria 1221
29 Ga0070666_10001112 3300005335 Bacteria 16435
30 Ga0070666_10005230 3300005335 Bacteria 7948
31 Ga0070666_10030598 3300005335 Bacteria 3548
32 Ga0070666_10255594 3300005335 Bacteria 1241
33 Ga0068868_100002848 3300005338 Bacteria 11989
34 Ga0068868_100029869 3300005338 Bacteria 4176
35 Ga0068868_100104447 3300005338 Bacteria 2296
36 Ga0070689_100012396 3300005340 Bacteria 6140
37 Ga0070689_100162858 3300005340 Archaea 1804
38 Ga0070689_100260702 3300005340 Bacteria 1433
39 Ga0070687_100138471 3300005343 Bacteria 1414
40 Ga0070661_100071869 3300005344 Bacteria 2546
41 Ga0070692_10257317 3300005345 Bacteria 1048
42 Ga0070668_100248986 3300005347 Bacteria 1474
43 Ga0070669_100016001 3300005353 Bacteria 5352
44 Ga0070669_100030914 3300005353 Bacteria 3865
45 Ga0070669_100057351 3300005353 Bacteria 2857
46 Ga0070669_100253043 3300005353 Unclassified 1403
47 Ga0070669_100281493 3300005353 Bacteria 1333
48 Ga0070675_100000412 3300005354 Bacteria 29143
49 Ga0070675_100002226 3300005354 Bacteria 14392
50 Ga0070675_100003309 3300005354 Bacteria 12223
51 Ga0070675_100006827 3300005354 Bacteria 8763
52 Ga0070675_100028586 3300005354 Bacteria 4488
53 Ga0070675_100061508 3300005354 Bacteria 3100
54 Ga0070675_100124442 3300005354 Bacteria 2193
55 Ga0070675_100129509 3300005354 Bacteria 2149
56 Ga0070675_100470864 3300005354 Bacteria 1129
57 Ga0070671_100007806 3300005355 Bacteria 8549
58 Ga0070671_100172828 3300005355 Bacteria 1828
59 Ga0070674_100027477 3300005356 Bacteria 3729
60 Ga0070674_100073938 3300005356 Unclassified 2417
61 Ga0070674_100090130 3300005356 Bacteria 2211
62 Ga0070674_100100857 3300005356 Bacteria 2103
63 Ga0070674_100174380 3300005356 Bacteria 1642
64 Ga0070673_100024873 3300005364 Bacteria 4397
65 Ga0070673_100045559 3300005364 Bacteria 3402
66 Ga0070673_100395000 3300005364 Unclassified 1235
67 Ga0070688_100039897 3300005365 Bacteria 2875
68 Ga0070688_100039988 3300005365 Bacteria 2872
69 Ga0070688_100081378 3300005365 Bacteria 2097
70 Ga0070688_100145037 3300005365 Bacteria 1617
71 Ga0070688_100185404 3300005365 Unclassified 1446
72 Ga0070688_100346367 3300005365 Bacteria 1087
73 Ga0070667_100008610 3300005367 Bacteria 8457
74 Ga0070667_100201479 3300005367 Bacteria 1766
75 Ga0070667_100592229 3300005367 Unclassified 1021
76 Ga0070713_100061065 3300005436 Bacteria 3153
77 Ga0070701_10008881 3300005438 Bacteria 4373
78 Ga0070700_100365548 3300005441 Bacteria 1074
79 Ga0070708_100315843 3300005445 Bacteria 1472
80 Ga0070678_100150409 3300005456 Bacteria 1875
81 Ga0070678_100536863 3300005456 Unclassified 1037
82 Ga0070662_100014432 3300005457 Bacteria 5279
83 Ga0070662_100037942 3300005457 Bacteria 3419
84 Ga0068867_100039320 3300005459 Bacteria 3448
85 Ga0068867_100225417 3300005459 Bacteria 1512
86 Ga0070685_10008157 3300005466 Bacteria 5367
87 Ga0070685_10219480 3300005466 Bacteria 1245
88 Ga0070706_100521002 3300005467 Bacteria 1106
89 Ga0070707_100170013 3300005468 Bacteria 2124
90 Ga0070698_100116004 3300005471 Bacteria 2642
91 Ga0070699_100129501 3300005518 Bacteria 2224
92 Ga0070684_100053180 3300005535 Bacteria 3524
93 Ga0068853_100120047 3300005539 Bacteria 2344
94 Ga0070672_100012331 3300005543 Bacteria 5996
95 Ga0070672_100023131 3300005543 Bacteria 4577
96 Ga0070672_100044057 3300005543 Bacteria 3445
97 Ga0070672_100084925 3300005543 Bacteria 2543
98 Ga0070686_100037728 3300005544 Bacteria 2999
99 Ga0070686_100060615 3300005544 Bacteria 2442
100 Ga0070686_100419506 3300005544 Bacteria 1022
101 Ga0070665_100008439 3300005548 Bacteria 10421
102 Ga0070704_100628900 3300005549 Bacteria 946
103 Ga0070664_100029428 3300005564 Bacteria 4579
104 Ga0070664_100043712 3300005564 Bacteria 3781
105 Ga0070664_100054423 3300005564 Bacteria 3395
106 Ga0068857_100035161 3300005577 Bacteria 4435
107 Ga0068857_100223336 3300005577 Bacteria 1721
108 Ga0068856_100331583 3300005614 Bacteria 1539
109 Ga0070702_100202209 3300005615 Bacteria 1316
110 Ga0068852_100230805 3300005616 Bacteria 1764
111 Ga0068859_100010329 3300005617 Bacteria 9399
112 Ga0068859_100014354 3300005617 Bacteria 7946
113 Ga0068859_100087305 3300005617 Bacteria 3167
114 Ga0068859_100092226 3300005617 Bacteria 3080
115 Ga0068859_100113609 3300005617 Bacteria 2772
116 Ga0068859_100239541 3300005617 Bacteria 1903
117 Ga0068859_100322489 3300005617 Bacteria 1639
118 Ga0068859_100399246 3300005617 Bacteria 1471
119 Ga0068864_100006596 3300005618 Bacteria 9497
120 Ga0068864_100119949 3300005618 Bacteria 2350
121 Ga0068864_100187579 3300005618 Unclassified 1894
122 Ga0068864_100296338 3300005618 Bacteria 1513
123 Ga0068864_100339705 3300005618 Bacteria 1415
124 Ga0068861_100507795 3300005719 Bacteria 1091
125 Ga0068870_10004289 3300005840 Bacteria 6136
126 Ga0068870_10097450 3300005840 Bacteria 1655
127 Ga0068863_100001177 3300005841 Bacteria 26139
128 Ga0068863_100008271 3300005841 Bacteria 10164
129 Ga0068863_100089330 3300005841 Bacteria 2921
130 Ga0068863_100139714 3300005841 Bacteria 2315
131 Ga0068863_100210173 3300005841 Bacteria 1874
132 Ga0068863_100354558 3300005841 Bacteria 1429
133 Ga0068858_100028766 3300005842 Bacteria 5161
134 Ga0068858_100030252 3300005842 Bacteria 5028
135 Ga0068858_100041156 3300005842 Bacteria 4286
136 Ga0068858_100046593 3300005842 Bacteria 4018
137 Ga0068858_100080305 3300005842 Bacteria 3030
138 Ga0068858_100148196 3300005842 Bacteria 2205
139 Ga0068858_100170691 3300005842 Bacteria 2051
140 Ga0068858_100270950 3300005842 Bacteria 1616
141 Ga0068858_100853750 3300005842 Bacteria 889
142 Ga0068860_100005883 3300005843 Bacteria 12343
143 Ga0068860_100019580 3300005843 Bacteria 6562
144 Ga0068860_100533956 3300005843 Bacteria 1174
145 Ga0068860_100590170 3300005843 Bacteria 1116
146 Ga0068862_100321632 3300005844 Bacteria 1428
147 Ga0081539_10000047 3300005985 Bacteria 275235
148 Ga0081539_10004786 3300005985 Bacteria 14592
149 Ga0081539_10014737 3300005985 Bacteria 5748
150 Ga0070712_100353645 3300006175 Bacteria 1203
151 Ga0097621_100033878 3300006237 Bacteria 4071
152 Ga0097621_100043447 3300006237 Bacteria 3623
153 Ga0097621_100054452 3300006237 Bacteria 3263
154 Ga0097621_100055503 3300006237 Bacteria 3235
155 Ga0097621_100086971 3300006237 Unclassified 2609
156 Ga0097621_100285390 3300006237 Unclassified 1454
157 Ga0097621_100382050 3300006237 Unclassified 1258
158 Ga0097621_100397799 3300006237 Bacteria 1233
159 Ga0068871_100065436 3300006358 Bacteria 2977
160 Ga0068871_100069878 3300006358 Bacteria 2885
161 Ga0068871_100230920 3300006358 Bacteria 1606
162 Ga0068871_100428979 3300006358 Bacteria 1182
163 Ga0068871_100607279 3300006358 Unclassified 995
164 Ga0075428_100005211 3300006844 Bacteria 14451
165 Ga0075428_100034588 3300006844 Bacteria 5572
166 Ga0075428_100055020 3300006844 Bacteria 4361
167 Ga0075428_100070527 3300006844 Bacteria 3820
168 Ga0075428_100138885 3300006844 Bacteria 2642
169 Ga0075428_100227367 3300006844 Bacteria 2014
170 Ga0075428_100542021 3300006844 Bacteria 1244
171 Ga0075430_100002643 3300006846 Bacteria 14961
172 Ga0075430_100039729 3300006846 Bacteria 3982
173 Ga0075430_100269016 3300006846 Bacteria 1411
174 Ga0075430_100554430 3300006846 Bacteria 948
175 Ga0075431_100000646 3300006847 Bacteria 29552
176 Ga0075431_100031593 3300006847 Bacteria 5453
177 Ga0075431_100081412 3300006847 Bacteria 3343
178 Ga0075431_100175583 3300006847 Bacteria 2201
179 Ga0075431_100366869 3300006847 Bacteria 1446
180 Ga0075433_10001289 3300006852 Bacteria 18331
181 Ga0075433_10001670 3300006852 Bacteria 16530
182 Ga0075433_10123632 3300006852 Bacteria 2299
183 Ga0075433_10123986 3300006852 Bacteria 2295
184 Ga0075433_10173152 3300006852 Bacteria 1921
185 Ga0075433_10468381 3300006852 Bacteria 1110
186 Ga0075434_100016390 3300006871 Bacteria 7123
187 Ga0075434_100065432 3300006871 Bacteria 3620
188 Ga0075434_100083925 3300006871 Bacteria 3184
189 Ga0075434_100173880 3300006871 Bacteria 2173
190 Ga0075434_100231306 3300006871 Bacteria 1868
191 Ga0075434_100641729 3300006871 Unclassified 1080
192 Ga0075429_100001853 3300006880 Bacteria 17516
193 Ga0075429_100037986 3300006880 Bacteria 4191
194 Ga0075429_100047486 3300006880 Bacteria 3735
195 Ga0068865_100061144 3300006881 Bacteria 2639
196 Ga0068865_100089462 3300006881 Bacteria 2230
197 Ga0068865_100236202 3300006881 Bacteria 1436
198 Ga0075436_100306292 3300006914 Bacteria 1139
199 Ga0097620_100010329 3300006931 Bacteria 9399
200 Ga0097620_100014354 3300006931 Bacteria 7946
201 Ga0097620_100087306 3300006931 Bacteria 3167
202 Ga0097620_100092224 3300006931 Bacteria 3080
203 Ga0097620_100113612 3300006931 Bacteria 2772
204 Ga0097620_100239541 3300006931 Bacteria 1903
205 Ga0097620_100322484 3300006931 Bacteria 1639
206 Ga0097620_100399199 3300006931 Bacteria 1471
207 Ga0075435_100022068 3300007076 Bacteria 4908
208 Ga0099794_10146930 3300007265 Bacteria 1196
209 Ga0105240_10257269 3300009093 Bacteria 2016
210 Ga0111539_10000151 3300009094 Bacteria 79134
211 Ga0111539_10000562 3300009094 Bacteria 47603
212 Ga0111539_10003382 3300009094 Bacteria 21034
213 Ga0111539_10021998 3300009094 Bacteria 7838
214 Ga0111539_10028000 3300009094 Bacteria 6882
215 Ga0111539_10039106 3300009094 Bacteria 5719
216 Ga0111539_10319600 3300009094 Bacteria 1807
217 Ga0111539_10454036 3300009094 Unclassified 1492
218 Ga0111539_10662310 3300009094 Bacteria 1215
219 Ga0105245_10002154 3300009098 Bacteria 17842
220 Ga0105245_10025043 3300009098 Bacteria 5245
221 Ga0105245_10193792 3300009098 Bacteria 1948
222 Ga0105245_10786617 3300009098 Bacteria 989
223 Ga0105247_10022256 3300009101 Bacteria 3817
224 Ga0105247_10102434 3300009101 Bacteria 1832
225 Ga0114129_10000797 3300009147 Bacteria 40445
226 Ga0114129_10078064 3300009147 Bacteria 4606
227 Ga0114129_10086660 3300009147 Bacteria 4343
228 Ga0114129_10126143 3300009147 Bacteria 3519
229 Ga0114129_10139486 3300009147 Bacteria 3324
230 Ga0114129_10260597 3300009147 Bacteria 2324
231 Ga0105243_10054656 3300009148 Bacteria 3171
232 Ga0105243_10237081 3300009148 Bacteria 1621
233 Ga0105241_10144995 3300009174 Bacteria 1937
234 Ga0105241_10152556 3300009174 Bacteria 1891
235 Ga0105241_10157892 3300009174 Bacteria 1862
236 Ga0105241_10605760 3300009174 Bacteria 990
237 Ga0105242_10011546 3300009176 Bacteria 6793
238 Ga0105242_10194135 3300009176 Bacteria 1799
239 Ga0105242_10308485 3300009176 Unclassified 1447
240 Ga0105248_10000923 3300009177 Bacteria 32713
241 Ga0105248_10027991 3300009177 Bacteria 6277
242 Ga0105248_10031282 3300009177 Bacteria 5948
243 Ga0105248_10035718 3300009177 Bacteria 5559
244 Ga0105248_10074816 3300009177 Bacteria 3806
245 Ga0105248_10078018 3300009177 Bacteria 3724
246 Ga0105248_10100529 3300009177 Bacteria 3259
247 Ga0105248_10256955 3300009177 Bacteria 1967
248 Ga0105248_10528589 3300009177 Unclassified 1330
249 Ga0105248_10606752 3300009177 Bacteria 1235
250 Ga0105248_11034840 3300009177 Unclassified 928
251 Ga0105248_11137281 3300009177 Unclassified 883
252 Ga0105237_10002323 3300009545 Bacteria 23604
253 Ga0105237_10546726 3300009545 Bacteria 1165
254 Ga0105238_10002890 3300009551 Bacteria 17159
255 Ga0105238_10123952 3300009551 Bacteria 2563
256 Ga0105249_10500873 3300009553 Unclassified 1260
257 Ga0105249_11067119 3300009553 Unclassified 877
258 Ga0105239_10004397 3300010375 Bacteria 16873
259 Ga0105246_10021446 3300011119 Bacteria 4157
260 Ga0105246_10046434 3300011119 Bacteria 2962
261 Ga0157369_10018536 3300013105 Bacteria 7802
262 Ga0157369_10575976 3300013105 Bacteria 1163
263 Ga0157374_10019444 3300013296 Bacteria 6010
264 Ga0157374_10037567 3300013296 Bacteria 4446
265 Ga0157374_10058599 3300013296 Bacteria 3599
266 Ga0157374_10659970 3300013296 Bacteria 1058
267 Ga0157374_10871435 3300013296 Bacteria 918
268 Ga0157378_10004499 3300013297 Bacteria 12234
269 Ga0157378_10037138 3300013297 Bacteria 4314
270 Ga0157378_10142665 3300013297 Bacteria 2225
271 Ga0157378_10419703 3300013297 Unclassified 1322
272 Ga0157378_10692542 3300013297 Bacteria 1038
273 Ga0163162_10011594 3300013306 Bacteria 8596
274 Ga0163162_10018089 3300013306 Bacteria 6898
275 Ga0163162_10101430 3300013306 Bacteria 2970
276 Ga0157372_10678407 3300013307 Bacteria 1199
277 Ga0157375_10002344 3300013308 Bacteria 16360
278 Ga0157375_10008555 3300013308 Bacteria 8960
279 Ga0157375_10063039 3300013308 Bacteria 3686
280 Ga0157375_10271532 3300013308 Bacteria 1858
281 Ga0157375_10366215 3300013308 Bacteria 1607
282 Ga0163163_10000798 3300014325 Bacteria 26698
283 Ga0163163_10008009 3300014325 Bacteria 9353
284 Ga0163163_10023399 3300014325 Bacteria 5863
285 Ga0163163_10026138 3300014325 Bacteria 5575
286 Ga0163163_10045675 3300014325 Bacteria 4300
287 Ga0163163_10075777 3300014325 Bacteria 3358
288 Ga0163163_10082947 3300014325 Bacteria 3210
289 Ga0163163_10145301 3300014325 Bacteria 2415
290 Ga0163163_10198293 3300014325 Unclassified 2056
291 Ga0163163_10234749 3300014325 Bacteria 1883
292 Ga0163163_10351893 3300014325 Bacteria 1529
293 Ga0157380_10066196 3300014326 Bacteria 2905
294 Ga0157380_10131100 3300014326 Bacteria 2139
295 Ga0157380_10206426 3300014326 Bacteria 1747
296 Ga0157377_10021572 3300014745 Unclassified 3389
297 Ga0157379_10020465 3300014968 Bacteria 5851
298 Ga0157379_10028278 3300014968 Bacteria 4990
299 Ga0157379_10324491 3300014968 Bacteria 1406
300 Ga0157376_10049055 3300014969 Bacteria 3496
301 Ga0157376_10131823 3300014969 Bacteria 2231
302 Ga0157376_10283655 3300014969 Bacteria 1561
303 Ga0157376_10493887 3300014969 Bacteria 1201
304 Ga0163161_10048559 3300017792 Unclassified 3065
305 Ga0163161_10056212 3300017792 Bacteria 2858
306 Ga0163161_10106956 3300017792 Bacteria 2088
307 Ga0213876_10053461 3300021384 Bacteria 2133
308 Ga0213875_10012164 3300021388 Bacteria 4256
309 Ga0213875_10118198 3300021388 Bacteria 1239
310 Ga0207697_10036941 3300025315 Bacteria 2001
311 Ga0207697_10153786 3300025315 Bacteria 1001
312 Ga0207682_10015461 3300025893 Bacteria 2970
313 Ga0207642_10066836 3300025899 Bacteria 1695
314 Ga0207642_10270178 3300025899 Bacteria 973
315 Ga0207710_10178812 3300025900 Bacteria 1040
316 Ga0207688_10020244 3300025901 Bacteria 3632
317 Ga0207680_10009905 3300025903 Bacteria 4746
318 Ga0207680_10180001 3300025903 Bacteria 1429
319 Ga0207645_10044868 3300025907 Bacteria 2828
320 Ga0207643_10010366 3300025908 Bacteria 5018
321 Ga0207654_10078882 3300025911 Unclassified 1977
322 Ga0207671_10016231 3300025914 Bacteria 5796
323 Ga0207671_10119541 3300025914 Bacteria 2013
324 Ga0207663_10158065 3300025916 Bacteria 1597
325 Ga0207662_10125996 3300025918 Bacteria 1610
326 Ga0207652_10455809 3300025921 Bacteria 1153
327 Ga0207646_10001462 3300025922 Bacteria 29242
328 Ga0207681_10043567 3300025923 Bacteria 3004
329 Ga0207681_10047844 3300025923 Bacteria 2884
330 Ga0207681_10141740 3300025923 Bacteria 1791
331 Ga0207681_10281188 3300025923 Unclassified 1310
332 Ga0207694_10000710 3300025924 Bacteria 29942
333 Ga0207650_10006456 3300025925 Bacteria 7987
334 Ga0207650_10006880 3300025925 Bacteria 7753
335 Ga0207650_10020039 3300025925 Bacteria 4710
336 Ga0207650_10111775 3300025925 Unclassified 2116
337 Ga0207659_10000287 3300025926 Bacteria 30532
338 Ga0207659_10003206 3300025926 Bacteria 9781
339 Ga0207659_10004351 3300025926 Bacteria 8562
340 Ga0207659_10030580 3300025926 Bacteria 3681
341 Ga0207659_10065342 3300025926 Bacteria 2636
342 Ga0207659_10143069 3300025926 Bacteria 1859
343 Ga0207659_10254844 3300025926 Bacteria 1425
344 Ga0207659_10327555 3300025926 Bacteria 1265
345 Ga0207659_10348997 3300025926 Unclassified 1227
346 Ga0207687_10002207 3300025927 Bacteria 13271
347 Ga0207687_10010486 3300025927 Bacteria 6053
348 Ga0207687_10210884 3300025927 Bacteria 1524
349 Ga0207687_10504219 3300025927 Unclassified 1010
350 Ga0207700_10054449 3300025928 Bacteria 3003
351 Ga0207644_10009199 3300025931 Bacteria 6480
352 Ga0207644_10029000 3300025931 Bacteria 3837
353 Ga0207644_10395834 3300025931 Bacteria 1128
354 Ga0207686_10023243 3300025934 Bacteria 3578
355 Ga0207686_10067818 3300025934 Bacteria 2283
356 Ga0207686_10196814 3300025934 Bacteria 1441
357 Ga0207709_10547643 3300025935 Bacteria 909
358 Ga0207670_10016772 3300025936 Bacteria 4412
359 Ga0207670_10160209 3300025936 Archaea 1679
360 Ga0207670_10368136 3300025936 Unclassified 1142
361 Ga0207669_10009677 3300025937 Bacteria 4607
362 Ga0207704_10160227 3300025938 Bacteria 1600
363 Ga0207691_10012333 3300025940 Bacteria 8192
364 Ga0207691_10014545 3300025940 Bacteria 7504
365 Ga0207691_10018151 3300025940 Bacteria 6664
366 Ga0207691_10031858 3300025940 Bacteria 4920
367 Ga0207691_10192832 3300025940 Bacteria 1776
368 Ga0207691_10639925 3300025940 Bacteria 899
369 Ga0207711_10008304 3300025941 Bacteria 8692
370 Ga0207711_10017416 3300025941 Bacteria 5970
371 Ga0207711_10022652 3300025941 Bacteria 5255
372 Ga0207711_10070017 3300025941 Bacteria 3042
373 Ga0207711_10075933 3300025941 Bacteria 2925
374 Ga0207711_10087121 3300025941 Bacteria 2739
375 Ga0207711_10140518 3300025941 Bacteria 2172
376 Ga0207711_10393496 3300025941 Bacteria 1287
377 Ga0207689_10082689 3300025942 Bacteria 2640
378 Ga0207689_10102988 3300025942 Bacteria 2346
379 Ga0207689_10178890 3300025942 Bacteria 1749
380 Ga0207689_10293875 3300025942 Bacteria 1346
381 Ga0207661_10001879 3300025944 Bacteria 14394
382 Ga0207661_10053522 3300025944 Bacteria 3230
383 Ga0207679_10048328 3300025945 Bacteria 3096
384 Ga0207679_10184504 3300025945 Unclassified 1729
385 Ga0207651_10009725 3300025960 Bacteria 5285
386 Ga0207651_10024719 3300025960 Bacteria 3721
387 Ga0207651_10026193 3300025960 Bacteria 3638
388 Ga0207651_10037543 3300025960 Bacteria 3175
389 Ga0207651_10136906 3300025960 Bacteria 1885
390 Ga0207651_10339067 3300025960 Bacteria 1262
391 Ga0207668_10271185 3300025972 Bacteria 1387
392 Ga0207668_10308229 3300025972 Bacteria 1309
393 Ga0207640_10024371 3300025981 Bacteria 3649
394 Ga0207658_10003206 3300025986 Bacteria 11640
395 Ga0207658_10052486 3300025986 Bacteria 3009
396 Ga0207658_10543152 3300025986 Bacteria 1039
397 Ga0207677_10005970 3300026023 Bacteria 6631
398 Ga0207677_10082722 3300026023 Bacteria 2308
399 Ga0207677_10139842 3300026023 Bacteria 1852
400 Ga0207703_10033972 3300026035 Bacteria 4045
401 Ga0207703_10061983 3300026035 Bacteria 3063
402 Ga0207703_10104988 3300026035 Bacteria 2401
403 Ga0207703_10105739 3300026035 Bacteria 2393
404 Ga0207703_10109248 3300026035 Bacteria 2357
405 Ga0207703_10163115 3300026035 Unclassified 1954
406 Ga0207703_10193327 3300026035 Unclassified 1804
407 Ga0207703_10371324 3300026035 Unclassified 1321
408 Ga0207703_10475562 3300026035 Bacteria 1170
409 Ga0207703_10558555 3300026035 Bacteria 1080
410 Ga0207703_10610604 3300026035 Unclassified 1032
411 Ga0207703_10661375 3300026035 Bacteria 991
412 Ga0207639_10084141 3300026041 Bacteria 2526
413 Ga0207708_10111755 3300026075 Bacteria 2121
414 Ga0207708_10146448 3300026075 Bacteria 1856
415 Ga0207708_10466299 3300026075 Bacteria 1054
416 Ga0207702_10354117 3300026078 Bacteria 1405
417 Ga0207641_10019827 3300026088 Bacteria 5519
418 Ga0207641_10032998 3300026088 Bacteria 4301
419 Ga0207641_10055052 3300026088 Bacteria 3378
420 Ga0207641_10407387 3300026088 Bacteria 1307
421 Ga0207648_10006827 3300026089 Bacteria 11308
422 Ga0207648_10069497 3300026089 Bacteria 3069
423 Ga0207676_10034868 3300026095 Bacteria 3812
424 Ga0207676_10061448 3300026095 Bacteria 2975
425 Ga0207676_10079323 3300026095 Bacteria 2662
426 Ga0207676_10372458 3300026095 Bacteria 1327
427 Ga0207674_10026232 3300026116 Bacteria 6195
428 Ga0207674_10258271 3300026116 Bacteria 1689
429 Ga0207675_100039636 3300026118 Bacteria 4397
430 Ga0207675_100593952 3300026118 Bacteria 1109
431 Ga0207683_10031644 3300026121 Bacteria 4591
432 Ga0207683_10057250 3300026121 Bacteria 3422
433 Ga0207683_10225960 3300026121 Bacteria 1706
434 Ga0207428_10000144 3300027907 Bacteria 96684
435 Ga0207428_10000643 3300027907 Bacteria 41046
436 Ga0207428_10019680 3300027907 Bacteria 5753
437 Ga0207428_10052671 3300027907 Unclassified 3249
438 Ga0207428_10113956 3300027907 Bacteria 2078
439 Ga0268266_10028726 3300028379 Bacteria 4727
440 Ga0268265_10103021 3300028380 Bacteria 2310
441 Ga0268265_10361383 3300028380 Bacteria 1329
442 Ga0268265_10577233 3300028380 Unclassified 1071
443 Ga0268265_10819567 3300028380 Bacteria 908
444 Ga0268264_10008921 3300028381 Bacteria 8319
445 Ga0268264_10012658 3300028381 Bacteria 6945
446 Ga0268264_10037903 3300028381 Bacteria 3976
447 Ga0268264_10123627 3300028381 Bacteria 2284
448 Ga0268264_10224216 3300028381 Bacteria 1732
449 Ga0268264_10240380 3300028381 Bacteria 1677
450 Ga0268264_10477815 3300028381 Bacteria 1212
451 Ga0268264_10515293 3300028381 Bacteria 1168
452 Ga0265338_10074453 3300028800 Bacteria 2888
453 Ga0265332_10077221 3300031238 Bacteria 1415
454 Ga0307408_100004306 3300031548 Bacteria 9661
455 Ga0265314_10002969 3300031711 Bacteria 16805
456 Ga0307405_10004173 3300031731 Bacteria 6797
457 Ga0307413_10034697 3300031824 Bacteria 2886
458 Ga0307406_10041867 3300031901 Bacteria 2857
459 Ga0307407_10038224 3300031903 Unclassified 2658
460 Ga0307416_100005845 3300032002 Bacteria 7630
461 Ga0307416_100404420 3300032002 Bacteria 1404
462 Ga0307411_10043665 3300032005 Unclassified 2869
463 Ga0307415_100281762 3300032126 Unclassified 1367
464 Ga0373923_0044032 3300035111 Bacteria 1849
465 Ga0373936_0073982 3300035113 Bacteria 1409
466 Ga0373936_0124928 3300035113 Unclassified 1102
467 Ga0373941_0101954 3300035115 Bacteria 1000
468 Ga0373945_0015626 3300035116 Bacteria 2556
469 Ga0373953_0033636 3300035117 Bacteria 2006
470 Ga0373954_0008145 3300035118 Bacteria 4592
471 Ga0373957_0033071 3300035120 Bacteria 1909
472 Ga0373943_0004543 3300035170 Bacteria 6276
473 Ga0373955_0024402 3300035172 Bacteria 3093
474 Ga0373955_0029993 3300035172 Bacteria 2835
475 Ga0373955_0039339 3300035172 Bacteria 2524
476 Ga0373955_0248118 3300035172 Bacteria 1067
477 Ga0373924_0003596 3300035410 Bacteria 5345
478 Ga0373931_0099059 3300035691 Bacteria 1637
479 Ga0373935_0012614 3300035692 Bacteria 5084
480 Ga0373935_0169721 3300035692 Bacteria 1492
481 Ga0373933_0011759 3300035724 Bacteria 4833
482 Ga0373933_0036471 3300035724 Bacteria 2878
483 Ga0373933_0049454 3300035724 Bacteria 2507
484 Ga0373933_0125069 3300035724 Bacteria 1613
485 Ga0373933_0165088 3300035724 Bacteria 1407
486 Ga0373947_0122488 3300035725 Bacteria 1653
487 Ga0373947_0126438 3300035725 Bacteria 1628
488 Ga0373937_0013754 3300036401 Bacteria 7130
489 Ga0373937_0034211 3300036401 Bacteria 4622
490 Ga0373937_0041341 3300036401 Bacteria 4204
491 Ga0373937_0075815 3300036401 Bacteria 3105
492 Ga0373937_0099881 3300036401 Bacteria 2692
493 Ga0373937_0213213 3300036401 Unclassified 1817
494 Ga0373925_0066151 3300037068 Bacteria 2724
495 Ga0373925_0099561 3300037068 Bacteria 2233
496 Ga0436364_0723968 3300037853 Bacteria 5227
497 Ga0242420_020852 3300038996 Bacteria 1169
498 Ga0436365_1453730 3300039437 Bacteria 2385
499 Ga0436365_1628392 3300039437 Bacteria 1099
500 Ga0436365_1882948 3300039437 Bacteria 2683
501 Ga0451576_0412473 3300045051 Bacteria 1417
502 Ga0466967_0250597 3300045976 Bacteria 1691
503 Ga0495592_0067931 3300046454 Bacteria 2603
504 Ga0495592_0117526 3300046454 Bacteria 1874
505 Ga0495629_0055092 3300046459 Bacteria 2781
506 Ga0495651_0104094 3300046462 Bacteria 2108
507 Ga0495653_0179433 3300046463 Bacteria 1455
508 Ga0495580_0009926 3300046472 Bacteria 7453
509 Ga0495580_0064564 3300046472 Bacteria 2566
510 Ga0495582_0022898 3300046473 Bacteria 3417
511 Ga0495639_0056934 3300046475 Bacteria 1786
512 Ga0495664_0070457 3300046477 Bacteria 2088
513 Ga0495664_0138188 3300046477 Unclassified 1477
514 Ga0495594_0076449 3300046499 Bacteria 1867
515 Ga0495608_0009055 3300046511 Bacteria 6963
516 Ga0495630_0039488 3300046517 Bacteria 3528
517 Ga0495643_0009518 3300046522 Bacteria 6036
518 Ga0495652_0104010 3300046529 Bacteria 2297
519 Ga0495652_0109564 3300046529 Bacteria 2223
520 Ga0495665_0179472 3300046531 Unclassified 1100
521 Ga0495586_0013155 3300046535 Bacteria 4385
522 Ga0495586_0037557 3300046535 Bacteria 2600
523 Ga0495587_0005831 3300046536 Bacteria 8019
524 Ga0495587_0028966 3300046536 Bacteria 3364
525 Ga0495598_0026385 3300046537 Unclassified 1592
526 Ga0495621_0022478 3300046539 Bacteria 2091
527 Ga0495667_0001498 3300046559 Bacteria 15394
528 Ga0495667_0040259 3300046559 Bacteria 3104
529 Ga0495634_0031946 3300046642 Bacteria 3623
530 Ga0495634_0133449 3300046642 Bacteria 1581
531 Ga0495657_0001128 3300046675 Bacteria 23394
532 Ga0495599_0069932 3300046678 Unclassified 2191
533 Ga0495599_0174907 3300046678 Unclassified 1324
534 Ga0495599_0293245 3300046678 Unclassified 983
535 Ga0495623_0068024 3300046679 Bacteria 2222
536 Ga0495658_0290769 3300046683 Unclassified 1032
537 Ga0495658_0349738 3300046683 Unclassified 939
538 Ga0495613_0000428 3300046689 Bacteria 35924
539 Ga0495613_0063817 3300046689 Unclassified 2694
540 Ga0495613_0191705 3300046689 Bacteria 1444
541 Ga0495613_0342310 3300046689 Unclassified 1028
542 Ga0495581_0135433 3300047315 Bacteria 1436
543 Ga0495636_0118850 3300047318 Bacteria 1168
544 Ga0495674_0475974 3300047319 Bacteria 1001
545 Ga0495674_0661476 3300047319 Bacteria 823
546 Ga0495675_0034308 3300047444 Bacteria 3240
547 Ga0495675_0121339 3300047444 Unclassified 1628
548 Ga0495684_0000117 3300047471 Bacteria 57879
549 Ga0495684_0009335 3300047471 Bacteria 7572
550 Ga0495684_0119887 3300047471 Bacteria 1982
551 Ga0496104_0027628 3300048907 Bacteria 5253
552 Ga0496104_0128087 3300048907 Bacteria 2438
553 Ga0496104_0299353 3300048907 Bacteria 1520
554 Ga0496104_0503011 3300048907 Unclassified 1123
555 Ga0496105_0034460 3300048908 Bacteria 4164
556 Ga0496109_0032041 3300048912 Bacteria 4722
557 Ga0496109_0836916 3300048912 Bacteria 858
558 Ga0496115_0200721 3300048918 Bacteria 1647
559 Ga0501039_0096514 3300049575 Bacteria 2305
560 Ga0501075_0060558 3300049591 Bacteria 2852
561 Ga0501076_0028885 3300049592 Bacteria 4310
562 Ga0501077_0330609 3300049593 Unclassified 972
563 Ga0501081_0070318 3300049743 Bacteria 2439
564 Ga0501272_001824 3300049769 Bacteria 2073
565 Ga0501283_001260 3300049779 Bacteria 3343
566 Ga0501045_0194278 3300049824 Unclassified 1512
567 nmdc:mga05p37_11743_c1 3300050507 Bacteria 10441
568 nmdc:mga05p37_16523_c1 3300050507 Bacteria 8891
569 nmdc:mga05p37_216107_c1 3300050507 Unclassified 2316
570 nmdc:mga05p37_35787_c1 3300050507 Bacteria 6090
571 nmdc:mga05p37_456978_c1 3300050507 Bacteria 1477
572 nmdc:mga05p37_72924_c1 3300050507 Bacteria 4225
573 nmdc:mga05p37_848806_c1 3300050507 Bacteria 992
574 nmdc:mga09592_14008_c1 3300050508 Bacteria 6545
575 nmdc:mga09592_141557_c1 3300050508 Unclassified 2074
576 nmdc:mga09592_967_c1 3300050508 Bacteria 22695
577 nmdc:mga0qj67_15628_c1 3300050509 Bacteria 5749
578 nmdc:mga0qj67_16084_c1 3300050509 Bacteria 5667
579 nmdc:mga0qj67_184538_c1 3300050509 Bacteria 1695
580 nmdc:mga0qj67_34947_c1 3300050509 Bacteria 3928
581 nmdc:mga06r32_118689_c1 3300050510 Bacteria 2608
582 nmdc:mga06r32_306424_c1 3300050510 Bacteria 1574
583 nmdc:mga06r32_543149_c1 3300050510 Bacteria 1137
584 nmdc:mga06r32_86225_c1 3300050510 Bacteria 3062
585 nmdc:mga08y16_12039_c1 3300050511 Bacteria 9089
586 nmdc:mga08y16_2215_c1 3300050511 Bacteria 19933
587 nmdc:mga08y16_2889_c1 3300050511 Bacteria 17675
588 nmdc:mga08y16_47758_c1 3300050511 Bacteria 4480
589 nmdc:mga08y16_5902_c1 3300050511 Bacteria 12836
590 nmdc:mga08y16_63674_c1 3300050511 Bacteria 3851
591 nmdc:mga08y16_83338_c1 3300050511 Bacteria 3332
592 nmdc:mga08y16_86476_c1 3300050511 Bacteria 3267
593 nmdc:mga08y16_87368_c1 3300050511 Unclassified 3249
594 nmdc:mga0n895_146918_c1 3300050512 Bacteria 2387
595 nmdc:mga0n895_205237_c1 3300050512 Bacteria 2001
596 nmdc:mga0n895_222077_c1 3300050512 Bacteria 1918
597 nmdc:mga0n895_300596_c1 3300050512 Bacteria 1627
598 nmdc:mga0n895_347721_c1 3300050512 Bacteria 1502
599 nmdc:mga0n895_44481_c1 3300050512 Bacteria 4330
600 nmdc:mga0n895_596612_c1 3300050512 Unclassified 1107
601 nmdc:mga0rr50_15826_c1 3300050513 Bacteria 4989
602 nmdc:mga0a205_335166_c1 3300050515 Unclassified 1382
603 nmdc:mga0a205_453920_c1 3300050515 Bacteria 1142
604 nmdc:mga0a205_529815_c1 3300050515 Bacteria 1034
605 nmdc:mga0a205_88276_c1 3300050515 Bacteria 2997
606 Ga0495601_0000639 3300053077 Bacteria 18674
607 Ga0495601_0100506 3300053077 Bacteria 1868
608 Ga0495619_0000356 3300053085 Bacteria 31805
609 Ga0495619_0089063 3300053085 Bacteria 2088
610 Ga0495619_0369123 3300053085 Bacteria 992
611 Ga0500568_0000656 3300053139 Bacteria 24982
612 Ga0501084_0106166 3300054114 Bacteria 2359
613 Ga0501082_0045934 3300060353 Bacteria 3766
614 Ga0105245_10873430
615 JGI25406J46586_10000393
616 Ga0065712_10000297
617 Ga0065712_10003090
618 Ga0065715_10004180
619 Ga0065715_10006344
620 Ga0065715_10162050
621 Ga0065707_10152114
622 Ga0065707_10153272
623 Ga0065707_10195050
624 Ga0070658_10166623
625 Ga0070683_100009079
626 Ga0070683_100046211
627 Ga0070683_100259668
628 Ga0070690_100012640
629 Ga0070690_100078899
630 Ga0070690_100238604
631 Ga0070690_100303608
632 Ga0070670_100000974
633 Ga0070670_100024356
634 Ga0070670_100031116
635 Ga0070670_100043489
636 Ga0070670_100513959
637 Ga0070677_10036578
638 Ga0070677_10066905
639 Ga0068869_100115470
640 Ga0068869_100278252
641 Ga0068869_100339849
642 Ga0070666_10001112
643 Ga0070666_10005230
644 Ga0070666_10030598
645 Ga0070666_10255594
646 Ga0068868_100002848
647 Ga0068868_100029869
648 Ga0068868_100104447
649 Ga0070689_100012396
650 Ga0070689_100162858
651 Ga0070689_100260702
652 Ga0070687_100138471
653 Ga0070661_100071869
654 Ga0070692_10257317
655 Ga0070668_100248986
656 Ga0070669_100016001
657 Ga0070669_100030914
658 Ga0070669_100057351
659 Ga0070669_100253043
660 Ga0070669_100281493
661 Ga0070675_100000412
662 Ga0070675_100002226
663 Ga0070675_100003309
664 Ga0070675_100006827
665 Ga0070675_100028586
666 Ga0070675_100061508
667 Ga0070675_100124442
668 Ga0070675_100129509
669 Ga0070675_100470864
670 Ga0070671_100007806
671 Ga0070671_100172828
672 Ga0070674_100027477
673 Ga0070674_100073938
674 Ga0070674_100090130
675 Ga0070674_100100857
676 Ga0070674_100174380
677 Ga0070673_100024873
678 Ga0070673_100045559
679 Ga0070673_100395000
680 Ga0070688_100039897
681 Ga0070688_100039988
682 Ga0070688_100081378
683 Ga0070688_100145037
684 Ga0070688_100185404
685 Ga0070688_100346367
686 Ga0070667_100008610
687 Ga0070667_100201479
688 Ga0070667_100592229
689 Ga0070713_100061065
690 Ga0070701_10008881
691 Ga0070700_100365548
692 Ga0070708_100315843
693 Ga0070678_100150409
694 Ga0070678_100536863
695 Ga0070662_100014432
696 Ga0070662_100037942
697 Ga0068867_100039320
698 Ga0068867_100225417
699 Ga0070685_10008157
700 Ga0070685_10219480
701 Ga0070706_100521002
702 Ga0070707_100170013
703 Ga0070698_100116004
704 Ga0070699_100129501
705 Ga0070684_100053180
706 Ga0068853_100120047
707 Ga0070672_100012331
708 Ga0070672_100023131
709 Ga0070672_100044057
710 Ga0070672_100084925
711 Ga0070686_100037728
712 Ga0070686_100060615
713 Ga0070686_100419506
714 Ga0070665_100008439
715 Ga0070704_100628900
716 Ga0070664_100029428
717 Ga0070664_100043712
718 Ga0070664_100054423
719 Ga0068857_100035161
720 Ga0068857_100223336
721 Ga0068856_100331583
722 Ga0070702_100202209
723 Ga0068852_100230805
724 Ga0068859_100010329
725 Ga0068859_100014354
726 Ga0068859_100087305
727 Ga0068859_100092226
728 Ga0068859_100113609
729 Ga0068859_100239541
730 Ga0068859_100322489
731 Ga0068859_100399246
732 Ga0068864_100006596
733 Ga0068864_100119949
734 Ga0068864_100187579
735 Ga0068864_100296338
736 Ga0068864_100339705
737 Ga0068861_100507795
738 Ga0068870_10004289
739 Ga0068870_10097450
740 Ga0068863_100001177
741 Ga0068863_100008271
742 Ga0068863_100089330
743 Ga0068863_100139714
744 Ga0068863_100210173
745 Ga0068863_100354558
746 Ga0068858_100028766
747 Ga0068858_100030252
748 Ga0068858_100041156
749 Ga0068858_100046593
750 Ga0068858_100080305
751 Ga0068858_100148196
752 Ga0068858_100170691
753 Ga0068858_100270950
754 Ga0068858_100853750
755 Ga0068860_100005883
756 Ga0068860_100019580
757 Ga0068860_100533956
758 Ga0068860_100590170
759 Ga0068862_100321632
760 Ga0081539_10000047
761 Ga0081539_10004786
762 Ga0081539_10014737
763 Ga0070712_100353645
764 Ga0097621_100033878
765 Ga0097621_100043447
766 Ga0097621_100054452
767 Ga0097621_100055503
768 Ga0097621_100086971
769 Ga0097621_100285390
770 Ga0097621_100382050
771 Ga0097621_100397799
772 Ga0068871_100065436
773 Ga0068871_100069878
774 Ga0068871_100230920
775 Ga0068871_100428979
776 Ga0068871_100607279
777 Ga0075428_100005211
778 Ga0075428_100034588
779 Ga0075428_100055020
780 Ga0075428_100070527
781 Ga0075428_100138885
782 Ga0075428_100227367
783 Ga0075428_100542021
784 Ga0075430_100002643
785 Ga0075430_100039729
786 Ga0075430_100269016
787 Ga0075430_100554430
788 Ga0075431_100000646
789 Ga0075431_100031593
790 Ga0075431_100081412
791 Ga0075431_100175583
792 Ga0075431_100366869
793 Ga0075433_10001289
794 Ga0075433_10001670
795 Ga0075433_10123632
796 Ga0075433_10123986
797 Ga0075433_10173152
798 Ga0075433_10468381
799 Ga0075434_100016390
800 Ga0075434_100065432
801 Ga0075434_100083925
802 Ga0075434_100173880
803 Ga0075434_100231306
804 Ga0075434_100641729
805 Ga0075429_100001853
806 Ga0075429_100037986
807 Ga0075429_100047486
808 Ga0068865_100061144
809 Ga0068865_100089462
810 Ga0068865_100236202
811 Ga0075436_100306292
812 Ga0097620_100010329
813 Ga0097620_100014354
814 Ga0097620_100087306
815 Ga0097620_100092224
816 Ga0097620_100113612
817 Ga0097620_100239541
818 Ga0097620_100322484
819 Ga0097620_100399199
820 Ga0075435_100022068
821 Ga0099794_10146930
822 Ga0105240_10257269
823 Ga0111539_10000151
824 Ga0111539_10000562
825 Ga0111539_10003382
826 Ga0111539_10021998
827 Ga0111539_10028000
828 Ga0111539_10039106
829 Ga0111539_10319600
830 Ga0111539_10454036
831 Ga0111539_10662310
832 Ga0105245_10002154
833 Ga0105245_10025043
834 Ga0105245_10193792
835 Ga0105245_10786617
836 Ga0105247_10022256
837 Ga0105247_10102434
838 Ga0114129_10000797
839 Ga0114129_10078064
840 Ga0114129_10086660
841 Ga0114129_10126143
842 Ga0114129_10139486
843 Ga0114129_10260597
844 Ga0105243_10054656
845 Ga0105243_10237081
846 Ga0105241_10144995
847 Ga0105241_10152556
848 Ga0105241_10157892
849 Ga0105241_10605760
850 Ga0105242_10011546
851 Ga0105242_10194135
852 Ga0105242_10308485
853 Ga0105248_10000923
854 Ga0105248_10027991
855 Ga0105248_10031282
856 Ga0105248_10035718
857 Ga0105248_10074816
858 Ga0105248_10078018
859 Ga0105248_10100529
860 Ga0105248_10256955
861 Ga0105248_10528589
862 Ga0105248_10606752
863 Ga0105248_11034840
864 Ga0105248_11137281
865 Ga0105237_10002323
866 Ga0105237_10546726
867 Ga0105238_10002890
868 Ga0105238_10123952
869 Ga0105249_10500873
870 Ga0105249_11067119
871 Ga0105239_10004397
872 Ga0105246_10021446
873 Ga0105246_10046434
874 Ga0157369_10018536
875 Ga0157369_10575976
876 Ga0157374_10019444
877 Ga0157374_10037567
878 Ga0157374_10058599
879 Ga0157374_10659970
880 Ga0157374_10871435
881 Ga0157378_10004499
882 Ga0157378_10037138
883 Ga0157378_10142665
884 Ga0157378_10419703
885 Ga0157378_10692542
886 Ga0163162_10011594
887 Ga0163162_10018089
888 Ga0163162_10101430
889 Ga0157372_10678407
890 Ga0157375_10002344
891 Ga0157375_10008555
892 Ga0157375_10063039
893 Ga0157375_10271532
894 Ga0157375_10366215
895 Ga0163163_10000798
896 Ga0163163_10008009
897 Ga0163163_10023399
898 Ga0163163_10026138
899 Ga0163163_10045675
900 Ga0163163_10075777
901 Ga0163163_10082947
902 Ga0163163_10145301
903 Ga0163163_10198293
904 Ga0163163_10234749
905 Ga0163163_10351893
906 Ga0157380_10066196
907 Ga0157380_10131100
908 Ga0157380_10206426
909 Ga0157377_10021572
910 Ga0157379_10020465
911 Ga0157379_10028278
912 Ga0157379_10324491
913 Ga0157376_10049055
914 Ga0157376_10131823
915 Ga0157376_10283655
916 Ga0157376_10493887
917 Ga0163161_10048559
918 Ga0163161_10056212
919 Ga0163161_10106956
920 Ga0213876_10053461
921 Ga0213875_10012164
922 Ga0213875_10118198
923 Ga0207697_10036941
924 Ga0207697_10153786
925 Ga0207682_10015461
926 Ga0207642_10066836
927 Ga0207642_10270178
928 Ga0207710_10178812
929 Ga0207688_10020244
930 Ga0207680_10009905
931 Ga0207680_10180001
932 Ga0207645_10044868
933 Ga0207643_10010366
934 Ga0207654_10078882
935 Ga0207671_10016231
936 Ga0207671_10119541
937 Ga0207663_10158065
938 Ga0207662_10125996
939 Ga0207652_10455809
940 Ga0207646_10001462
941 Ga0207681_10043567
942 Ga0207681_10047844
943 Ga0207681_10141740
944 Ga0207681_10281188
945 Ga0207694_10000710
946 Ga0207650_10006456
947 Ga0207650_10006880
948 Ga0207650_10020039
949 Ga0207650_10111775
950 Ga0207659_10000287
951 Ga0207659_10003206
952 Ga0207659_10004351
953 Ga0207659_10030580
954 Ga0207659_10065342
955 Ga0207659_10143069
956 Ga0207659_10254844
957 Ga0207659_10327555
958 Ga0207659_10348997
959 Ga0207687_10002207
960 Ga0207687_10010486
961 Ga0207687_10210884
962 Ga0207687_10504219
963 Ga0207700_10054449
964 Ga0207644_10009199
965 Ga0207644_10029000
966 Ga0207644_10395834
967 Ga0207686_10023243
968 Ga0207686_10067818
969 Ga0207686_10196814
970 Ga0207709_10547643
971 Ga0207670_10016772
972 Ga0207670_10160209
973 Ga0207670_10368136
974 Ga0207669_10009677
975 Ga0207704_10160227
976 Ga0207691_10012333
977 Ga0207691_10014545
978 Ga0207691_10018151
979 Ga0207691_10031858
980 Ga0207691_10192832
981 Ga0207691_10639925
982 Ga0207711_10008304
983 Ga0207711_10017416
984 Ga0207711_10022652
985 Ga0207711_10070017
986 Ga0207711_10075933
987 Ga0207711_10087121
988 Ga0207711_10140518
989 Ga0207711_10393496
990 Ga0207689_10082689
991 Ga0207689_10102988
992 Ga0207689_10178890
993 Ga0207689_10293875
994 Ga0207661_10001879
995 Ga0207661_10053522
996 Ga0207679_10048328
997 Ga0207679_10184504
998 Ga0207651_10009725
999 Ga0207651_10024719
1000 Ga0207651_10026193
1001 Ga0207651_10037543
1002 Ga0207651_10136906
1003 Ga0207651_10339067
1004 Ga0207668_10271185
1005 Ga0207668_10308229
1006 Ga0207640_10024371
1007 Ga0207658_10003206
1008 Ga0207658_10052486
1009 Ga0207658_10543152
1010 Ga0207677_10005970
1011 Ga0207677_10082722
1012 Ga0207677_10139842
1013 Ga0207703_10033972
1014 Ga0207703_10061983
1015 Ga0207703_10104988
1016 Ga0207703_10105739
1017 Ga0207703_10109248
1018 Ga0207703_10163115
1019 Ga0207703_10193327
1020 Ga0207703_10371324
1021 Ga0207703_10475562
1022 Ga0207703_10558555
1023 Ga0207703_10610604
1024 Ga0207703_10661375
1025 Ga0207639_10084141
1026 Ga0207708_10111755
1027 Ga0207708_10146448
1028 Ga0207708_10466299
1029 Ga0207702_10354117
1030 Ga0207641_10019827
1031 Ga0207641_10032998
1032 Ga0207641_10055052
1033 Ga0207641_10407387
1034 Ga0207648_10006827
1035 Ga0207648_10069497
1036 Ga0207676_10034868
1037 Ga0207676_10061448
1038 Ga0207676_10079323
1039 Ga0207676_10372458
1040 Ga0207674_10026232
1041 Ga0207674_10258271
1042 Ga0207675_100039636
1043 Ga0207675_100593952
1044 Ga0207683_10031644
1045 Ga0207683_10057250
1046 Ga0207683_10225960
1047 Ga0207428_10000144
1048 Ga0207428_10000643
1049 Ga0207428_10019680
1050 Ga0207428_10052671
1051 Ga0207428_10113956
1052 Ga0268266_10028726
1053 Ga0268265_10103021
1054 Ga0268265_10361383
1055 Ga0268265_10577233
1056 Ga0268265_10819567
1057 Ga0268264_10008921
1058 Ga0268264_10012658
1059 Ga0268264_10037903
1060 Ga0268264_10123627
1061 Ga0268264_10224216
1062 Ga0268264_10240380
1063 Ga0268264_10477815
1064 Ga0268264_10515293
1065 Ga0265338_10074453
1066 Ga0265332_10077221
1067 Ga0307408_100004306
1068 Ga0265314_10002969
1069 Ga0307405_10004173
1070 Ga0307413_10034697
1071 Ga0307406_10041867
1072 Ga0307407_10038224
1073 Ga0307416_100005845
1074 Ga0307416_100404420
1075 Ga0307411_10043665
1076 Ga0307415_100281762
1077 Ga0373923_0044032
1078 Ga0373936_0073982
1079 Ga0373936_0124928
1080 Ga0373941_0101954
1081 Ga0373945_0015626
1082 Ga0373953_0033636
1083 Ga0373954_0008145
1084 Ga0373957_0033071
1085 Ga0373943_0004543
1086 Ga0373955_0024402
1087 Ga0373955_0029993
1088 Ga0373955_0039339
1089 Ga0373955_0248118
1090 Ga0373924_0003596
1091 Ga0373931_0099059
1092 Ga0373935_0012614
1093 Ga0373935_0169721
1094 Ga0373933_0011759
1095 Ga0373933_0036471
1096 Ga0373933_0049454
1097 Ga0373933_0125069
1098 Ga0373933_0165088
1099 Ga0373947_0122488
1100 Ga0373947_0126438
1101 Ga0373937_0013754
1102 Ga0373937_0034211
1103 Ga0373937_0041341
1104 Ga0373937_0075815
1105 Ga0373937_0099881
1106 Ga0373937_0213213
1107 Ga0373925_0066151
1108 Ga0373925_0099561
1109 Ga0436364_0723968
1110 Ga0242420_020852
1111 Ga0436365_1453730
1112 Ga0436365_1628392
1113 Ga0436365_1882948
1114 Ga0451576_0412473
1115 Ga0466967_0250597
1116 Ga0495592_0067931
1117 Ga0495592_0117526
1118 Ga0495629_0055092
1119 Ga0495651_0104094
1120 Ga0495653_0179433
1121 Ga0495580_0009926
1122 Ga0495580_0064564
1123 Ga0495582_0022898
1124 Ga0495639_0056934
1125 Ga0495664_0070457
1126 Ga0495664_0138188
1127 Ga0495594_0076449
1128 Ga0495608_0009055
1129 Ga0495630_0039488
1130 Ga0495643_0009518
1131 Ga0495652_0104010
1132 Ga0495652_0109564
1133 Ga0495665_0179472
1134 Ga0495586_0013155
1135 Ga0495586_0037557
1136 Ga0495587_0005831
1137 Ga0495587_0028966
1138 Ga0495598_0026385
1139 Ga0495621_0022478
1140 Ga0495667_0001498
1141 Ga0495667_0040259
1142 Ga0495634_0031946
1143 Ga0495634_0133449
1144 Ga0495657_0001128
1145 Ga0495599_0069932
1146 Ga0495599_0174907
1147 Ga0495599_0293245
1148 Ga0495623_0068024
1149 Ga0495658_0290769
1150 Ga0495658_0349738
1151 Ga0495613_0000428
1152 Ga0495613_0063817
1153 Ga0495613_0191705
1154 Ga0495613_0342310
1155 Ga0495581_0135433
1156 Ga0495636_0118850
1157 Ga0495674_0475974
1158 Ga0495674_0661476
1159 Ga0495675_0034308
1160 Ga0495675_0121339
1161 Ga0495684_0000117
1162 Ga0495684_0009335
1163 Ga0495684_0119887
1164 Ga0496104_0027628
1165 Ga0496104_0128087
1166 Ga0496104_0299353
1167 Ga0496104_0503011
1168 Ga0496105_0034460
1169 Ga0496109_0032041
1170 Ga0496109_0836916
1171 Ga0496115_0200721
1172 Ga0501039_0096514
1173 Ga0501075_0060558
1174 Ga0501076_0028885
1175 Ga0501077_0330609
1176 Ga0501081_0070318
1177 Ga0501272_001824
1178 Ga0501283_001260
1179 Ga0501045_0194278
1180 nmdc:mga05p37_11743_c1
1181 nmdc:mga05p37_16523_c1
1182 nmdc:mga05p37_216107_c1
1183 nmdc:mga05p37_35787_c1
1184 nmdc:mga05p37_456978_c1
1185 nmdc:mga05p37_72924_c1
1186 nmdc:mga05p37_848806_c1
1187 nmdc:mga09592_14008_c1
1188 nmdc:mga09592_141557_c1
1189 nmdc:mga09592_967_c1
1190 nmdc:mga0qj67_15628_c1
1191 nmdc:mga0qj67_16084_c1
1192 nmdc:mga0qj67_184538_c1
1193 nmdc:mga0qj67_34947_c1
1194 nmdc:mga06r32_118689_c1
1195 nmdc:mga06r32_306424_c1
1196 nmdc:mga06r32_543149_c1
1197 nmdc:mga06r32_86225_c1
1198 nmdc:mga08y16_12039_c1
1199 nmdc:mga08y16_2215_c1
1200 nmdc:mga08y16_2889_c1
1201 nmdc:mga08y16_47758_c1
1202 nmdc:mga08y16_5902_c1
1203 nmdc:mga08y16_63674_c1
1204 nmdc:mga08y16_83338_c1
1205 nmdc:mga08y16_86476_c1
1206 nmdc:mga08y16_87368_c1
1207 nmdc:mga0n895_146918_c1
1208 nmdc:mga0n895_205237_c1
1209 nmdc:mga0n895_222077_c1
1210 nmdc:mga0n895_300596_c1
1211 nmdc:mga0n895_347721_c1
1212 nmdc:mga0n895_44481_c1
1213 nmdc:mga0n895_596612_c1
1214 nmdc:mga0rr50_15826_c1
1215 nmdc:mga0a205_335166_c1
1216 nmdc:mga0a205_453920_c1
1217 nmdc:mga0a205_529815_c1
1218 nmdc:mga0a205_88276_c1
1219 Ga0495601_0000639
1220 Ga0495601_0100506
1221 Ga0495619_0000356
1222 Ga0495619_0089063
1223 Ga0495619_0369123
1224 Ga0500568_0000656
1225 Ga0501084_0106166
1226 Ga0501082_0045934

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

94

283

0.98

Map