F469211

General Info

Members Datasets Scaffolds Average Seq Length
612 352 1224 260

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8008558824|8008567455
Length 257
Sequence TAERMPALYLSHGAPPLADDPIWPGELAAWAATLPRPKAVLMVSAHWEEAPLALGAVDPVPLVYDFWGFPEHYYTVKYGAPGAPELAASVRKLLQAPGTPVQDIPDRGLDHGAYVPLVEMFPDADIPVLQISMPTLDPVRLMDIGRRLAPLRDEGVLIIGSGFFTHNLAALRQPGIPTWSAEFDDWGRRALESRDWDGLLDFLHKSPAGQLAHPRTEHFAPLFVTMGAAEAAGELDAQRSVIDGFWLGLAKRSVQFG

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
22 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
23 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
24 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
28 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
29 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
38 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
39 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
40 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
41 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
42 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
44 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
59 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
60 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
61 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
62 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
63 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
64 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
65 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
66 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
67 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
68 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
69 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
70 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
71 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
72 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
73 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
74 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
75 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
76 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
77 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
78 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
79 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
80 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
81 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
82 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
83 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
84 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
89 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
90 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
91 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
92 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
93 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
94 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
95 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
96 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
97 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
98 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
99 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
100 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
101 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
102 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
103 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
104 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
105 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
106 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
107 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
108 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
109 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
110 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
111 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
112 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
113 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
114 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
115 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
116 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
117 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
118 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
119 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
120 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
121 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
122 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
125 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
126 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
127 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
128 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
129 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
130 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
131 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
132 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
133 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
134 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
135 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
136 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
137 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
138 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
139 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
140 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
141 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
142 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
143 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
144 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
145 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
146 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
147 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
148 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
149 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
150 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
151 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
152 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
153 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
154 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
155 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
156 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
157 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
158 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
159 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
160 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
161 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
162 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
163 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
164 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
165 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
166 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
167 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
168 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
169 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
170 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
171 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
172 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
173 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
174 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
175 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
176 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
177 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
178 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
179 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
180 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
181 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
182 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
187 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
188 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
189 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
190 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
191 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
192 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
193 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
194 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
195 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
196 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
197 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
198 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
199 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
200 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
212 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
228 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
229 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
230 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
231 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
232 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
233 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
234 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
235 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
236 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
237 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
238 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
239 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
240 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
241 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
244 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
245 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
246 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
247 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
248 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
249 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
250 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
251 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
252 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
253 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
254 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
255 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
256 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
257 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
258 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
259 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
260 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
261 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
262 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
263 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
264 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
265 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
266 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
267 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
268 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
269 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
270 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
271 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
272 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
273 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
274 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
275 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
276 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
277 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
278 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
279 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
280 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
281 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
282 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
283 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
284 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
285 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
286 2643221548 Streptomyces sp. Root55 Isolate Unclassified
287 2643221578 Streptomyces sp. Root63 Isolate Unclassified
288 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
289 2643221647 Streptomyces sp. Root369 Isolate Unclassified
290 2643221670 Streptomyces sp. Root431 Isolate Unclassified
291 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
292 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
293 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
294 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
295 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
296 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
297 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
298 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
299 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
300 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
301 2808606448 Streptomyces sp. 193411 Isolate Unclassified
302 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
303 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
304 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
305 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
306 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
307 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
308 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
309 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
310 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
311 2862574272 Streptomyces sp. AcE210 Isolate Nodule
312 2867428634 Streptomyces sp. RP5T Isolate Unclassified
313 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
314 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
315 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
316 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
317 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
318 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
319 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
320 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
321 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
322 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
323 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
324 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
325 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
326 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
327 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
328 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
329 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
330 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
331 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
332 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
333 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
334 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
335 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
336 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
337 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
338 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
339 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
340 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
341 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
342 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
343 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
344 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
345 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
346 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
347 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
348 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
349 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
350 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
351 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
352 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.6
Metatranscriptomes 1.14
Isolates 12.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.88
Nodule 0.82
Rhizoplane 2.29
Rhizosphere 80.07
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10004205 3300001989 Bacteria 5509
2 JGI24737J22298_10009073 3300001990 Bacteria 3315
3 JGI24738J21930_10016824 3300002075 Bacteria 1541
4 Ga0006759J45824_1087315 3300003163 Bacteria 954
5 Ga0006562J51391_1065942 3300003578 Bacteria 1610
6 Ga0006562J51391_1137583 3300003578 Bacteria 1490
7 Ga0007429J51699_1018962 3300003579 Bacteria 1033
8 Ga0007429J51699_1050781 3300003579 Bacteria 1087
9 Ga0032354_1036702 3300003693 Bacteria 1214
10 Ga0070683_100755125 3300005329 Bacteria 932
11 Ga0070714_100060446 3300005435 Bacteria 3252
12 Ga0070713_100369425 3300005436 Bacteria 1334
13 Ga0070710_10046672 3300005437 Bacteria 2413
14 Ga0070710_10103510 3300005437 Bacteria 1699
15 Ga0070711_100020621 3300005439 Bacteria 4251
16 Ga0070711_100201692 3300005439 Bacteria 1535
17 Ga0070681_10711624 3300005458 Bacteria 920
18 Ga0070707_100036619 3300005468 Bacteria 4682
19 Ga0070699_100003959 3300005518 Bacteria 13091
20 Ga0070684_100320869 3300005535 Bacteria 1423
21 Ga0070697_100164203 3300005536 Bacteria 1877
22 Ga0068856_100096520 3300005614 Bacteria 2944
23 Ga0068863_100150247 3300005841 Bacteria 2228
24 Ga0070717_10081261 3300006028 Bacteria 2721
25 Ga0075368_10006104 3300006042 Bacteria 4188
26 Ga0075363_100006154 3300006048 Bacteria 5423
27 Ga0070715_10005589 3300006163 Bacteria 4203
28 Ga0070716_100018208 3300006173 Bacteria 3654
29 Ga0070712_100094796 3300006175 Bacteria 2194
30 Ga0070712_100115771 3300006175 Bacteria 2009
31 Ga0075367_10014387 3300006178 Bacteria 4283
32 Ga0075370_10059297 3300006353 Bacteria 2178
33 Ga0099826_10064064 3300006948 Bacteria 2371
34 Ga0105251_10004016 3300009011 Bacteria 10383
35 Ga0105245_10254532 3300009098 Bacteria 1707
36 Ga0105243_10634946 3300009148 Bacteria 1033
37 Ga0105242_10466410 3300009176 Bacteria 1194
38 Ga0105239_10134901 3300010375 Bacteria 2748
39 Ga0105246_10004492 3300011119 Bacteria 8484
40 Ga0105246_10232695 3300011119 Bacteria 1452
41 Ga0105246_10447298 3300011119 Bacteria 1085
42 Ga0157369_10161665 3300013105 Bacteria 2364
43 Ga0157372_10077839 3300013307 Bacteria 3747
44 Ga0182008_10000456 3300014497 Bacteria 31212
45 Ga0182007_10003402 3300015262 Bacteria 7498
46 Ga0182005_1006184 3300015265 Bacteria 3679
47 Ga0183367_1005 3300015688 Bacteria 652063
48 Ga0213875_10032259 3300021388 Bacteria 2476
49 Ga0224712_10201798 3300022467 Bacteria 904
50 Ga0207426_1018911 3300025302 Bacteria 2418
51 Ga0207692_10021530 3300025898 Bacteria 2951
52 Ga0207692_10097110 3300025898 Bacteria 1610
53 Ga0207647_10003562 3300025904 Bacteria 11685
54 Ga0207685_10043255 3300025905 Bacteria 1696
55 Ga0207699_10202064 3300025906 Bacteria 1347
56 Ga0207699_10377733 3300025906 Bacteria 1005
57 Ga0207693_10033862 3300025915 Bacteria 4030
58 Ga0207663_10093616 3300025916 Bacteria 2000
59 Ga0207687_10162484 3300025927 Bacteria 1715
60 Ga0207700_10047223 3300025928 Bacteria 3190
61 Ga0207664_10081728 3300025929 Bacteria 2630
62 Ga0207664_10130047 3300025929 Bacteria 2118
63 Ga0207665_10000685 3300025939 Bacteria 22900
64 Ga0207639_10311394 3300026041 Bacteria 1395
65 Ga0207702_10124620 3300026078 Bacteria 2311
66 Ga0207641_10178910 3300026088 Bacteria 1941
67 Ga0209371_1024868 3300027312 Bacteria 1385
68 Ga0209282_1115276 3300027666 Bacteria 1355
69 Ga0209813_10007360 3300027866 Bacteria 2740
70 Ga0307517_10003610 3300028786 Bacteria 24038
71 Ga0307517_10004268 3300028786 Bacteria 22022
72 Ga0307515_10001178 3300028794 Bacteria 59820
73 Ga0307515_10175996 3300028794 Bacteria 2110
74 Ga0268256_1009124 3300030500 Bacteria 3331
75 Ga0307511_10006909 3300030521 Bacteria 11434
76 Ga0307511_10073069 3300030521 Bacteria 2484
77 Ga0307511_10083615 3300030521 Bacteria 2222
78 Ga0307511_10090842 3300030521 Bacteria 2071
79 Ga0307512_10048985 3300030522 Bacteria 3412
80 Ga0307513_10022441 3300031456 Bacteria 7420
81 Ga0307513_10080919 3300031456 Bacteria 3348
82 Ga0307509_10051213 3300031507 Bacteria 4417
83 Ga0307509_10098008 3300031507 Bacteria 2978
84 Ga0307509_10155578 3300031507 Bacteria 2193
85 Ga0307508_10000988 3300031616 Bacteria 33039
86 Ga0307508_10009504 3300031616 Bacteria 8937
87 Ga0307508_10100193 3300031616 Bacteria 2492
88 Ga0307514_10062437 3300031649 Bacteria 2833
89 Ga0307514_10067467 3300031649 Bacteria 2700
90 Ga0307516_10001402 3300031730 Bacteria 33337
91 Ga0307516_10019976 3300031730 Bacteria 6925
92 Ga0307516_10023172 3300031730 Bacteria 6368
93 Ga0307518_10042923 3300031838 Bacteria 3292
94 Ga0307518_10059094 3300031838 Bacteria 2784
95 Ga0307518_10105909 3300031838 Bacteria 2008
96 Ga0307416_100153292 3300032002 Bacteria 2117
97 Ga0307507_10229314 3300033179 Bacteria 1234
98 Ga0307510_10035767 3300033180 Bacteria 5538
99 Ga0307510_10119547 3300033180 Bacteria 2344
100 Ga0373944_0000226 3300035089 Bacteria 12242
101 Ga0373936_0000614 3300035113 Bacteria 12300
102 Ga0373945_0002143 3300035116 Bacteria 6158
103 Ga0373957_0056259 3300035120 Bacteria 1514
104 Ga0373943_0001500 3300035170 Bacteria 10566
105 Ga0373943_0021759 3300035170 Bacteria 2964
106 Ga0373943_0173240 3300035170 Bacteria 1182
107 Ga0373946_0000920 3300035171 Bacteria 10113
108 Ga0373924_0002432 3300035410 Bacteria 6265
109 Ga0373935_0000873 3300035692 Bacteria 16280
110 Ga0373927_0001048 3300035695 Bacteria 21065
111 Ga0373927_0135920 3300035695 Bacteria 1607
112 Ga0373933_0172486 3300035724 Bacteria 1377
113 Ga0373947_0003271 3300035725 Bacteria 9605
114 Ga0373947_0124076 3300035725 Bacteria 1643
115 Ga0373937_0006751 3300036401 Bacteria 9903
116 Ga0373937_0093866 3300036401 Bacteria 2782
117 Ga0373925_0036592 3300037068 Bacteria 3622
118 Ga0373925_0135334 3300037068 Bacteria 1925
119 Ga0395898_0011572 3300037466 Bacteria 9161
120 Ga0436364_0040082 3300037853 Bacteria 8169
121 Ga0436364_0381949 3300037853 Bacteria 3065
122 Ga0436365_0746795 3300039437 Bacteria 21409
123 Ga0436363_0995507 3300039450 Bacteria 1371
124 Ga0439436_0058816 3300041404 Bacteria 1077
125 Ga0439439_0013273 3300041406 Bacteria 1996
126 Ga0451791_0925667 3300041451 Bacteria 1014
127 Ga0451837_1399963 3300041494 Bacteria 4111
128 Ga0451853_0721026 3300041512 Bacteria 6288
129 Ga0451853_1176982 3300041512 Bacteria 2299
130 Ga0439433_0014091 3300041999 Bacteria 1759
131 Ga0439442_015561 3300042002 Bacteria 1567
132 Ga0439442_030894 3300042002 Bacteria 1118
133 Ga0439448_0003611 3300042005 Bacteria 4305
134 Ga0439449_0002399 3300042007 Bacteria 7330
135 Ga0439449_0092584 3300042007 Bacteria 1116
136 Ga0439455_0001019 3300042012 Bacteria 4413
137 Ga0439457_000284 3300042014 Bacteria 14024
138 Ga0439457_002513 3300042014 Bacteria 5222
139 Ga0439462_0026308 3300042015 Bacteria 1533
140 Ga0450894_000275 3300042131 Bacteria 9228
141 Ga0450896_002213 3300042133 Bacteria 2492
142 Ga0450899_001383 3300042135 Bacteria 2713
143 Ga0450903_000175 3300042138 Bacteria 14130
144 Ga0450906_010561 3300042145 Bacteria 1744
145 Ga0439458_0002847 3300042157 Bacteria 4163
146 Ga0450908_038942 3300042184 Bacteria 824
147 Ga0466969_0034946 3300044656 Bacteria 2545
148 Ga0466969_0150598 3300044656 Bacteria 1072
149 Ga0466972_0011266 3300044658 Bacteria 4487
150 Ga0466972_0018110 3300044658 Bacteria 3523
151 Ga0466965_0000433 3300044683 Bacteria 14524
152 Ga0466966_0000541 3300044684 Bacteria 24070
153 Ga0466966_0008041 3300044684 Bacteria 6988
154 Ga0466966_0019809 3300044684 Bacteria 4425
155 Ga0466966_0042273 3300044684 Bacteria 2926
156 Ga0466966_0135353 3300044684 Bacteria 1507
157 Ga0466961_0006317 3300044693 Bacteria 7523
158 Ga0466961_0009187 3300044693 Bacteria 6295
159 Ga0466961_0056054 3300044693 Bacteria 2511
160 Ga0466961_0124734 3300044693 Bacteria 1616
161 Ga0466961_0191660 3300044693 Bacteria 1267
162 Ga0466963_0000453 3300044694 Bacteria 19007
163 Ga0466963_0027711 3300044694 Bacteria 3631
164 Ga0466963_0036056 3300044694 Bacteria 3224
165 Ga0466971_0001302 3300044719 Bacteria 10423
166 Ga0466971_0012672 3300044719 Bacteria 3697
167 Ga0466971_0232694 3300044719 Bacteria 875
168 Ga0466968_0039260 3300044735 Bacteria 1992
169 Ga0466970_0002585 3300044765 Bacteria 8721
170 Ga0466970_0017103 3300044765 Bacteria 3744
171 Ga0466970_0029207 3300044765 Bacteria 2902
172 Ga0466970_0062389 3300044765 Bacteria 1998
173 Ga0466957_0007477 3300044842 Bacteria 6171
174 Ga0466960_0319494 3300044901 Bacteria 879
175 Ga0466959_0023723 3300045049 Bacteria 4540
176 Ga0466959_0023861 3300045049 Bacteria 4528
177 Ga0466958_0004428 3300045836 Bacteria 7417
178 Ga0466967_0001688 3300045976 Bacteria 13116
179 Ga0495627_042048 3300046453 Bacteria 1402
180 Ga0495592_0004949 3300046454 Bacteria 9803
181 Ga0495592_0018583 3300046454 Bacteria 5289
182 Ga0495603_0017290 3300046455 Bacteria 4366
183 Ga0495603_0041082 3300046455 Bacteria 2766
184 Ga0495590_0052853 3300046457 Bacteria 1419
185 Ga0495629_0013088 3300046459 Bacteria 5994
186 Ga0495629_0013433 3300046459 Bacteria 5906
187 Ga0495629_0019038 3300046459 Bacteria 4909
188 Ga0495629_0048831 3300046459 Bacteria 2967
189 Ga0495629_0059984 3300046459 Bacteria 2659
190 Ga0495629_0119268 3300046459 Bacteria 1838
191 Ga0495629_0160360 3300046459 Bacteria 1562
192 Ga0495638_0019992 3300046460 Bacteria 4426
193 Ga0495638_0111420 3300046460 Bacteria 1625
194 Ga0495641_0007910 3300046461 Bacteria 6565
195 Ga0495641_0110286 3300046461 Bacteria 1228
196 Ga0495651_0005458 3300046462 Bacteria 9700
197 Ga0495651_0024924 3300046462 Bacteria 4654
198 Ga0495651_0026186 3300046462 Bacteria 4542
199 Ga0495651_0269995 3300046462 Bacteria 1153
200 Ga0495653_0001116 3300046463 Bacteria 20658
201 Ga0495653_0079826 3300046463 Bacteria 2422
202 Ga0495653_0121211 3300046463 Bacteria 1864
203 Ga0495653_0140360 3300046463 Bacteria 1700
204 Ga0495582_0102944 3300046473 Bacteria 1599
205 Ga0495605_0014895 3300046474 Bacteria 4242
206 Ga0495639_0025928 3300046475 Bacteria 2587
207 Ga0495639_0080305 3300046475 Bacteria 1518
208 Ga0495662_0000147 3300046476 Bacteria 27603
209 Ga0495662_0000258 3300046476 Bacteria 22452
210 Ga0495662_0033551 3300046476 Bacteria 2480
211 Ga0495662_0037280 3300046476 Bacteria 2348
212 Ga0495664_0001287 3300046477 Bacteria 13152
213 Ga0495664_0013416 3300046477 Bacteria 4647
214 Ga0495664_0022876 3300046477 Bacteria 3625
215 Ga0495664_0050002 3300046477 Bacteria 2481
216 Ga0495664_0079868 3300046477 Bacteria 1960
217 Ga0495585_0094842 3300046492 Bacteria 1603
218 Ga0495585_0145617 3300046492 Bacteria 1238
219 Ga0495585_0167971 3300046492 Bacteria 1135
220 Ga0495585_0214338 3300046492 Bacteria 974
221 Ga0495594_0000823 3300046499 Bacteria 16005
222 Ga0495594_0072444 3300046499 Bacteria 1916
223 Ga0495594_0222446 3300046499 Bacteria 1076
224 Ga0495607_0009181 3300046501 Bacteria 6720
225 Ga0495607_0082611 3300046501 Bacteria 1762
226 Ga0495606_0002466 3300046507 Bacteria 21442
227 Ga0495606_0042087 3300046507 Bacteria 3058
228 Ga0495608_0047206 3300046511 Bacteria 2863
229 Ga0495610_0099424 3300046512 Bacteria 1305
230 Ga0495618_0071566 3300046514 Bacteria 2206
231 Ga0495618_0152582 3300046514 Bacteria 1475
232 Ga0495618_0256972 3300046514 Bacteria 1094
233 Ga0495620_0038023 3300046515 Bacteria 2138
234 Ga0495620_0048500 3300046515 Bacteria 1822
235 Ga0495628_0002288 3300046516 Bacteria 17323
236 Ga0495628_0022825 3300046516 Bacteria 5138
237 Ga0495628_0087660 3300046516 Bacteria 2413
238 Ga0495628_0094138 3300046516 Bacteria 2316
239 Ga0495630_0106814 3300046517 Bacteria 2120
240 Ga0495630_0216902 3300046517 Bacteria 1460
241 Ga0495630_0412729 3300046517 Bacteria 1035
242 Ga0495630_0582830 3300046517 Bacteria 858
243 Ga0495631_0013988 3300046518 Bacteria 3880
244 Ga0495631_0069984 3300046518 Bacteria 1517
245 Ga0495632_0078350 3300046519 Bacteria 1579
246 Ga0495632_0212077 3300046519 Bacteria 878
247 Ga0495643_0003031 3300046522 Bacteria 12631
248 Ga0495643_0004308 3300046522 Bacteria 10027
249 Ga0495643_0183793 3300046522 Bacteria 1014
250 Ga0495648_0016567 3300046524 Bacteria 5308
251 Ga0495648_0155361 3300046524 Bacteria 1188
252 Ga0495666_0022238 3300046526 Bacteria 3139
253 Ga0495666_0032973 3300046526 Bacteria 2532
254 Ga0495666_0099562 3300046526 Bacteria 1370
255 Ga0495652_0001073 3300046529 Bacteria 31003
256 Ga0495652_0008623 3300046529 Bacteria 9291
257 Ga0495652_0008717 3300046529 Bacteria 9241
258 Ga0495652_0019901 3300046529 Bacteria 5969
259 Ga0495652_0144539 3300046529 Bacteria 1866
260 Ga0495652_0170984 3300046529 Bacteria 1677
261 Ga0495665_0003626 3300046531 Bacteria 8378
262 Ga0495640_0000167 3300046533 Bacteria 42901
263 Ga0495640_0005657 3300046533 Bacteria 9939
264 Ga0495640_0048538 3300046533 Bacteria 2933
265 Ga0495640_0085572 3300046533 Bacteria 2089
266 Ga0495640_0168634 3300046533 Bacteria 1399
267 Ga0495586_0081486 3300046535 Bacteria 1778
268 Ga0495587_0001305 3300046536 Bacteria 16567
269 Ga0495587_0031188 3300046536 Bacteria 3229
270 Ga0495587_0213413 3300046536 Bacteria 1089
271 Ga0495609_0012702 3300046538 Bacteria 3992
272 Ga0495597_0061205 3300046542 Bacteria 1640
273 Ga0495597_0084903 3300046542 Bacteria 1349
274 Ga0495645_0011680 3300046543 Bacteria 6182
275 Ga0495645_0020780 3300046543 Bacteria 4742
276 Ga0495622_0012173 3300046557 Bacteria 3979
277 Ga0495622_0025203 3300046557 Bacteria 2777
278 Ga0495633_0022864 3300046558 Bacteria 3102
279 Ga0495633_0086666 3300046558 Bacteria 1456
280 Ga0495667_0013195 3300046559 Bacteria 5595
281 Ga0495667_0013384 3300046559 Bacteria 5553
282 Ga0495668_0002160 3300046616 Bacteria 16878
283 Ga0495668_0025448 3300046616 Bacteria 3362
284 Ga0495634_0000435 3300046642 Bacteria 41620
285 Ga0495634_0018627 3300046642 Bacteria 4939
286 Ga0495634_0039867 3300046642 Bacteria 3196
287 Ga0495634_0058783 3300046642 Bacteria 2562
288 Ga0495634_0105850 3300046642 Bacteria 1813
289 Ga0495611_0014047 3300046648 Bacteria 3416
290 Ga0495611_0103326 3300046648 Bacteria 1324
291 Ga0495611_0216606 3300046648 Bacteria 891
292 Ga0495625_0000730 3300046660 Bacteria 46115
293 Ga0495625_0093318 3300046660 Bacteria 2078
294 Ga0495635_0008773 3300046663 Bacteria 7058
295 Ga0495635_0051729 3300046663 Bacteria 2830
296 Ga0495635_0064682 3300046663 Bacteria 2510
297 Ga0495635_0081742 3300046663 Bacteria 2210
298 Ga0495635_0125868 3300046663 Bacteria 1747
299 Ga0495588_0048173 3300046674 Bacteria 2189
300 Ga0495588_0148212 3300046674 Bacteria 1240
301 Ga0495657_0005025 3300046675 Bacteria 10509
302 Ga0495657_0008211 3300046675 Bacteria 7999
303 Ga0495657_0015846 3300046675 Bacteria 5505
304 Ga0495657_0064938 3300046675 Bacteria 2401
305 Ga0495657_0089367 3300046675 Bacteria 1979
306 Ga0495599_0028644 3300046678 Bacteria 3490
307 Ga0495599_0035442 3300046678 Bacteria 3132
308 Ga0495599_0164331 3300046678 Bacteria 1371
309 Ga0495623_0023122 3300046679 Bacteria 4011
310 Ga0495623_0178210 3300046679 Bacteria 1236
311 Ga0495646_0000981 3300046680 Bacteria 16376
312 Ga0495646_0006952 3300046680 Bacteria 7182
313 Ga0495647_0026750 3300046681 Bacteria 2116
314 Ga0495613_0004378 3300046689 Bacteria 10565
315 Ga0495613_0005104 3300046689 Bacteria 9843
316 Ga0495613_0026334 3300046689 Bacteria 4333
317 Ga0495613_0035535 3300046689 Bacteria 3697
318 Ga0495613_0110039 3300046689 Bacteria 1985
319 Ga0495613_0246631 3300046689 Bacteria 1247
320 Ga0495613_0252139 3300046689 Bacteria 1231
321 Ga0495624_0002608 3300046690 Bacteria 13603
322 Ga0495624_0004492 3300046690 Bacteria 10203
323 Ga0495624_0040897 3300046690 Bacteria 2968
324 Ga0495624_0059481 3300046690 Bacteria 2397
325 Ga0495624_0089574 3300046690 Bacteria 1898
326 Ga0495624_0283838 3300046690 Bacteria 999
327 Ga0495670_0014744 3300046691 Bacteria 3846
328 Ga0495670_0073579 3300046691 Bacteria 1732
329 Ga0495670_0314704 3300046691 Bacteria 840
330 Ga0495671_0050377 3300046692 Bacteria 2073
331 Ga0495649_0022440 3300046694 Bacteria 3532
332 Ga0495589_0007368 3300046794 Bacteria 5760
333 Ga0495589_0036832 3300046794 Bacteria 2452
334 Ga0495589_0058084 3300046794 Bacteria 1902
335 Ga0495589_0078099 3300046794 Bacteria 1612
336 Ga0495600_0004206 3300046809 Bacteria 8591
337 Ga0495600_0028560 3300046809 Bacteria 3609
338 Ga0495600_0070454 3300046809 Bacteria 2284
339 Ga0495600_0073125 3300046809 Bacteria 2238
340 Ga0495581_0007810 3300047315 Bacteria 6196
341 Ga0495581_0093196 3300047315 Bacteria 1748
342 Ga0495604_0003588 3300047317 Bacteria 12368
343 Ga0495604_0006902 3300047317 Bacteria 9003
344 Ga0495604_0020163 3300047317 Bacteria 5327
345 Ga0495604_0027637 3300047317 Bacteria 4510
346 Ga0495604_0034355 3300047317 Bacteria 4011
347 Ga0495604_0086961 3300047317 Bacteria 2329
348 Ga0495636_0002162 3300047318 Bacteria 7539
349 Ga0495636_0067467 3300047318 Bacteria 1522
350 Ga0495636_0129933 3300047318 Bacteria 1120
351 Ga0495674_0000554 3300047319 Bacteria 34730
352 Ga0495674_0015213 3300047319 Bacteria 7197
353 Ga0495674_0074978 3300047319 Bacteria 2912
354 Ga0495676_0001924 3300047321 Bacteria 18208
355 Ga0495676_0002496 3300047321 Bacteria 16373
356 Ga0495676_0008482 3300047321 Bacteria 9415
357 Ga0495676_0011743 3300047321 Bacteria 7900
358 Ga0495676_0023875 3300047321 Bacteria 5298
359 Ga0495676_0043001 3300047321 Bacteria 3701
360 Ga0495680_0006322 3300047322 Bacteria 11026
361 Ga0495680_0009120 3300047322 Bacteria 8953
362 Ga0495680_0074121 3300047322 Bacteria 2585
363 Ga0495683_0028841 3300047323 Bacteria 2837
364 Ga0495683_0046889 3300047323 Bacteria 2169
365 Ga0495683_0093025 3300047323 Bacteria 1458
366 Ga0495687_007292 3300047443 Bacteria 6550
367 Ga0495687_011579 3300047443 Bacteria 4732
368 Ga0495687_060237 3300047443 Bacteria 1566
369 Ga0495675_0022572 3300047444 Bacteria 4011
370 Ga0495675_0129102 3300047444 Bacteria 1572
371 Ga0495675_0199603 3300047444 Bacteria 1218
372 Ga0495675_0201369 3300047444 Bacteria 1211
373 Ga0495677_0088322 3300047445 Bacteria 1167
374 Ga0495679_081446 3300047446 Bacteria 918
375 Ga0495685_000179 3300047447 Bacteria 21142
376 Ga0495685_008409 3300047447 Bacteria 3427
377 Ga0495685_025646 3300047447 Bacteria 2027
378 Ga0495685_030903 3300047447 Bacteria 1842
379 Ga0495685_034549 3300047447 Bacteria 1737
380 Ga0495685_037634 3300047447 Bacteria 1658
381 Ga0495681_0001221 3300047470 Bacteria 19566
382 Ga0495681_0011537 3300047470 Bacteria 5254
383 Ga0495681_0027898 3300047470 Bacteria 2915
384 Ga0495684_0002664 3300047471 Bacteria 14149
385 Ga0495684_0018463 3300047471 Bacteria 5373
386 Ga0495684_0036801 3300047471 Bacteria 3752
387 Ga0495686_0052102 3300047472 Bacteria 2566
388 Ga0495686_0119308 3300047472 Bacteria 1574
389 Ga0495593_0002876 3300047673 Bacteria 10381
390 Ga0495593_0097878 3300047673 Bacteria 1507
391 Ga0495602_0028832 3300048088 Bacteria 5304
392 Ga0495602_0129184 3300048088 Bacteria 2018
393 Ga0495602_0156606 3300048088 Bacteria 1783
394 Ga0495602_0414750 3300048088 Bacteria 957
395 Ga0495614_0000629 3300048089 Bacteria 14764
396 Ga0495614_0016171 3300048089 Bacteria 3248
397 Ga0495614_0028902 3300048089 Bacteria 2386
398 Ga0495626_0000241 3300048091 Bacteria 63323
399 Ga0495626_0026743 3300048091 Bacteria 2808
400 Ga0496102_0117255 3300048905 Bacteria 2484
401 Ga0496104_0009005 3300048907 Bacteria 8876
402 Ga0496105_0005445 3300048908 Bacteria 9658
403 Ga0496106_0419157 3300048909 Bacteria 1076
404 Ga0496107_0242481 3300048910 Bacteria 1341
405 Ga0496108_0006050 3300048911 Bacteria 9792
406 Ga0496108_0638384 3300048911 Bacteria 926
407 Ga0496109_0162268 3300048912 Bacteria 2094
408 Ga0496109_0235954 3300048912 Bacteria 1721
409 Ga0496110_0417145 3300048913 Bacteria 1224
410 Ga0496113_0064091 3300048916 Bacteria 2778
411 Ga0496115_0034371 3300048918 Bacteria 4006
412 Ga0495682_0041213 3300049460 Bacteria 1693
413 Ga0501031_0020049 3300049568 Bacteria 4358
414 Ga0501031_0022790 3300049568 Bacteria 4082
415 Ga0501031_0204951 3300049568 Bacteria 1286
416 Ga0501031_0248639 3300049568 Bacteria 1156
417 Ga0501032_0011024 3300049569 Bacteria 6498
418 Ga0501032_0187479 3300049569 Bacteria 1353
419 Ga0501033_0008132 3300049570 Bacteria 8121
420 Ga0501033_0075167 3300049570 Bacteria 2480
421 Ga0501034_0054085 3300049571 Bacteria 4041
422 Ga0501034_0153169 3300049571 Bacteria 2281
423 Ga0501034_0240314 3300049571 Bacteria 1757
424 Ga0501036_0000345 3300049572 Bacteria 32636
425 Ga0501036_0035305 3300049572 Bacteria 4230
426 Ga0501036_0051252 3300049572 Bacteria 3494
427 Ga0501036_0057484 3300049572 Bacteria 3295
428 Ga0501036_0147140 3300049572 Bacteria 1987
429 Ga0501036_0457265 3300049572 Bacteria 1063
430 Ga0501037_0103353 3300049573 Bacteria 2055
431 Ga0501037_0105461 3300049573 Bacteria 2031
432 Ga0501037_0153376 3300049573 Bacteria 1645
433 Ga0501037_0257217 3300049573 Bacteria 1220
434 Ga0501038_0029146 3300049574 Bacteria 4895
435 Ga0501038_0034183 3300049574 Bacteria 4473
436 Ga0501038_0081114 3300049574 Bacteria 2733
437 Ga0501038_0108687 3300049574 Bacteria 2299
438 Ga0501038_0343243 3300049574 Bacteria 1164
439 Ga0501039_0037637 3300049575 Bacteria 3735
440 Ga0501039_0039110 3300049575 Bacteria 3663
441 Ga0501039_0136298 3300049575 Bacteria 1927
442 Ga0501040_0004864 3300049576 Bacteria 8697
443 Ga0501040_0015476 3300049576 Bacteria 5040
444 Ga0501041_0027036 3300049577 Bacteria 3455
445 Ga0501041_0031559 3300049577 Bacteria 3202
446 Ga0501042_0016932 3300049578 Bacteria 5016
447 Ga0501043_0007930 3300049579 Bacteria 8391
448 Ga0501043_0047310 3300049579 Bacteria 3381
449 Ga0501043_0277112 3300049579 Bacteria 1286
450 Ga0501043_0370640 3300049579 Bacteria 1085
451 Ga0501046_0007107 3300049580 Bacteria 9849
452 Ga0501046_0100994 3300049580 Bacteria 2213
453 Ga0501047_0011079 3300049581 Bacteria 8533
454 Ga0501047_0052964 3300049581 Bacteria 3923
455 Ga0501047_0090206 3300049581 Bacteria 2942
456 Ga0501047_0099051 3300049581 Bacteria 2793
457 Ga0501047_0247635 3300049581 Bacteria 1631
458 Ga0501047_0258182 3300049581 Bacteria 1590
459 Ga0501047_0393597 3300049581 Bacteria 1219
460 Ga0501048_0044027 3300049582 Bacteria 3193
461 Ga0501067_0005507 3300049583 Bacteria 7020
462 Ga0501068_0004786 3300049584 Bacteria 7367
463 Ga0501070_0000263 3300049586 Bacteria 49655
464 Ga0501070_0061066 3300049586 Bacteria 3124
465 Ga0501070_0474596 3300049586 Bacteria 1007
466 Ga0501071_0023639 3300049587 Bacteria 4292
467 Ga0501072_0021490 3300049588 Bacteria 5003
468 Ga0501072_0023008 3300049588 Bacteria 4838
469 Ga0501073_0416170 3300049589 Bacteria 929
470 Ga0501074_0010341 3300049590 Bacteria 6770
471 Ga0501074_0057130 3300049590 Bacteria 2811
472 Ga0501075_0021506 3300049591 Bacteria 4705
473 Ga0501076_0017795 3300049592 Bacteria 5403
474 Ga0501077_0010506 3300049593 Bacteria 5763
475 Ga0501077_0030751 3300049593 Bacteria 3417
476 Ga0501079_0018264 3300049741 Bacteria 5358
477 Ga0501081_0424851 3300049743 Bacteria 986
478 Ga0501083_0005065 3300049744 Bacteria 9336
479 Ga0501282_008453 3300049778 Bacteria 1103
480 Ga0501035_0003454 3300049822 Bacteria 15119
481 Ga0501035_0010534 3300049822 Bacteria 8568
482 Ga0501035_0016638 3300049822 Bacteria 6782
483 Ga0501035_0041127 3300049822 Bacteria 4175
484 Ga0501035_0109245 3300049822 Bacteria 2424
485 Ga0501035_0122391 3300049822 Bacteria 2273
486 Ga0501035_0180333 3300049822 Bacteria 1819
487 Ga0501035_0243109 3300049822 Bacteria 1530
488 Ga0501044_0001704 3300049823 Bacteria 25802
489 Ga0501044_0028777 3300049823 Bacteria 5861
490 Ga0501044_0211130 3300049823 Bacteria 1895
491 Ga0501044_0275020 3300049823 Bacteria 1619
492 Ga0501044_0290101 3300049823 Bacteria 1568
493 Ga0501044_0328264 3300049823 Bacteria 1453
494 Ga0501045_0027120 3300049824 Bacteria 4125
495 Ga0501045_0075022 3300049824 Bacteria 2490
496 nmdc:mga03n38_10286_c1 3300050490 Bacteria 3434
497 nmdc:mga0yw44_82597_c1 3300050492 Bacteria 2016
498 nmdc:mga06z11_2058_c1 3300050494 Bacteria 7634
499 nmdc:mga04h51_8558_c1 3300050495 Bacteria 2740
500 nmdc:mga07m45_110554_c1 3300050496 Bacteria 1582
501 nmdc:mga07m45_232864_c1 3300050496 Bacteria 1072
502 nmdc:mga08x19_86485_c1 3300050514 Bacteria 2064
503 Ga0495601_0194701 3300053077 Bacteria 1325
504 Ga0495601_0249418 3300053077 Bacteria 1159
505 Ga0495612_0118845 3300053078 Bacteria 1136
506 Ga0500610_0096159 3300053079 Bacteria 1536
507 Ga0495619_0210254 3300053085 Bacteria 1347
508 Ga0495619_0315745 3300053085 Bacteria 1082
509 Ga0500578_0007770 3300053086 Bacteria 7057
510 Ga0500578_0133419 3300053086 Bacteria 1556
511 Ga0500644_0084105 3300053088 Bacteria 1177
512 Ga0500640_071546 3300053095 Bacteria 1486
513 Ga0500641_0113391 3300053096 Bacteria 1167
514 Ga0500560_025472 3300053107 Bacteria 1737
515 Ga0500569_001918 3300053109 Bacteria 4019
516 Ga0500628_001728 3300053129 Bacteria 3688
517 Ga0500652_002052 3300053131 Bacteria 6063
518 Ga0500658_0003725 3300053134 Bacteria 5742
519 Ga0500561_0007019 3300053137 Bacteria 2175
520 Ga0500573_0003345 3300053140 Bacteria 8287
521 Ga0500573_0025080 3300053140 Bacteria 3429
522 Ga0500579_030691 3300053143 Bacteria 3449
523 Ga0500600_0002908 3300053149 Bacteria 9721
524 Ga0500600_0138250 3300053149 Bacteria 1230
525 Ga0500616_0012323 3300053153 Bacteria 5006
526 Ga0500624_006455 3300053157 Bacteria 1587
527 Ga0500627_0169895 3300053158 Bacteria 983
528 Ga0500633_0002061 3300053160 Bacteria 4031
529 Ga0500634_0003166 3300053161 Bacteria 7238
530 Ga0500656_005305 3300053732 Bacteria 1270
531 Ga0500587_000069 3300053739 Bacteria 8394
532 Ga0501084_0010225 3300054114 Bacteria 7761
533 Ga0501084_0042745 3300054114 Bacteria 3791
534 Ga0501082_0053196 3300060353 Bacteria 3490
535 Ga0466962_0023545 3300061719 Bacteria 2960
536 Ga0466962_0053882 3300061719 Bacteria 1922
537 Ga0530510_0048412 3300061734 Bacteria 3072
538 8008567455 8008558824 Bacteria 10610750
539 2547408040 2547132111 Bacteria 8013147
540 2554257986 2554235005 Bacteria 6457341
541 2585302213 2582581312 Bacteria 7308206
542 2585308604 2582581313 Bacteria 10042643
543 2585318709 2582581314 Bacteria 11452267
544 2616695253 2616644814 Bacteria 11555299
545 2616903929 2616644941 Bacteria 8510691
546 2643765738 2643221548 Bacteria 8053412
547 2643898468 2643221578 Bacteria 9213798
548 2643948309 2643221587 Bacteria 7586415
549 2644264143 2643221647 Bacteria 10741251
550 2644388721 2643221670 Bacteria 6497041
551 2644406384 2643221673 Bacteria 9196637
552 2644429782 2643221677 Bacteria 7584031
553 2644437032 2643221678 Bacteria 9540101
554 2644459850 2643221682 Bacteria 6743283
555 2784588493 2784132148 Bacteria 8627943
556 2785343469 2784746763 Bacteria 9783172
557 2785369331 2784746768 Bacteria 10036182
558 2786670464 2786546132 Bacteria 10419719
559 2793984520 2791355406 Bacteria 11364898
560 2808841931 2808606359 Bacteria 9866990
561 2809232089 2808606448 Bacteria 8656184
562 2811848842 2808606982 Bacteria 7791042
563 2812480682 2811994917 Bacteria 7761064
564 2819697973 2818991463 Bacteria 7948711
565 2852636822 2852635781 Bacteria 8251373
566 2862181924 2862178590 Bacteria 8583590
567 2862285533 2862281513 Bacteria 9621493
568 2862293339 2862290372 Bacteria 7471434
569 2862386111 2862382967 Bacteria 10317375
570 2862515268 2862507626 Bacteria 9425308
571 2862579351 2862574272 Bacteria 10567477
572 2867434227 2867428634 Bacteria 9590268
573 2873155858 2873151551 Bacteria 8625867
574 2875394448 2875391855 Bacteria 7600475
575 2877681220 2877676314 Bacteria 9512378
576 2887480975 2887478801 Bacteria 8972725
577 2912724445 2912723979 Bacteria 8557534
578 2918504415 2918501144 Bacteria 8668083
579 2919469626 2919468124 Bacteria 9133025
580 2946075801 2946072368 Bacteria 8999607
581 2947229451 2947224130 Bacteria 9938529
582 2954007613 2954002825 Bacteria 9173742
583 2954386369 2954380949 Bacteria 10050426
584 2954676810 2954673503 Bacteria 9685905
585 2954687356 2954682443 Bacteria 9862841
586 2954697040 2954691527 Bacteria 10720516
587 2954705093 2954701450 Bacteria 10834262
588 2954716353 2954711539 Bacteria 10867210
589 2954726297 2954721474 Bacteria 10456478
590 2954745221 2954740390 Bacteria 10229294
591 2954754368 2954749733 Bacteria 10366972
592 2954764196 2954759201 Bacteria 9358192
593 2966602671 2966598605 Bacteria 7676064
594 2990062096 2990059506 Bacteria 9321252
595 2995464171 2995463766 Bacteria 8577691
596 3006327050 3006321560 Bacteria 8247479
597 3006492210 3006486233 Bacteria 8157040
598 3006496180 3006493962 Bacteria 8825450
599 8001785356 8001781756 Bacteria 9586736
600 8008488846 8008485437 Bacteria 7198341
601 8008578955 8008574985 Bacteria 7815457
602 8023631263 8023623736 Bacteria 8593882
603 8025414363 8025413630 Bacteria 7014048
604 8025528329 8025524527 Bacteria 7197316
605 8025536511 8025530807 Bacteria 8495698
606 8047896721 8047893842 Bacteria 11723082
607 8048129903 8048127548 Bacteria 11053136
608 8048362201 8048356638 Bacteria 11044339
609 8048373734 8048369669 Bacteria 11666822
610 8048384494 8048379754 Bacteria 11877923
611 8048410174 8048406513 Bacteria 8936924
612 8056831851 8056829672 Bacteria 9045328
613 JGI24739J22299_10004205
614 JGI24737J22298_10009073
615 JGI24738J21930_10016824
616 Ga0006759J45824_1087315
617 Ga0006562J51391_1065942
618 Ga0006562J51391_1137583
619 Ga0007429J51699_1018962
620 Ga0007429J51699_1050781
621 Ga0032354_1036702
622 Ga0070683_100755125
623 Ga0070714_100060446
624 Ga0070713_100369425
625 Ga0070710_10046672
626 Ga0070710_10103510
627 Ga0070711_100020621
628 Ga0070711_100201692
629 Ga0070681_10711624
630 Ga0070707_100036619
631 Ga0070699_100003959
632 Ga0070684_100320869
633 Ga0070697_100164203
634 Ga0068856_100096520
635 Ga0068863_100150247
636 Ga0070717_10081261
637 Ga0075368_10006104
638 Ga0075363_100006154
639 Ga0070715_10005589
640 Ga0070716_100018208
641 Ga0070712_100094796
642 Ga0070712_100115771
643 Ga0075367_10014387
644 Ga0075370_10059297
645 Ga0099826_10064064
646 Ga0105251_10004016
647 Ga0105245_10254532
648 Ga0105243_10634946
649 Ga0105242_10466410
650 Ga0105239_10134901
651 Ga0105246_10004492
652 Ga0105246_10232695
653 Ga0105246_10447298
654 Ga0157369_10161665
655 Ga0157372_10077839
656 Ga0182008_10000456
657 Ga0182007_10003402
658 Ga0182005_1006184
659 Ga0183367_1005
660 Ga0213875_10032259
661 Ga0224712_10201798
662 Ga0207426_1018911
663 Ga0207692_10021530
664 Ga0207692_10097110
665 Ga0207647_10003562
666 Ga0207685_10043255
667 Ga0207699_10202064
668 Ga0207699_10377733
669 Ga0207693_10033862
670 Ga0207663_10093616
671 Ga0207687_10162484
672 Ga0207700_10047223
673 Ga0207664_10081728
674 Ga0207664_10130047
675 Ga0207665_10000685
676 Ga0207639_10311394
677 Ga0207702_10124620
678 Ga0207641_10178910
679 Ga0209371_1024868
680 Ga0209282_1115276
681 Ga0209813_10007360
682 Ga0307517_10003610
683 Ga0307517_10004268
684 Ga0307515_10001178
685 Ga0307515_10175996
686 Ga0268256_1009124
687 Ga0307511_10006909
688 Ga0307511_10073069
689 Ga0307511_10083615
690 Ga0307511_10090842
691 Ga0307512_10048985
692 Ga0307513_10022441
693 Ga0307513_10080919
694 Ga0307509_10051213
695 Ga0307509_10098008
696 Ga0307509_10155578
697 Ga0307508_10000988
698 Ga0307508_10009504
699 Ga0307508_10100193
700 Ga0307514_10062437
701 Ga0307514_10067467
702 Ga0307516_10001402
703 Ga0307516_10019976
704 Ga0307516_10023172
705 Ga0307518_10042923
706 Ga0307518_10059094
707 Ga0307518_10105909
708 Ga0307416_100153292
709 Ga0307507_10229314
710 Ga0307510_10035767
711 Ga0307510_10119547
712 Ga0373944_0000226
713 Ga0373936_0000614
714 Ga0373945_0002143
715 Ga0373957_0056259
716 Ga0373943_0001500
717 Ga0373943_0021759
718 Ga0373943_0173240
719 Ga0373946_0000920
720 Ga0373924_0002432
721 Ga0373935_0000873
722 Ga0373927_0001048
723 Ga0373927_0135920
724 Ga0373933_0172486
725 Ga0373947_0003271
726 Ga0373947_0124076
727 Ga0373937_0006751
728 Ga0373937_0093866
729 Ga0373925_0036592
730 Ga0373925_0135334
731 Ga0395898_0011572
732 Ga0436364_0040082
733 Ga0436364_0381949
734 Ga0436365_0746795
735 Ga0436363_0995507
736 Ga0439436_0058816
737 Ga0439439_0013273
738 Ga0451791_0925667
739 Ga0451837_1399963
740 Ga0451853_0721026
741 Ga0451853_1176982
742 Ga0439433_0014091
743 Ga0439442_015561
744 Ga0439442_030894
745 Ga0439448_0003611
746 Ga0439449_0002399
747 Ga0439449_0092584
748 Ga0439455_0001019
749 Ga0439457_000284
750 Ga0439457_002513
751 Ga0439462_0026308
752 Ga0450894_000275
753 Ga0450896_002213
754 Ga0450899_001383
755 Ga0450903_000175
756 Ga0450906_010561
757 Ga0439458_0002847
758 Ga0450908_038942
759 Ga0466969_0034946
760 Ga0466969_0150598
761 Ga0466972_0011266
762 Ga0466972_0018110
763 Ga0466965_0000433
764 Ga0466966_0000541
765 Ga0466966_0008041
766 Ga0466966_0019809
767 Ga0466966_0042273
768 Ga0466966_0135353
769 Ga0466961_0006317
770 Ga0466961_0009187
771 Ga0466961_0056054
772 Ga0466961_0124734
773 Ga0466961_0191660
774 Ga0466963_0000453
775 Ga0466963_0027711
776 Ga0466963_0036056
777 Ga0466971_0001302
778 Ga0466971_0012672
779 Ga0466971_0232694
780 Ga0466968_0039260
781 Ga0466970_0002585
782 Ga0466970_0017103
783 Ga0466970_0029207
784 Ga0466970_0062389
785 Ga0466957_0007477
786 Ga0466960_0319494
787 Ga0466959_0023723
788 Ga0466959_0023861
789 Ga0466958_0004428
790 Ga0466967_0001688
791 Ga0495627_042048
792 Ga0495592_0004949
793 Ga0495592_0018583
794 Ga0495603_0017290
795 Ga0495603_0041082
796 Ga0495590_0052853
797 Ga0495629_0013088
798 Ga0495629_0013433
799 Ga0495629_0019038
800 Ga0495629_0048831
801 Ga0495629_0059984
802 Ga0495629_0119268
803 Ga0495629_0160360
804 Ga0495638_0019992
805 Ga0495638_0111420
806 Ga0495641_0007910
807 Ga0495641_0110286
808 Ga0495651_0005458
809 Ga0495651_0024924
810 Ga0495651_0026186
811 Ga0495651_0269995
812 Ga0495653_0001116
813 Ga0495653_0079826
814 Ga0495653_0121211
815 Ga0495653_0140360
816 Ga0495582_0102944
817 Ga0495605_0014895
818 Ga0495639_0025928
819 Ga0495639_0080305
820 Ga0495662_0000147
821 Ga0495662_0000258
822 Ga0495662_0033551
823 Ga0495662_0037280
824 Ga0495664_0001287
825 Ga0495664_0013416
826 Ga0495664_0022876
827 Ga0495664_0050002
828 Ga0495664_0079868
829 Ga0495585_0094842
830 Ga0495585_0145617
831 Ga0495585_0167971
832 Ga0495585_0214338
833 Ga0495594_0000823
834 Ga0495594_0072444
835 Ga0495594_0222446
836 Ga0495607_0009181
837 Ga0495607_0082611
838 Ga0495606_0002466
839 Ga0495606_0042087
840 Ga0495608_0047206
841 Ga0495610_0099424
842 Ga0495618_0071566
843 Ga0495618_0152582
844 Ga0495618_0256972
845 Ga0495620_0038023
846 Ga0495620_0048500
847 Ga0495628_0002288
848 Ga0495628_0022825
849 Ga0495628_0087660
850 Ga0495628_0094138
851 Ga0495630_0106814
852 Ga0495630_0216902
853 Ga0495630_0412729
854 Ga0495630_0582830
855 Ga0495631_0013988
856 Ga0495631_0069984
857 Ga0495632_0078350
858 Ga0495632_0212077
859 Ga0495643_0003031
860 Ga0495643_0004308
861 Ga0495643_0183793
862 Ga0495648_0016567
863 Ga0495648_0155361
864 Ga0495666_0022238
865 Ga0495666_0032973
866 Ga0495666_0099562
867 Ga0495652_0001073
868 Ga0495652_0008623
869 Ga0495652_0008717
870 Ga0495652_0019901
871 Ga0495652_0144539
872 Ga0495652_0170984
873 Ga0495665_0003626
874 Ga0495640_0000167
875 Ga0495640_0005657
876 Ga0495640_0048538
877 Ga0495640_0085572
878 Ga0495640_0168634
879 Ga0495586_0081486
880 Ga0495587_0001305
881 Ga0495587_0031188
882 Ga0495587_0213413
883 Ga0495609_0012702
884 Ga0495597_0061205
885 Ga0495597_0084903
886 Ga0495645_0011680
887 Ga0495645_0020780
888 Ga0495622_0012173
889 Ga0495622_0025203
890 Ga0495633_0022864
891 Ga0495633_0086666
892 Ga0495667_0013195
893 Ga0495667_0013384
894 Ga0495668_0002160
895 Ga0495668_0025448
896 Ga0495634_0000435
897 Ga0495634_0018627
898 Ga0495634_0039867
899 Ga0495634_0058783
900 Ga0495634_0105850
901 Ga0495611_0014047
902 Ga0495611_0103326
903 Ga0495611_0216606
904 Ga0495625_0000730
905 Ga0495625_0093318
906 Ga0495635_0008773
907 Ga0495635_0051729
908 Ga0495635_0064682
909 Ga0495635_0081742
910 Ga0495635_0125868
911 Ga0495588_0048173
912 Ga0495588_0148212
913 Ga0495657_0005025
914 Ga0495657_0008211
915 Ga0495657_0015846
916 Ga0495657_0064938
917 Ga0495657_0089367
918 Ga0495599_0028644
919 Ga0495599_0035442
920 Ga0495599_0164331
921 Ga0495623_0023122
922 Ga0495623_0178210
923 Ga0495646_0000981
924 Ga0495646_0006952
925 Ga0495647_0026750
926 Ga0495613_0004378
927 Ga0495613_0005104
928 Ga0495613_0026334
929 Ga0495613_0035535
930 Ga0495613_0110039
931 Ga0495613_0246631
932 Ga0495613_0252139
933 Ga0495624_0002608
934 Ga0495624_0004492
935 Ga0495624_0040897
936 Ga0495624_0059481
937 Ga0495624_0089574
938 Ga0495624_0283838
939 Ga0495670_0014744
940 Ga0495670_0073579
941 Ga0495670_0314704
942 Ga0495671_0050377
943 Ga0495649_0022440
944 Ga0495589_0007368
945 Ga0495589_0036832
946 Ga0495589_0058084
947 Ga0495589_0078099
948 Ga0495600_0004206
949 Ga0495600_0028560
950 Ga0495600_0070454
951 Ga0495600_0073125
952 Ga0495581_0007810
953 Ga0495581_0093196
954 Ga0495604_0003588
955 Ga0495604_0006902
956 Ga0495604_0020163
957 Ga0495604_0027637
958 Ga0495604_0034355
959 Ga0495604_0086961
960 Ga0495636_0002162
961 Ga0495636_0067467
962 Ga0495636_0129933
963 Ga0495674_0000554
964 Ga0495674_0015213
965 Ga0495674_0074978
966 Ga0495676_0001924
967 Ga0495676_0002496
968 Ga0495676_0008482
969 Ga0495676_0011743
970 Ga0495676_0023875
971 Ga0495676_0043001
972 Ga0495680_0006322
973 Ga0495680_0009120
974 Ga0495680_0074121
975 Ga0495683_0028841
976 Ga0495683_0046889
977 Ga0495683_0093025
978 Ga0495687_007292
979 Ga0495687_011579
980 Ga0495687_060237
981 Ga0495675_0022572
982 Ga0495675_0129102
983 Ga0495675_0199603
984 Ga0495675_0201369
985 Ga0495677_0088322
986 Ga0495679_081446
987 Ga0495685_000179
988 Ga0495685_008409
989 Ga0495685_025646
990 Ga0495685_030903
991 Ga0495685_034549
992 Ga0495685_037634
993 Ga0495681_0001221
994 Ga0495681_0011537
995 Ga0495681_0027898
996 Ga0495684_0002664
997 Ga0495684_0018463
998 Ga0495684_0036801
999 Ga0495686_0052102
1000 Ga0495686_0119308
1001 Ga0495593_0002876
1002 Ga0495593_0097878
1003 Ga0495602_0028832
1004 Ga0495602_0129184
1005 Ga0495602_0156606
1006 Ga0495602_0414750
1007 Ga0495614_0000629
1008 Ga0495614_0016171
1009 Ga0495614_0028902
1010 Ga0495626_0000241
1011 Ga0495626_0026743
1012 Ga0496102_0117255
1013 Ga0496104_0009005
1014 Ga0496105_0005445
1015 Ga0496106_0419157
1016 Ga0496107_0242481
1017 Ga0496108_0006050
1018 Ga0496108_0638384
1019 Ga0496109_0162268
1020 Ga0496109_0235954
1021 Ga0496110_0417145
1022 Ga0496113_0064091
1023 Ga0496115_0034371
1024 Ga0495682_0041213
1025 Ga0501031_0020049
1026 Ga0501031_0022790
1027 Ga0501031_0204951
1028 Ga0501031_0248639
1029 Ga0501032_0011024
1030 Ga0501032_0187479
1031 Ga0501033_0008132
1032 Ga0501033_0075167
1033 Ga0501034_0054085
1034 Ga0501034_0153169
1035 Ga0501034_0240314
1036 Ga0501036_0000345
1037 Ga0501036_0035305
1038 Ga0501036_0051252
1039 Ga0501036_0057484
1040 Ga0501036_0147140
1041 Ga0501036_0457265
1042 Ga0501037_0103353
1043 Ga0501037_0105461
1044 Ga0501037_0153376
1045 Ga0501037_0257217
1046 Ga0501038_0029146
1047 Ga0501038_0034183
1048 Ga0501038_0081114
1049 Ga0501038_0108687
1050 Ga0501038_0343243
1051 Ga0501039_0037637
1052 Ga0501039_0039110
1053 Ga0501039_0136298
1054 Ga0501040_0004864
1055 Ga0501040_0015476
1056 Ga0501041_0027036
1057 Ga0501041_0031559
1058 Ga0501042_0016932
1059 Ga0501043_0007930
1060 Ga0501043_0047310
1061 Ga0501043_0277112
1062 Ga0501043_0370640
1063 Ga0501046_0007107
1064 Ga0501046_0100994
1065 Ga0501047_0011079
1066 Ga0501047_0052964
1067 Ga0501047_0090206
1068 Ga0501047_0099051
1069 Ga0501047_0247635
1070 Ga0501047_0258182
1071 Ga0501047_0393597
1072 Ga0501048_0044027
1073 Ga0501067_0005507
1074 Ga0501068_0004786
1075 Ga0501070_0000263
1076 Ga0501070_0061066
1077 Ga0501070_0474596
1078 Ga0501071_0023639
1079 Ga0501072_0021490
1080 Ga0501072_0023008
1081 Ga0501073_0416170
1082 Ga0501074_0010341
1083 Ga0501074_0057130
1084 Ga0501075_0021506
1085 Ga0501076_0017795
1086 Ga0501077_0010506
1087 Ga0501077_0030751
1088 Ga0501079_0018264
1089 Ga0501081_0424851
1090 Ga0501083_0005065
1091 Ga0501282_008453
1092 Ga0501035_0003454
1093 Ga0501035_0010534
1094 Ga0501035_0016638
1095 Ga0501035_0041127
1096 Ga0501035_0109245
1097 Ga0501035_0122391
1098 Ga0501035_0180333
1099 Ga0501035_0243109
1100 Ga0501044_0001704
1101 Ga0501044_0028777
1102 Ga0501044_0211130
1103 Ga0501044_0275020
1104 Ga0501044_0290101
1105 Ga0501044_0328264
1106 Ga0501045_0027120
1107 Ga0501045_0075022
1108 nmdc:mga03n38_10286_c1
1109 nmdc:mga0yw44_82597_c1
1110 nmdc:mga06z11_2058_c1
1111 nmdc:mga04h51_8558_c1
1112 nmdc:mga07m45_110554_c1
1113 nmdc:mga07m45_232864_c1
1114 nmdc:mga08x19_86485_c1
1115 Ga0495601_0194701
1116 Ga0495601_0249418
1117 Ga0495612_0118845
1118 Ga0500610_0096159
1119 Ga0495619_0210254
1120 Ga0495619_0315745
1121 Ga0500578_0007770
1122 Ga0500578_0133419
1123 Ga0500644_0084105
1124 Ga0500640_071546
1125 Ga0500641_0113391
1126 Ga0500560_025472
1127 Ga0500569_001918
1128 Ga0500628_001728
1129 Ga0500652_002052
1130 Ga0500658_0003725
1131 Ga0500561_0007019
1132 Ga0500573_0003345
1133 Ga0500573_0025080
1134 Ga0500579_030691
1135 Ga0500600_0002908
1136 Ga0500600_0138250
1137 Ga0500616_0012323
1138 Ga0500624_006455
1139 Ga0500627_0169895
1140 Ga0500633_0002061
1141 Ga0500634_0003166
1142 Ga0500656_005305
1143 Ga0500587_000069
1144 Ga0501084_0010225
1145 Ga0501084_0042745
1146 Ga0501082_0053196
1147 Ga0466962_0023545
1148 Ga0466962_0053882
1149 Ga0530510_0048412
1150 8008567455
1151 2547408040
1152 2554257986
1153 2585302213
1154 2585308604
1155 2585318709
1156 2616695253
1157 2616903929
1158 2643765738
1159 2643898468
1160 2643948309
1161 2644264143
1162 2644388721
1163 2644406384
1164 2644429782
1165 2644437032
1166 2644459850
1167 2784588493
1168 2785343469
1169 2785369331
1170 2786670464
1171 2793984520
1172 2808841931
1173 2809232089
1174 2811848842
1175 2812480682
1176 2819697973
1177 2852636822
1178 2862181924
1179 2862285533
1180 2862293339
1181 2862386111
1182 2862515268
1183 2862579351
1184 2867434227
1185 2873155858
1186 2875394448
1187 2877681220
1188 2887480975
1189 2912724445
1190 2918504415
1191 2919469626
1192 2946075801
1193 2947229451
1194 2954007613
1195 2954386369
1196 2954676810
1197 2954687356
1198 2954697040
1199 2954705093
1200 2954716353
1201 2954726297
1202 2954745221
1203 2954754368
1204 2954764196
1205 2966602671
1206 2990062096
1207 2995464171
1208 3006327050
1209 3006492210
1210 3006496180
1211 8001785356
1212 8008488846
1213 8008578955
1214 8023631263
1215 8025414363
1216 8025528329
1217 8025536511
1218 8047896721
1219 8048129903
1220 8048362201
1221 8048373734
1222 8048384494
1223 8048410174
1224 8056831851

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02900

LigB

Catalytic LigB subunit of aromatic ring-opening dioxygenase

6

245

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pw6-assembly1.cif.gz_A-2 crystal structure of uncharacterized protein jw3007 from escherichia coli k12 0.8324 8 263
2pw6-assembly1.cif.gz_A-2 crystal structure of uncharacterized protein jw3007 from escherichia coli k12 0.8293 8 263
8iq8-assembly1.cif.gz_D crystal structure of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (dhpao) from acinetobacter baumannii 0.7899 8 262
8iq8-assembly1.cif.gz_D crystal structure of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (dhpao) from acinetobacter baumannii 0.7657 8 262
7txy-assembly2.cif.gz_F crystal structure of the 2-aminophenol 1,6-dioxygenase from the aro bacterial microcompartment of micromonospora rosaria 0.753 8 261
ID Description Score Start End Superfamily
af_I1MQB9_2_262_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.8812 10 263 3.40.830.10
af_P24197_1_271_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.8696 2 263 3.40.830.10
af_P24197_1_271_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.8634 2 263 3.40.830.10
af_I1MQB9_2_262_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.8561 10 263 3.40.830.10
af_Q54W77_1_267_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.8367 8 263 3.40.830.10
ID Description Score Start End GO Terms
AF-A0A6B3FFA7-F1-model_v4 Dioxygenase 0.9326 43 171 GO:0008198
GO:0008270
GO:0016701
GO:0051213
AF-A0A7J0CQM7-F1-model_v4 Dioxygenase 0.9297 46 263 GO:0008198
GO:0008270
GO:0016701
GO:0051213
AF-A0A1D8G1Q6-F1-model_v4 LigB family dioxygenase 0.9279 1 263 GO:0008198
GO:0008270
GO:0016701
GO:0051213
AF-A0A7J0CQM7-F1-model_v4 Dioxygenase 0.9256 46 263 GO:0008198
GO:0008270
GO:0016701
GO:0051213
AF-A0A5P0YNJ0-F1-model_v4 Dioxygenase 0.925 9 263 GO:0008198
GO:0008270
GO:0016701
GO:0051213

Map