F469123

General Info

Members Datasets Scaffolds Average Seq Length
612 297 1224 214

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10032009|Ga0070709_100320092
Length 236
Sequence MMRRGTGKIGVGGGARGEVAAHGSIATMRVVVAEDAAVMREGLIRLLTDRGHEVCAAVADGEALLAAVAEHGPDVAVVDIRMPPSHTDEGLRAALKLRHDHPATGVLVFSQYIETRYTARLLAVGYLLKDRVADVSEFADALTRVGAGGTALDPEVVSQLMSASPRPRGLTALTXXXXEVLALMAEGRSNAGIAAALTITDGAVEKHVAGIFDKFGLPPAEGDNRRVLAVLRHLRS

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
74 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
88 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
89 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
90 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
91 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
110 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
162 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
163 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
164 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
165 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
166 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
167 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
168 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
169 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
170 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
173 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
174 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
175 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
176 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
177 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
178 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
181 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
182 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
183 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
184 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
185 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
186 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
187 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
188 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
189 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
190 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
192 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
193 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
194 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
195 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
196 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
197 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
198 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
199 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
200 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
201 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
202 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
203 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
204 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
205 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
206 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
207 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
208 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
209 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
210 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
211 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
214 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
215 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
216 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
217 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
218 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
219 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
220 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
221 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
222 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
223 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
224 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
225 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
226 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
227 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
228 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
229 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
230 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
231 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
232 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
233 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
234 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
235 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
236 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
237 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
238 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
239 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
240 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
241 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
242 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
243 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
244 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
245 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
246 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
247 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
248 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
249 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
250 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
251 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
252 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
253 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
254 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
255 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
256 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
257 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
258 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
259 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
260 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
261 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
262 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
263 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
264 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
265 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
266 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
267 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
268 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
269 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
270 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
271 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
272 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
273 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
274 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
275 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
276 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
277 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
278 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
279 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
280 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
281 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
282 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
283 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
284 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
285 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
286 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
287 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
288 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
289 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
290 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
291 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
292 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
293 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
294 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
295 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
296 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
297 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.69
Metatranscriptomes 0.65
Isolates 0.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.49
Nodule 0
Rhizoplane 3.59
Rhizosphere 90.69
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10032009 3300005434 Bacteria 3168
2 JGI25407J50210_10016436 3300003373 Bacteria 1917
3 JGI25407J50210_10033815 3300003373 Bacteria 1319
4 JGI25404J52841_10011003 3300003659 Bacteria 1948
5 Ga0070658_10259146 3300005327 Bacteria 1477
6 Ga0070658_10287344 3300005327 Bacteria 1401
7 Ga0070676_10126412 3300005328 Bacteria 1611
8 Ga0070683_100027282 3300005329 Bacteria 5149
9 Ga0070683_100078646 3300005329 Bacteria 3086
10 Ga0070683_100184852 3300005329 Bacteria 1978
11 Ga0070670_100434658 3300005331 Bacteria 1162
12 Ga0070666_10048548 3300005335 Bacteria 2853
13 Ga0068868_100296429 3300005338 Bacteria 1372
14 Ga0070660_100102001 3300005339 Bacteria 2274
15 Ga0070689_100443924 3300005340 Bacteria 1103
16 Ga0070691_10007706 3300005341 Bacteria 4934
17 Ga0070691_10105711 3300005341 Bacteria 1403
18 Ga0070687_100062966 3300005343 Bacteria 1965
19 Ga0070661_100186902 3300005344 Bacteria 1579
20 Ga0070661_100333308 3300005344 Bacteria 1187
21 Ga0070692_10042994 3300005345 Bacteria 2322
22 Ga0070668_100000958 3300005347 Bacteria 20166
23 Ga0070668_100002495 3300005347 Bacteria 13546
24 Ga0070668_100284692 3300005347 Bacteria 1382
25 Ga0070669_100642854 3300005353 Bacteria 892
26 Ga0070671_100118584 3300005355 Bacteria 2226
27 Ga0070673_100086873 3300005364 Bacteria 2548
28 Ga0070688_100084657 3300005365 Bacteria 2060
29 Ga0070659_100044152 3300005366 Bacteria 3488
30 Ga0070667_100137257 3300005367 Bacteria 2139
31 Ga0070709_10068897 3300005434 Bacteria 2277
32 Ga0070709_10158795 3300005434 Bacteria 1570
33 Ga0070709_10202199 3300005434 Bacteria 1407
34 Ga0070714_100001103 3300005435 Bacteria 19328
35 Ga0070714_100127065 3300005435 Bacteria 2274
36 Ga0070714_100157712 3300005435 Bacteria 2050
37 Ga0070714_100162612 3300005435 Bacteria 2021
38 Ga0070714_100428869 3300005435 Bacteria 1253
39 Ga0070714_100504720 3300005435 Bacteria 1154
40 Ga0070713_100006854 3300005436 Bacteria 7941
41 Ga0070713_100012188 3300005436 Bacteria 6297
42 Ga0070713_100041187 3300005436 Bacteria 3762
43 Ga0070713_100175146 3300005436 Bacteria 1924
44 Ga0070713_100303418 3300005436 Bacteria 1470
45 Ga0070710_10225390 3300005437 Bacteria 1194
46 Ga0070701_10060979 3300005438 Bacteria 1988
47 Ga0070711_100031419 3300005439 Bacteria 3525
48 Ga0070708_100009288 3300005445 Bacteria 7924
49 Ga0070708_100054266 3300005445 Bacteria 3559
50 Ga0070708_100148265 3300005445 Bacteria 2180
51 Ga0070663_100001231 3300005455 Bacteria 14056
52 Ga0070678_100301813 3300005456 Bacteria 1361
53 Ga0070681_10037172 3300005458 Bacteria 4887
54 Ga0070681_10718376 3300005458 Bacteria 915
55 Ga0070706_100019817 3300005467 Bacteria 6201
56 Ga0070706_100123535 3300005467 Bacteria 2413
57 Ga0070706_100205897 3300005467 Bacteria 1837
58 Ga0070706_100434976 3300005467 Bacteria 1221
59 Ga0070707_100005042 3300005468 Bacteria 12383
60 Ga0070707_100107710 3300005468 Bacteria 2704
61 Ga0070698_100013943 3300005471 Bacteria 8500
62 Ga0070698_100017200 3300005471 Bacteria 7619
63 Ga0070698_100036660 3300005471 Bacteria 5063
64 Ga0070698_100268234 3300005471 Bacteria 1638
65 Ga0070699_100000759 3300005518 Bacteria 29797
66 Ga0070699_100058768 3300005518 Bacteria 3332
67 Ga0070699_100060802 3300005518 Bacteria 3274
68 Ga0070679_100234349 3300005530 Bacteria 1795
69 Ga0070679_100379480 3300005530 Bacteria 1360
70 Ga0070679_100541012 3300005530 Bacteria 1108
71 Ga0070684_100088537 3300005535 Bacteria 2751
72 Ga0070684_100344942 3300005535 Bacteria 1369
73 Ga0070697_100000794 3300005536 Bacteria 23696
74 Ga0068853_100658838 3300005539 Bacteria 997
75 Ga0070686_100033490 3300005544 Bacteria 3157
76 Ga0070696_100079059 3300005546 Bacteria 2326
77 Ga0070693_100009830 3300005547 Bacteria 4770
78 Ga0070665_100085257 3300005548 Bacteria 3164
79 Ga0070704_100492024 3300005549 Bacteria 1063
80 Ga0068855_100113961 3300005563 Bacteria 3101
81 Ga0068855_100212330 3300005563 Bacteria 2174
82 Ga0070664_100066601 3300005564 Bacteria 3076
83 Ga0068857_100049175 3300005577 Bacteria 3742
84 Ga0068857_100121134 3300005577 Bacteria 2355
85 Ga0068857_100281923 3300005577 Bacteria 1529
86 Ga0068856_100043412 3300005614 Bacteria 4424
87 Ga0068856_100088092 3300005614 Bacteria 3086
88 Ga0070702_100046766 3300005615 Bacteria 2454
89 Ga0070702_100058398 3300005615 Bacteria 2235
90 Ga0068852_100119367 3300005616 Bacteria 2411
91 Ga0068859_100518853 3300005617 Bacteria 1286
92 Ga0068864_100333090 3300005618 Bacteria 1429
93 Ga0068861_100215859 3300005719 Bacteria 1618
94 Ga0068861_100264818 3300005719 Bacteria 1473
95 Ga0068851_10073565 3300005834 Bacteria 1773
96 Ga0068863_100042142 3300005841 Bacteria 4337
97 Ga0068863_100089886 3300005841 Bacteria 2912
98 Ga0068858_100136080 3300005842 Bacteria 2305
99 Ga0068858_100675222 3300005842 Bacteria 1004
100 Ga0081455_10001973 3300005937 Bacteria 24538
101 Ga0081538_10000637 3300005981 Bacteria 38833
102 Ga0081538_10002855 3300005981 Bacteria 16518
103 Ga0081538_10003455 3300005981 Bacteria 14922
104 Ga0081538_10010873 3300005981 Bacteria 7423
105 Ga0081540_1002469 3300005983 Bacteria 15059
106 Ga0070717_10004732 3300006028 Bacteria 9892
107 Ga0070717_10146623 3300006028 Bacteria 2039
108 Ga0070717_10146828 3300006028 Bacteria 2037
109 Ga0070715_10017406 3300006163 Bacteria 2721
110 Ga0070715_10112889 3300006163 Bacteria 1284
111 Ga0070716_100004255 3300006173 Bacteria 6815
112 Ga0070712_100205080 3300006175 Bacteria 1551
113 Ga0070712_100376214 3300006175 Bacteria 1168
114 Ga0097621_100116048 3300006237 Bacteria 2267
115 Ga0097621_100249635 3300006237 Bacteria 1553
116 Ga0068871_100158654 3300006358 Bacteria 1933
117 Ga0075431_100118228 3300006847 Bacteria 2735
118 Ga0075433_10120785 3300006852 Bacteria 2326
119 Ga0075434_100021695 3300006871 Bacteria 6246
120 Ga0068865_100264552 3300006881 Bacteria 1363
121 Ga0075436_100156499 3300006914 Bacteria 1606
122 Ga0075436_100487500 3300006914 Bacteria 901
123 Ga0097620_100518872 3300006931 Bacteria 1286
124 Ga0075435_100475832 3300007076 Bacteria 1078
125 Ga0099795_10018491 3300007788 Bacteria 2240
126 Ga0105251_10024060 3300009011 Bacteria 3133
127 Ga0105240_10340342 3300009093 Bacteria 1704
128 Ga0105245_10032213 3300009098 Bacteria 4641
129 Ga0105247_10079800 3300009101 Bacteria 2060
130 Ga0105243_10091467 3300009148 Bacteria 2506
131 Ga0105241_10096490 3300009174 Bacteria 2342
132 Ga0105242_10232758 3300009176 Bacteria 1652
133 Ga0105248_10246349 3300009177 Bacteria 2012
134 Ga0105237_10310860 3300009545 Bacteria 1579
135 Ga0105237_10628841 3300009545 Bacteria 1080
136 Ga0105238_10189619 3300009551 Bacteria 2032
137 Ga0105238_10249501 3300009551 Bacteria 1753
138 Ga0105249_10090292 3300009553 Bacteria 2864
139 Ga0105249_10603750 3300009553 Bacteria 1152
140 Ga0099796_10106425 3300010159 Bacteria 1062
141 Ga0105246_10028878 3300011119 Bacteria 3647
142 Ga0157341_1005834 3300012494 Bacteria 936
143 Ga0157339_1007016 3300012505 Bacteria 935
144 Ga0157324_1008346 3300012506 Bacteria 831
145 Ga0157342_1003281 3300012507 Bacteria 1377
146 Ga0157316_1008588 3300012510 Bacteria 897
147 Ga0157371_10113622 3300013102 Bacteria 1923
148 Ga0157370_10046485 3300013104 Bacteria 4162
149 Ga0157369_10113494 3300013105 Bacteria 2878
150 Ga0157374_10067005 3300013296 Bacteria 3374
151 Ga0157378_10273279 3300013297 Bacteria 1626
152 Ga0163162_10048905 3300013306 Bacteria 4237
153 Ga0157372_10273387 3300013307 Bacteria 1964
154 Ga0157375_10130529 3300013308 Bacteria 2631
155 Ga0157380_10310093 3300014326 Bacteria 1458
156 Ga0157377_10007244 3300014745 Bacteria 5345
157 Ga0157379_10030601 3300014968 Bacteria 4793
158 Ga0157376_10014289 3300014969 Bacteria 5954
159 Ga0157376_10306671 3300014969 Bacteria 1505
160 Ga0182005_1070117 3300015265 Bacteria 962
161 Ga0163161_10152065 3300017792 Bacteria 1759
162 Ga0197907_10043345 3300020069 Bacteria 857
163 Ga0206350_10447418 3300020080 Bacteria 940
164 Ga0206353_12047453 3300020082 Bacteria 1563
165 Ga0213875_10000726 3300021388 Bacteria 25181
166 Ga0213875_10009094 3300021388 Bacteria 5048
167 Ga0213875_10075835 3300021388 Bacteria 1569
168 Ga0213875_10127802 3300021388 Bacteria 1188
169 Ga0213875_10150642 3300021388 Bacteria 1090
170 Ga0224712_10161683 3300022467 Bacteria 999
171 Ga0207656_10141473 3300025321 Bacteria 1134
172 Ga0207713_1045121 3300025735 Bacteria 1803
173 Ga0207653_10007512 3300025885 Bacteria 3397
174 Ga0207692_10007408 3300025898 Bacteria 4500
175 Ga0207642_10020508 3300025899 Bacteria 2582
176 Ga0207688_10008948 3300025901 Bacteria 5449
177 Ga0207680_10077772 3300025903 Bacteria 2076
178 Ga0207680_10404543 3300025903 Bacteria 965
179 Ga0207647_10179687 3300025904 Bacteria 1229
180 Ga0207685_10076452 3300025905 Bacteria 1373
181 Ga0207699_10023821 3300025906 Bacteria 3337
182 Ga0207699_10058687 3300025906 Bacteria 2303
183 Ga0207699_10059925 3300025906 Bacteria 2283
184 Ga0207699_10558548 3300025906 Bacteria 831
185 Ga0207645_10093337 3300025907 Bacteria 1936
186 Ga0207684_10069277 3300025910 Bacteria 2998
187 Ga0207684_10134172 3300025910 Bacteria 2125
188 Ga0207684_10143743 3300025910 Bacteria 2052
189 Ga0207684_10222414 3300025910 Bacteria 1629
190 Ga0207684_10300399 3300025910 Bacteria 1384
191 Ga0207707_10203106 3300025912 Bacteria 1728
192 Ga0207707_10618405 3300025912 Bacteria 915
193 Ga0207695_10262371 3300025913 Bacteria 1625
194 Ga0207693_10025022 3300025915 Bacteria 4735
195 Ga0207693_10033280 3300025915 Bacteria 4068
196 Ga0207693_10056946 3300025915 Bacteria 3064
197 Ga0207693_10130668 3300025915 Bacteria 1974
198 Ga0207693_10343506 3300025915 Bacteria 1168
199 Ga0207663_10004411 3300025916 Bacteria 6986
200 Ga0207663_10082422 3300025916 Bacteria 2110
201 Ga0207663_10089272 3300025916 Bacteria 2040
202 Ga0207663_10281622 3300025916 Bacteria 1235
203 Ga0207662_10016109 3300025918 Bacteria 4214
204 Ga0207662_10435983 3300025918 Bacteria 894
205 Ga0207657_10030145 3300025919 Bacteria 4928
206 Ga0207649_10312115 3300025920 Bacteria 1153
207 Ga0207652_10259475 3300025921 Bacteria 1567
208 Ga0207646_10021314 3300025922 Bacteria 5989
209 Ga0207646_10089868 3300025922 Bacteria 2749
210 Ga0207646_10102385 3300025922 Bacteria 2567
211 Ga0207646_10279736 3300025922 Bacteria 1508
212 Ga0207694_10119586 3300025924 Bacteria 2102
213 Ga0207659_10464824 3300025926 Bacteria 1067
214 Ga0207687_10061220 3300025927 Bacteria 2658
215 Ga0207700_10001598 3300025928 Bacteria 12857
216 Ga0207700_10007183 3300025928 Bacteria 6790
217 Ga0207700_10021007 3300025928 Bacteria 4449
218 Ga0207700_10029401 3300025928 Bacteria 3877
219 Ga0207700_10084787 3300025928 Bacteria 2485
220 Ga0207700_10165060 3300025928 Bacteria 1842
221 Ga0207700_10216832 3300025928 Bacteria 1620
222 Ga0207700_10623361 3300025928 Bacteria 961
223 Ga0207664_10000778 3300025929 Bacteria 21525
224 Ga0207664_10037032 3300025929 Bacteria 3773
225 Ga0207664_10059103 3300025929 Bacteria 3052
226 Ga0207664_10153390 3300025929 Bacteria 1959
227 Ga0207664_10181341 3300025929 Bacteria 1808
228 Ga0207664_10194330 3300025929 Bacteria 1748
229 Ga0207664_10194771 3300025929 Bacteria 1746
230 Ga0207664_10209298 3300025929 Bacteria 1687
231 Ga0207664_10239756 3300025929 Bacteria 1579
232 Ga0207664_10621671 3300025929 Bacteria 970
233 Ga0207706_10037269 3300025933 Bacteria 4318
234 Ga0207686_10187062 3300025934 Bacteria 1473
235 Ga0207709_10085113 3300025935 Bacteria 2049
236 Ga0207669_10230960 3300025937 Bacteria 1365
237 Ga0207665_10047352 3300025939 Bacteria 2883
238 Ga0207665_10074838 3300025939 Bacteria 2318
239 Ga0207665_10174274 3300025939 Bacteria 1555
240 Ga0207691_10049060 3300025940 Bacteria 3868
241 Ga0207689_10004898 3300025942 Bacteria 12076
242 Ga0207679_10047925 3300025945 Bacteria 3107
243 Ga0207679_10066089 3300025945 Bacteria 2709
244 Ga0207679_10166790 3300025945 Bacteria 1809
245 Ga0207667_10102332 3300025949 Bacteria 2955
246 Ga0207651_10493343 3300025960 Bacteria 1057
247 Ga0207668_10007279 3300025972 Bacteria 6570
248 Ga0207668_10023577 3300025972 Bacteria 3958
249 Ga0207658_10103439 3300025986 Bacteria 2236
250 Ga0207703_10036458 3300026035 Bacteria 3915
251 Ga0207678_10004403 3300026067 Bacteria 12666
252 Ga0207678_10009039 3300026067 Bacteria 8772
253 Ga0207708_10023120 3300026075 Bacteria 4696
254 Ga0207702_10002656 3300026078 Bacteria 16791
255 Ga0207702_10142671 3300026078 Bacteria 2169
256 Ga0207641_10149390 3300026088 Bacteria 2115
257 Ga0207648_10183438 3300026089 Bacteria 1853
258 Ga0207676_10171727 3300026095 Bacteria 1890
259 Ga0207676_10448641 3300026095 Bacteria 1215
260 Ga0207674_10005156 3300026116 Bacteria 15573
261 Ga0207674_10546745 3300026116 Bacteria 1119
262 Ga0207675_100038218 3300026118 Bacteria 4479
263 Ga0207675_100589043 3300026118 Bacteria 1114
264 Ga0207683_10001474 3300026121 Bacteria 21196
265 Ga0207698_10123603 3300026142 Bacteria 2196
266 Ga0207698_10363491 3300026142 Bacteria 1371
267 Ga0268265_10041753 3300028380 Bacteria 3398
268 Ga0268265_10285483 3300028380 Bacteria 1479
269 Ga0265334_10066176 3300028573 Bacteria 1354
270 Ga0265336_10004762 3300028666 Bacteria 5087
271 Ga0307517_10112574 3300028786 Bacteria 2060
272 Ga0307515_10028283 3300028794 Bacteria 9532
273 Ga0265338_10001746 3300028800 Bacteria 34367
274 Ga0265338_10010066 3300028800 Bacteria 11178
275 Ga0307512_10001507 3300030522 Bacteria 32791
276 Ga0307512_10006387 3300030522 Bacteria 11944
277 Ga0307512_10100138 3300030522 Bacteria 1968
278 Ga0307512_10177044 3300030522 Bacteria 1208
279 Ga0307513_10011882 3300031456 Bacteria 10786
280 Ga0307513_10182914 3300031456 Bacteria 1957
281 Ga0307509_10355627 3300031507 Bacteria 1186
282 Ga0307508_10005342 3300031616 Bacteria 12236
283 Ga0307508_10126285 3300031616 Bacteria 2161
284 Ga0307516_10024967 3300031730 Bacteria 6093
285 Ga0307405_10731524 3300031731 Bacteria 822
286 Ga0307413_10213710 3300031824 Bacteria 1403
287 Ga0307410_10141900 3300031852 Bacteria 1778
288 Ga0307406_10018154 3300031901 Bacteria 4105
289 Ga0307406_10052716 3300031901 Bacteria 2588
290 Ga0307407_10005069 3300031903 Bacteria 5681
291 Ga0307412_10223075 3300031911 Bacteria 1446
292 Ga0307412_10577611 3300031911 Bacteria 948
293 Ga0307409_100003368 3300031995 Bacteria 8670
294 Ga0307409_100009478 3300031995 Bacteria 5984
295 Ga0307409_100720691 3300031995 Bacteria 999
296 Ga0307416_100004244 3300032002 Bacteria 8604
297 Ga0307416_100013650 3300032002 Bacteria 5531
298 Ga0307411_10371687 3300032005 Bacteria 1173
299 Ga0307415_100000006 3300032126 Bacteria 107919
300 Ga0307415_100001353 3300032126 Bacteria 11658
301 Ga0307415_100193618 3300032126 Bacteria 1606
302 Ga0307507_10076340 3300033179 Bacteria 2989
303 Ga0307507_10240732 3300033179 Bacteria 1184
304 Ga0373948_0060415 3300034817 Bacteria 831
305 Ga0373958_0008596 3300034819 Bacteria 1660
306 Ga0373938_0049635 3300034957 Bacteria 955
307 Ga0373926_0000817 3300035083 Bacteria 8813
308 Ga0373926_0003194 3300035083 Bacteria 5266
309 Ga0373929_0003965 3300035085 Bacteria 2653
310 Ga0373934_0003271 3300035086 Bacteria 5927
311 Ga0373934_0011025 3300035086 Bacteria 3400
312 Ga0373944_0005750 3300035089 Bacteria 3274
313 Ga0373944_0005920 3300035089 Bacteria 3235
314 Ga0373944_0024088 3300035089 Bacteria 1781
315 Ga0373949_0028978 3300035090 Bacteria 1309
316 Ga0373923_0000819 3300035111 Bacteria 8143
317 Ga0373923_0012398 3300035111 Bacteria 3149
318 Ga0373923_0023427 3300035111 Bacteria 2429
319 Ga0373923_0035286 3300035111 Bacteria 2035
320 Ga0373923_0052022 3300035111 Bacteria 1720
321 Ga0373932_0018053 3300035112 Bacteria 1820
322 Ga0373936_0002860 3300035113 Bacteria 6445
323 Ga0373936_0006931 3300035113 Bacteria 4264
324 Ga0373941_0028665 3300035115 Bacteria 1636
325 Ga0373945_0000627 3300035116 Bacteria 10155
326 Ga0373945_0001271 3300035116 Bacteria 7662
327 Ga0373945_0044831 3300035116 Bacteria 1609
328 Ga0373953_0003733 3300035117 Bacteria 4783
329 Ga0373953_0036961 3300035117 Bacteria 1925
330 Ga0373953_0084578 3300035117 Bacteria 1322
331 Ga0373954_0002801 3300035118 Bacteria 7346
332 Ga0373954_0040509 3300035118 Bacteria 2170
333 Ga0373954_0042479 3300035118 Bacteria 2120
334 Ga0373954_0117161 3300035118 Bacteria 1291
335 Ga0373956_0001792 3300035119 Bacteria 8853
336 Ga0373956_0007477 3300035119 Bacteria 4401
337 Ga0373956_0059518 3300035119 Bacteria 1728
338 Ga0373956_0092588 3300035119 Bacteria 1395
339 Ga0373957_0000025 3300035120 Bacteria 38262
340 Ga0373957_0001345 3300035120 Bacteria 6593
341 Ga0373960_0018167 3300035121 Bacteria 1830
342 Ga0373943_0005388 3300035170 Bacteria 5755
343 Ga0373943_0007670 3300035170 Bacteria 4847
344 Ga0373943_0141698 3300035170 Bacteria 1296
345 Ga0373943_0147227 3300035170 Bacteria 1273
346 Ga0373943_0269522 3300035170 Bacteria 960
347 Ga0373946_0000041 3300035171 Bacteria 32847
348 Ga0373946_0002684 3300035171 Bacteria 6290
349 Ga0373946_0056847 3300035171 Bacteria 1653
350 Ga0373946_0314053 3300035171 Bacteria 777
351 Ga0373955_0000002 3300035172 Bacteria 125763
352 Ga0373955_0009412 3300035172 Bacteria 4570
353 Ga0373955_0021898 3300035172 Bacteria 3233
354 Ga0373955_0173397 3300035172 Bacteria 1277
355 Ga0373955_0355005 3300035172 Bacteria 888
356 Ga0373955_0478409 3300035172 Bacteria 760
357 Ga0373962_0052073 3300035242 Bacteria 1182
358 Ga0316574_0203311 3300035398 Bacteria 1272
359 Ga0373924_0000130 3300035410 Bacteria 21871
360 Ga0373924_0000926 3300035410 Bacteria 9264
361 Ga0373924_0001912 3300035410 Bacteria 6923
362 Ga0373924_0024091 3300035410 Bacteria 2395
363 Ga0373931_0018398 3300035691 Bacteria 3475
364 Ga0373931_0081896 3300035691 Bacteria 1783
365 Ga0373935_0039616 3300035692 Bacteria 2954
366 Ga0373935_0106628 3300035692 Bacteria 1854
367 Ga0373935_0298824 3300035692 Bacteria 1137
368 Ga0373935_0690038 3300035692 Bacteria 750
369 Ga0373927_0003175 3300035695 Bacteria 11853
370 Ga0373927_0016581 3300035695 Bacteria 4859
371 Ga0373927_0310779 3300035695 Bacteria 1037
372 Ga0373933_0000028 3300035724 Bacteria 88269
373 Ga0373933_0004903 3300035724 Bacteria 7303
374 Ga0373933_0009517 3300035724 Bacteria 5306
375 Ga0373933_0020080 3300035724 Bacteria 3783
376 Ga0373933_0139026 3300035724 Bacteria 1532
377 Ga0373933_0152177 3300035724 Bacteria 1465
378 Ga0373947_0002384 3300035725 Bacteria 11348
379 Ga0373947_0004433 3300035725 Bacteria 8232
380 Ga0373947_0030774 3300035725 Bacteria 3155
381 Ga0373947_0062488 3300035725 Bacteria 2266
382 Ga0373947_0120833 3300035725 Bacteria 1664
383 Ga0373947_0143157 3300035725 Bacteria 1535
384 Ga0373937_0000055 3300036401 Bacteria 101021
385 Ga0373937_0057179 3300036401 Bacteria 3582
386 Ga0373937_0606327 3300036401 Bacteria 1039
387 Ga0373925_0005422 3300037068 Bacteria 9501
388 Ga0373925_0067830 3300037068 Bacteria 2691
389 Ga0373925_0071960 3300037068 Bacteria 2615
390 Ga0373925_0219111 3300037068 Bacteria 1518
391 Ga0436364_0144709 3300037853 Bacteria 5124
392 Ga0436364_0685150 3300037853 Bacteria 1451
393 Ga0436364_0910932 3300037853 Bacteria 2567
394 Ga0436364_0940223 3300037853 Bacteria 123217
395 Ga0436364_1400616 3300037853 Bacteria 5888
396 Ga0436364_1453316 3300037853 Bacteria 1539
397 Ga0436362_0182691 3300039453 Bacteria 944
398 Ga0451853_2440832 3300041512 Bacteria 810
399 Ga0466969_0013991 3300044656 Bacteria 4223
400 Ga0466972_0031575 3300044658 Bacteria 2603
401 Ga0466960_0255361 3300044901 Bacteria 975
402 Ga0466967_0005616 3300045976 Bacteria 8724
403 Ga0466967_0122491 3300045976 Bacteria 2405
404 Ga0495592_0000105 3300046454 Bacteria 74737
405 Ga0495592_0014251 3300046454 Bacteria 6038
406 Ga0495592_0021462 3300046454 Bacteria 4910
407 Ga0495592_0062583 3300046454 Bacteria 2731
408 Ga0495592_0106084 3300046454 Bacteria 1995
409 Ga0495592_0113425 3300046454 Bacteria 1915
410 Ga0495603_0013933 3300046455 Bacteria 4862
411 Ga0495603_0125728 3300046455 Bacteria 1494
412 Ga0495629_0008179 3300046459 Bacteria 7691
413 Ga0495629_0034003 3300046459 Bacteria 3605
414 Ga0495641_0005028 3300046461 Bacteria 9111
415 Ga0495641_0092146 3300046461 Bacteria 1354
416 Ga0495651_0000048 3300046462 Bacteria 88292
417 Ga0495651_0003978 3300046462 Bacteria 11298
418 Ga0495651_0016689 3300046462 Bacteria 5686
419 Ga0495651_0055332 3300046462 Bacteria 3049
420 Ga0495651_0257865 3300046462 Bacteria 1187
421 Ga0495653_0001622 3300046463 Bacteria 17653
422 Ga0495653_0012578 3300046463 Bacteria 6911
423 Ga0495653_0014459 3300046463 Bacteria 6440
424 Ga0495653_0019280 3300046463 Bacteria 5532
425 Ga0495653_0033643 3300046463 Bacteria 4059
426 Ga0495653_0035259 3300046463 Bacteria 3949
427 Ga0495653_0038090 3300046463 Bacteria 3774
428 Ga0495653_0064587 3300046463 Bacteria 2758
429 Ga0495580_0010686 3300046472 Bacteria 7131
430 Ga0495580_0044019 3300046472 Bacteria 3176
431 Ga0495582_0001153 3300046473 Bacteria 14859
432 Ga0495639_0000717 3300046475 Bacteria 15170
433 Ga0495662_0000952 3300046476 Bacteria 14172
434 Ga0495662_0026682 3300046476 Bacteria 2789
435 Ga0495662_0062485 3300046476 Bacteria 1799
436 Ga0495664_0000663 3300046477 Bacteria 17519
437 Ga0495664_0064598 3300046477 Bacteria 2181
438 Ga0495664_0110174 3300046477 Bacteria 1661
439 Ga0495664_0224668 3300046477 Bacteria 1136
440 Ga0495594_0011242 3300046499 Bacteria 4649
441 Ga0495608_0000016 3300046511 Bacteria 196738
442 Ga0495608_0014435 3300046511 Bacteria 5479
443 Ga0495608_0015188 3300046511 Bacteria 5343
444 Ga0495608_0017198 3300046511 Bacteria 5003
445 Ga0495608_0025967 3300046511 Bacteria 3997
446 Ga0495608_0325380 3300046511 Bacteria 949
447 Ga0495618_0007466 3300046514 Bacteria 6611
448 Ga0495618_0014120 3300046514 Bacteria 4863
449 Ga0495618_0035192 3300046514 Bacteria 3142
450 Ga0495628_0000143 3300046516 Bacteria 61310
451 Ga0495628_0156233 3300046516 Bacteria 1735
452 Ga0495628_0439569 3300046516 Bacteria 948
453 Ga0495628_0494441 3300046516 Bacteria 884
454 Ga0495630_0040166 3300046517 Bacteria 3496
455 Ga0495630_0061661 3300046517 Bacteria 2816
456 Ga0495630_0062888 3300046517 Bacteria 2788
457 Ga0495630_0138671 3300046517 Bacteria 1848
458 Ga0495630_0150169 3300046517 Bacteria 1772
459 Ga0495630_0356197 3300046517 Bacteria 1120
460 Ga0495632_0059857 3300046519 Bacteria 1852
461 Ga0495666_0007160 3300046526 Bacteria 5600
462 Ga0495652_0000109 3300046529 Bacteria 88498
463 Ga0495652_0017014 3300046529 Bacteria 6495
464 Ga0495652_0019433 3300046529 Bacteria 6051
465 Ga0495652_0062952 3300046529 Bacteria 3125
466 Ga0495652_0233588 3300046529 Bacteria 1373
467 Ga0495665_0009959 3300046531 Bacteria 5148
468 Ga0495665_0027430 3300046531 Bacteria 3056
469 Ga0495665_0059955 3300046531 Bacteria 2009
470 Ga0495665_0089205 3300046531 Bacteria 1620
471 Ga0495640_0003743 3300046533 Bacteria 12214
472 Ga0495640_0021258 3300046533 Bacteria 4764
473 Ga0495640_0376796 3300046533 Bacteria 873
474 Ga0495586_0001181 3300046535 Bacteria 14662
475 Ga0495586_0068840 3300046535 Bacteria 1931
476 Ga0495587_0000065 3300046536 Bacteria 88259
477 Ga0495587_0008893 3300046536 Bacteria 6444
478 Ga0495587_0019481 3300046536 Bacteria 4197
479 Ga0495587_0053658 3300046536 Bacteria 2376
480 Ga0495587_0186664 3300046536 Bacteria 1174
481 Ga0495645_0016056 3300046543 Bacteria 5338
482 Ga0495645_0073061 3300046543 Bacteria 2470
483 Ga0495645_0081972 3300046543 Bacteria 2314
484 Ga0495645_0085584 3300046543 Bacteria 2256
485 Ga0495667_0000065 3300046559 Bacteria 88530
486 Ga0495667_0009889 3300046559 Bacteria 6458
487 Ga0495667_0010527 3300046559 Bacteria 6257
488 Ga0495667_0022654 3300046559 Bacteria 4232
489 Ga0495667_0034997 3300046559 Bacteria 3358
490 Ga0495667_0158408 3300046559 Bacteria 1456
491 Ga0495634_0016948 3300046642 Bacteria 5203
492 Ga0495634_0044394 3300046642 Bacteria 3008
493 Ga0495634_0167274 3300046642 Bacteria 1383
494 Ga0495635_0001818 3300046663 Bacteria 14412
495 Ga0495635_0002752 3300046663 Bacteria 12056
496 Ga0495635_0013293 3300046663 Bacteria 5760
497 Ga0495635_0025007 3300046663 Bacteria 4160
498 Ga0495635_0124954 3300046663 Bacteria 1754
499 Ga0495635_0456287 3300046663 Bacteria 844
500 Ga0495588_0031672 3300046674 Bacteria 2663
501 Ga0495657_0000015 3300046675 Bacteria 187657
502 Ga0495657_0026811 3300046675 Bacteria 4076
503 Ga0495657_0092987 3300046675 Bacteria 1931
504 Ga0495657_0093727 3300046675 Bacteria 1921
505 Ga0495657_0098504 3300046675 Bacteria 1865
506 Ga0495599_0000082 3300046678 Bacteria 66404
507 Ga0495599_0004484 3300046678 Bacteria 8273
508 Ga0495599_0006158 3300046678 Bacteria 7225
509 Ga0495623_0000063 3300046679 Bacteria 67060
510 Ga0495623_0012006 3300046679 Bacteria 5611
511 Ga0495623_0045671 3300046679 Bacteria 2781
512 Ga0495623_0256326 3300046679 Bacteria 982
513 Ga0495646_0005233 3300046680 Bacteria 8180
514 Ga0495646_0012811 3300046680 Bacteria 5329
515 Ga0495646_0033083 3300046680 Bacteria 3215
516 Ga0495646_0153679 3300046680 Bacteria 1278
517 Ga0495647_0030629 3300046681 Bacteria 1997
518 Ga0495658_0003523 3300046683 Bacteria 7744
519 Ga0495658_0099165 3300046683 Bacteria 1736
520 Ga0495613_0006664 3300046689 Bacteria 8627
521 Ga0495613_0010855 3300046689 Bacteria 6758
522 Ga0495613_0583310 3300046689 Bacteria 745
523 Ga0495624_0002852 3300046690 Bacteria 12936
524 Ga0495624_0009453 3300046690 Bacteria 6753
525 Ga0495600_0002618 3300046809 Bacteria 10375
526 Ga0495600_0004088 3300046809 Bacteria 8682
527 Ga0495600_0009492 3300046809 Bacteria 6013
528 Ga0495581_0008567 3300047315 Bacteria 5925
529 Ga0495581_0017564 3300047315 Bacteria 4155
530 Ga0495604_0000273 3300047317 Bacteria 45993
531 Ga0495604_0029148 3300047317 Bacteria 4391
532 Ga0495604_0054765 3300047317 Bacteria 3077
533 Ga0495604_0076134 3300047317 Bacteria 2524
534 Ga0495674_0002304 3300047319 Bacteria 18728
535 Ga0495674_0013603 3300047319 Bacteria 7644
536 Ga0495674_0070043 3300047319 Bacteria 3031
537 Ga0495674_0072128 3300047319 Bacteria 2979
538 Ga0495674_0255699 3300047319 Bacteria 1440
539 Ga0495676_0000782 3300047321 Bacteria 26592
540 Ga0495676_0002773 3300047321 Bacteria 15741
541 Ga0495676_0526342 3300047321 Bacteria 774
542 Ga0495680_0000033 3300047322 Bacteria 108347
543 Ga0495680_0007030 3300047322 Bacteria 10375
544 Ga0495680_0037960 3300047322 Bacteria 3854
545 Ga0495680_0067618 3300047322 Bacteria 2731
546 Ga0495680_0089570 3300047322 Bacteria 2309
547 Ga0495675_0000582 3300047444 Bacteria 23472
548 Ga0495675_0002221 3300047444 Bacteria 11586
549 Ga0495675_0004710 3300047444 Bacteria 8286
550 Ga0495675_0229038 3300047444 Bacteria 1122
551 Ga0495684_0005361 3300047471 Bacteria 9985
552 Ga0495684_0010695 3300047471 Bacteria 7095
553 Ga0495684_0018306 3300047471 Bacteria 5398
554 Ga0495684_0091900 3300047471 Bacteria 2298
555 Ga0495593_0006554 3300047673 Bacteria 6813
556 Ga0495593_0009790 3300047673 Bacteria 5560
557 Ga0495602_0000091 3300048088 Bacteria 88530
558 Ga0495602_0038744 3300048088 Bacteria 4401
559 Ga0495602_0067628 3300048088 Bacteria 3072
560 Ga0495602_0070746 3300048088 Bacteria 2983
561 Ga0495614_0022208 3300048089 Bacteria 2739
562 Ga0495614_0058071 3300048089 Bacteria 1661
563 Ga0496100_0064336 3300048903 Bacteria 2427
564 Ga0496100_0436964 3300048903 Bacteria 1001
565 Ga0496102_1085318 3300048905 Bacteria 720
566 Ga0496103_0052151 3300048906 Bacteria 2533
567 Ga0496104_0013320 3300048907 Bacteria 7410
568 Ga0496104_0023130 3300048907 Bacteria 5713
569 Ga0496104_0038344 3300048907 Bacteria 4483
570 Ga0496105_0076893 3300048908 Bacteria 2756
571 Ga0496106_0268971 3300048909 Bacteria 1364
572 Ga0496107_0082047 3300048910 Bacteria 2351
573 Ga0496107_0425073 3300048910 Bacteria 988
574 Ga0496108_0066285 3300048911 Bacteria 3044
575 Ga0496108_0680470 3300048911 Bacteria 893
576 Ga0496109_0022856 3300048912 Bacteria 5542
577 Ga0496110_0006449 3300048913 Bacteria 9294
578 Ga0496110_0027547 3300048913 Bacteria 4872
579 Ga0496111_0088357 3300048914 Bacteria 2269
580 Ga0496112_0148379 3300048915 Bacteria 2313
581 Ga0496112_0540392 3300048915 Bacteria 1099
582 Ga0496114_0304013 3300048917 Bacteria 1408
583 Ga0496115_0346292 3300048918 Bacteria 1212
584 Ga0496115_0402149 3300048918 Bacteria 1111
585 Ga0496126_0000039 3300048929 Bacteria 347353
586 Ga0496126_0167005 3300048929 Bacteria 1877
587 Ga0501045_0006250 3300049824 Bacteria 8242
588 nmdc:mga0n895_50369_c1 3300050512 Bacteria 4083
589 nmdc:mga0n895_732556_c1 3300050512 Bacteria 983
590 nmdc:mga0rr50_204483_c1 3300050513 Bacteria 1624
591 nmdc:mga0rr50_2787_c1 3300050513 Bacteria 9933
592 nmdc:mga0rr50_780084_c1 3300050513 Bacteria 816
593 nmdc:mga08x19_15954_c1 3300050514 Bacteria 4577
594 nmdc:mga08x19_34405_c1 3300050514 Bacteria 3202
595 nmdc:mga08x19_62065_c1 3300050514 Bacteria 2422
596 nmdc:mga0a205_36260_c1 3300050515 Bacteria 4738
597 Ga0495601_0008032 3300053077 Bacteria 6218
598 Ga0495601_0082475 3300053077 Bacteria 2064
599 Ga0495612_0133789 3300053078 Bacteria 1072
600 Ga0495595_0004092 3300053084 Bacteria 5846
601 Ga0495595_0013004 3300053084 Bacteria 3511
602 Ga0495595_0018190 3300053084 Bacteria 3034
603 Ga0495619_0012882 3300053085 Bacteria 5267
604 Ga0495619_0027871 3300053085 Bacteria 3642
605 Ga0495619_0122998 3300053085 Bacteria 1779
606 Ga0500651_0088080 3300053093 Bacteria 1915
607 Ga0500652_058580 3300053131 Bacteria 1582
608 Ga0500611_029872 3300053727 Bacteria 1119
609 2866616928 2866612099 Bacteria 7543886
610 2899368729 2899359706 Bacteria 10940472
611 2917740904 2917736166 Bacteria 9690793
612 8003322373 8003314358 Bacteria 10575343
613 Ga0070709_10032009
614 JGI25407J50210_10016436
615 JGI25407J50210_10033815
616 JGI25404J52841_10011003
617 Ga0070658_10259146
618 Ga0070658_10287344
619 Ga0070676_10126412
620 Ga0070683_100027282
621 Ga0070683_100078646
622 Ga0070683_100184852
623 Ga0070670_100434658
624 Ga0070666_10048548
625 Ga0068868_100296429
626 Ga0070660_100102001
627 Ga0070689_100443924
628 Ga0070691_10007706
629 Ga0070691_10105711
630 Ga0070687_100062966
631 Ga0070661_100186902
632 Ga0070661_100333308
633 Ga0070692_10042994
634 Ga0070668_100000958
635 Ga0070668_100002495
636 Ga0070668_100284692
637 Ga0070669_100642854
638 Ga0070671_100118584
639 Ga0070673_100086873
640 Ga0070688_100084657
641 Ga0070659_100044152
642 Ga0070667_100137257
643 Ga0070709_10068897
644 Ga0070709_10158795
645 Ga0070709_10202199
646 Ga0070714_100001103
647 Ga0070714_100127065
648 Ga0070714_100157712
649 Ga0070714_100162612
650 Ga0070714_100428869
651 Ga0070714_100504720
652 Ga0070713_100006854
653 Ga0070713_100012188
654 Ga0070713_100041187
655 Ga0070713_100175146
656 Ga0070713_100303418
657 Ga0070710_10225390
658 Ga0070701_10060979
659 Ga0070711_100031419
660 Ga0070708_100009288
661 Ga0070708_100054266
662 Ga0070708_100148265
663 Ga0070663_100001231
664 Ga0070678_100301813
665 Ga0070681_10037172
666 Ga0070681_10718376
667 Ga0070706_100019817
668 Ga0070706_100123535
669 Ga0070706_100205897
670 Ga0070706_100434976
671 Ga0070707_100005042
672 Ga0070707_100107710
673 Ga0070698_100013943
674 Ga0070698_100017200
675 Ga0070698_100036660
676 Ga0070698_100268234
677 Ga0070699_100000759
678 Ga0070699_100058768
679 Ga0070699_100060802
680 Ga0070679_100234349
681 Ga0070679_100379480
682 Ga0070679_100541012
683 Ga0070684_100088537
684 Ga0070684_100344942
685 Ga0070697_100000794
686 Ga0068853_100658838
687 Ga0070686_100033490
688 Ga0070696_100079059
689 Ga0070693_100009830
690 Ga0070665_100085257
691 Ga0070704_100492024
692 Ga0068855_100113961
693 Ga0068855_100212330
694 Ga0070664_100066601
695 Ga0068857_100049175
696 Ga0068857_100121134
697 Ga0068857_100281923
698 Ga0068856_100043412
699 Ga0068856_100088092
700 Ga0070702_100046766
701 Ga0070702_100058398
702 Ga0068852_100119367
703 Ga0068859_100518853
704 Ga0068864_100333090
705 Ga0068861_100215859
706 Ga0068861_100264818
707 Ga0068851_10073565
708 Ga0068863_100042142
709 Ga0068863_100089886
710 Ga0068858_100136080
711 Ga0068858_100675222
712 Ga0081455_10001973
713 Ga0081538_10000637
714 Ga0081538_10002855
715 Ga0081538_10003455
716 Ga0081538_10010873
717 Ga0081540_1002469
718 Ga0070717_10004732
719 Ga0070717_10146623
720 Ga0070717_10146828
721 Ga0070715_10017406
722 Ga0070715_10112889
723 Ga0070716_100004255
724 Ga0070712_100205080
725 Ga0070712_100376214
726 Ga0097621_100116048
727 Ga0097621_100249635
728 Ga0068871_100158654
729 Ga0075431_100118228
730 Ga0075433_10120785
731 Ga0075434_100021695
732 Ga0068865_100264552
733 Ga0075436_100156499
734 Ga0075436_100487500
735 Ga0097620_100518872
736 Ga0075435_100475832
737 Ga0099795_10018491
738 Ga0105251_10024060
739 Ga0105240_10340342
740 Ga0105245_10032213
741 Ga0105247_10079800
742 Ga0105243_10091467
743 Ga0105241_10096490
744 Ga0105242_10232758
745 Ga0105248_10246349
746 Ga0105237_10310860
747 Ga0105237_10628841
748 Ga0105238_10189619
749 Ga0105238_10249501
750 Ga0105249_10090292
751 Ga0105249_10603750
752 Ga0099796_10106425
753 Ga0105246_10028878
754 Ga0157341_1005834
755 Ga0157339_1007016
756 Ga0157324_1008346
757 Ga0157342_1003281
758 Ga0157316_1008588
759 Ga0157371_10113622
760 Ga0157370_10046485
761 Ga0157369_10113494
762 Ga0157374_10067005
763 Ga0157378_10273279
764 Ga0163162_10048905
765 Ga0157372_10273387
766 Ga0157375_10130529
767 Ga0157380_10310093
768 Ga0157377_10007244
769 Ga0157379_10030601
770 Ga0157376_10014289
771 Ga0157376_10306671
772 Ga0182005_1070117
773 Ga0163161_10152065
774 Ga0197907_10043345
775 Ga0206350_10447418
776 Ga0206353_12047453
777 Ga0213875_10000726
778 Ga0213875_10009094
779 Ga0213875_10075835
780 Ga0213875_10127802
781 Ga0213875_10150642
782 Ga0224712_10161683
783 Ga0207656_10141473
784 Ga0207713_1045121
785 Ga0207653_10007512
786 Ga0207692_10007408
787 Ga0207642_10020508
788 Ga0207688_10008948
789 Ga0207680_10077772
790 Ga0207680_10404543
791 Ga0207647_10179687
792 Ga0207685_10076452
793 Ga0207699_10023821
794 Ga0207699_10058687
795 Ga0207699_10059925
796 Ga0207699_10558548
797 Ga0207645_10093337
798 Ga0207684_10069277
799 Ga0207684_10134172
800 Ga0207684_10143743
801 Ga0207684_10222414
802 Ga0207684_10300399
803 Ga0207707_10203106
804 Ga0207707_10618405
805 Ga0207695_10262371
806 Ga0207693_10025022
807 Ga0207693_10033280
808 Ga0207693_10056946
809 Ga0207693_10130668
810 Ga0207693_10343506
811 Ga0207663_10004411
812 Ga0207663_10082422
813 Ga0207663_10089272
814 Ga0207663_10281622
815 Ga0207662_10016109
816 Ga0207662_10435983
817 Ga0207657_10030145
818 Ga0207649_10312115
819 Ga0207652_10259475
820 Ga0207646_10021314
821 Ga0207646_10089868
822 Ga0207646_10102385
823 Ga0207646_10279736
824 Ga0207694_10119586
825 Ga0207659_10464824
826 Ga0207687_10061220
827 Ga0207700_10001598
828 Ga0207700_10007183
829 Ga0207700_10021007
830 Ga0207700_10029401
831 Ga0207700_10084787
832 Ga0207700_10165060
833 Ga0207700_10216832
834 Ga0207700_10623361
835 Ga0207664_10000778
836 Ga0207664_10037032
837 Ga0207664_10059103
838 Ga0207664_10153390
839 Ga0207664_10181341
840 Ga0207664_10194330
841 Ga0207664_10194771
842 Ga0207664_10209298
843 Ga0207664_10239756
844 Ga0207664_10621671
845 Ga0207706_10037269
846 Ga0207686_10187062
847 Ga0207709_10085113
848 Ga0207669_10230960
849 Ga0207665_10047352
850 Ga0207665_10074838
851 Ga0207665_10174274
852 Ga0207691_10049060
853 Ga0207689_10004898
854 Ga0207679_10047925
855 Ga0207679_10066089
856 Ga0207679_10166790
857 Ga0207667_10102332
858 Ga0207651_10493343
859 Ga0207668_10007279
860 Ga0207668_10023577
861 Ga0207658_10103439
862 Ga0207703_10036458
863 Ga0207678_10004403
864 Ga0207678_10009039
865 Ga0207708_10023120
866 Ga0207702_10002656
867 Ga0207702_10142671
868 Ga0207641_10149390
869 Ga0207648_10183438
870 Ga0207676_10171727
871 Ga0207676_10448641
872 Ga0207674_10005156
873 Ga0207674_10546745
874 Ga0207675_100038218
875 Ga0207675_100589043
876 Ga0207683_10001474
877 Ga0207698_10123603
878 Ga0207698_10363491
879 Ga0268265_10041753
880 Ga0268265_10285483
881 Ga0265334_10066176
882 Ga0265336_10004762
883 Ga0307517_10112574
884 Ga0307515_10028283
885 Ga0265338_10001746
886 Ga0265338_10010066
887 Ga0307512_10001507
888 Ga0307512_10006387
889 Ga0307512_10100138
890 Ga0307512_10177044
891 Ga0307513_10011882
892 Ga0307513_10182914
893 Ga0307509_10355627
894 Ga0307508_10005342
895 Ga0307508_10126285
896 Ga0307516_10024967
897 Ga0307405_10731524
898 Ga0307413_10213710
899 Ga0307410_10141900
900 Ga0307406_10018154
901 Ga0307406_10052716
902 Ga0307407_10005069
903 Ga0307412_10223075
904 Ga0307412_10577611
905 Ga0307409_100003368
906 Ga0307409_100009478
907 Ga0307409_100720691
908 Ga0307416_100004244
909 Ga0307416_100013650
910 Ga0307411_10371687
911 Ga0307415_100000006
912 Ga0307415_100001353
913 Ga0307415_100193618
914 Ga0307507_10076340
915 Ga0307507_10240732
916 Ga0373948_0060415
917 Ga0373958_0008596
918 Ga0373938_0049635
919 Ga0373926_0000817
920 Ga0373926_0003194
921 Ga0373929_0003965
922 Ga0373934_0003271
923 Ga0373934_0011025
924 Ga0373944_0005750
925 Ga0373944_0005920
926 Ga0373944_0024088
927 Ga0373949_0028978
928 Ga0373923_0000819
929 Ga0373923_0012398
930 Ga0373923_0023427
931 Ga0373923_0035286
932 Ga0373923_0052022
933 Ga0373932_0018053
934 Ga0373936_0002860
935 Ga0373936_0006931
936 Ga0373941_0028665
937 Ga0373945_0000627
938 Ga0373945_0001271
939 Ga0373945_0044831
940 Ga0373953_0003733
941 Ga0373953_0036961
942 Ga0373953_0084578
943 Ga0373954_0002801
944 Ga0373954_0040509
945 Ga0373954_0042479
946 Ga0373954_0117161
947 Ga0373956_0001792
948 Ga0373956_0007477
949 Ga0373956_0059518
950 Ga0373956_0092588
951 Ga0373957_0000025
952 Ga0373957_0001345
953 Ga0373960_0018167
954 Ga0373943_0005388
955 Ga0373943_0007670
956 Ga0373943_0141698
957 Ga0373943_0147227
958 Ga0373943_0269522
959 Ga0373946_0000041
960 Ga0373946_0002684
961 Ga0373946_0056847
962 Ga0373946_0314053
963 Ga0373955_0000002
964 Ga0373955_0009412
965 Ga0373955_0021898
966 Ga0373955_0173397
967 Ga0373955_0355005
968 Ga0373955_0478409
969 Ga0373962_0052073
970 Ga0316574_0203311
971 Ga0373924_0000130
972 Ga0373924_0000926
973 Ga0373924_0001912
974 Ga0373924_0024091
975 Ga0373931_0018398
976 Ga0373931_0081896
977 Ga0373935_0039616
978 Ga0373935_0106628
979 Ga0373935_0298824
980 Ga0373935_0690038
981 Ga0373927_0003175
982 Ga0373927_0016581
983 Ga0373927_0310779
984 Ga0373933_0000028
985 Ga0373933_0004903
986 Ga0373933_0009517
987 Ga0373933_0020080
988 Ga0373933_0139026
989 Ga0373933_0152177
990 Ga0373947_0002384
991 Ga0373947_0004433
992 Ga0373947_0030774
993 Ga0373947_0062488
994 Ga0373947_0120833
995 Ga0373947_0143157
996 Ga0373937_0000055
997 Ga0373937_0057179
998 Ga0373937_0606327
999 Ga0373925_0005422
1000 Ga0373925_0067830
1001 Ga0373925_0071960
1002 Ga0373925_0219111
1003 Ga0436364_0144709
1004 Ga0436364_0685150
1005 Ga0436364_0910932
1006 Ga0436364_0940223
1007 Ga0436364_1400616
1008 Ga0436364_1453316
1009 Ga0436362_0182691
1010 Ga0451853_2440832
1011 Ga0466969_0013991
1012 Ga0466972_0031575
1013 Ga0466960_0255361
1014 Ga0466967_0005616
1015 Ga0466967_0122491
1016 Ga0495592_0000105
1017 Ga0495592_0014251
1018 Ga0495592_0021462
1019 Ga0495592_0062583
1020 Ga0495592_0106084
1021 Ga0495592_0113425
1022 Ga0495603_0013933
1023 Ga0495603_0125728
1024 Ga0495629_0008179
1025 Ga0495629_0034003
1026 Ga0495641_0005028
1027 Ga0495641_0092146
1028 Ga0495651_0000048
1029 Ga0495651_0003978
1030 Ga0495651_0016689
1031 Ga0495651_0055332
1032 Ga0495651_0257865
1033 Ga0495653_0001622
1034 Ga0495653_0012578
1035 Ga0495653_0014459
1036 Ga0495653_0019280
1037 Ga0495653_0033643
1038 Ga0495653_0035259
1039 Ga0495653_0038090
1040 Ga0495653_0064587
1041 Ga0495580_0010686
1042 Ga0495580_0044019
1043 Ga0495582_0001153
1044 Ga0495639_0000717
1045 Ga0495662_0000952
1046 Ga0495662_0026682
1047 Ga0495662_0062485
1048 Ga0495664_0000663
1049 Ga0495664_0064598
1050 Ga0495664_0110174
1051 Ga0495664_0224668
1052 Ga0495594_0011242
1053 Ga0495608_0000016
1054 Ga0495608_0014435
1055 Ga0495608_0015188
1056 Ga0495608_0017198
1057 Ga0495608_0025967
1058 Ga0495608_0325380
1059 Ga0495618_0007466
1060 Ga0495618_0014120
1061 Ga0495618_0035192
1062 Ga0495628_0000143
1063 Ga0495628_0156233
1064 Ga0495628_0439569
1065 Ga0495628_0494441
1066 Ga0495630_0040166
1067 Ga0495630_0061661
1068 Ga0495630_0062888
1069 Ga0495630_0138671
1070 Ga0495630_0150169
1071 Ga0495630_0356197
1072 Ga0495632_0059857
1073 Ga0495666_0007160
1074 Ga0495652_0000109
1075 Ga0495652_0017014
1076 Ga0495652_0019433
1077 Ga0495652_0062952
1078 Ga0495652_0233588
1079 Ga0495665_0009959
1080 Ga0495665_0027430
1081 Ga0495665_0059955
1082 Ga0495665_0089205
1083 Ga0495640_0003743
1084 Ga0495640_0021258
1085 Ga0495640_0376796
1086 Ga0495586_0001181
1087 Ga0495586_0068840
1088 Ga0495587_0000065
1089 Ga0495587_0008893
1090 Ga0495587_0019481
1091 Ga0495587_0053658
1092 Ga0495587_0186664
1093 Ga0495645_0016056
1094 Ga0495645_0073061
1095 Ga0495645_0081972
1096 Ga0495645_0085584
1097 Ga0495667_0000065
1098 Ga0495667_0009889
1099 Ga0495667_0010527
1100 Ga0495667_0022654
1101 Ga0495667_0034997
1102 Ga0495667_0158408
1103 Ga0495634_0016948
1104 Ga0495634_0044394
1105 Ga0495634_0167274
1106 Ga0495635_0001818
1107 Ga0495635_0002752
1108 Ga0495635_0013293
1109 Ga0495635_0025007
1110 Ga0495635_0124954
1111 Ga0495635_0456287
1112 Ga0495588_0031672
1113 Ga0495657_0000015
1114 Ga0495657_0026811
1115 Ga0495657_0092987
1116 Ga0495657_0093727
1117 Ga0495657_0098504
1118 Ga0495599_0000082
1119 Ga0495599_0004484
1120 Ga0495599_0006158
1121 Ga0495623_0000063
1122 Ga0495623_0012006
1123 Ga0495623_0045671
1124 Ga0495623_0256326
1125 Ga0495646_0005233
1126 Ga0495646_0012811
1127 Ga0495646_0033083
1128 Ga0495646_0153679
1129 Ga0495647_0030629
1130 Ga0495658_0003523
1131 Ga0495658_0099165
1132 Ga0495613_0006664
1133 Ga0495613_0010855
1134 Ga0495613_0583310
1135 Ga0495624_0002852
1136 Ga0495624_0009453
1137 Ga0495600_0002618
1138 Ga0495600_0004088
1139 Ga0495600_0009492
1140 Ga0495581_0008567
1141 Ga0495581_0017564
1142 Ga0495604_0000273
1143 Ga0495604_0029148
1144 Ga0495604_0054765
1145 Ga0495604_0076134
1146 Ga0495674_0002304
1147 Ga0495674_0013603
1148 Ga0495674_0070043
1149 Ga0495674_0072128
1150 Ga0495674_0255699
1151 Ga0495676_0000782
1152 Ga0495676_0002773
1153 Ga0495676_0526342
1154 Ga0495680_0000033
1155 Ga0495680_0007030
1156 Ga0495680_0037960
1157 Ga0495680_0067618
1158 Ga0495680_0089570
1159 Ga0495675_0000582
1160 Ga0495675_0002221
1161 Ga0495675_0004710
1162 Ga0495675_0229038
1163 Ga0495684_0005361
1164 Ga0495684_0010695
1165 Ga0495684_0018306
1166 Ga0495684_0091900
1167 Ga0495593_0006554
1168 Ga0495593_0009790
1169 Ga0495602_0000091
1170 Ga0495602_0038744
1171 Ga0495602_0067628
1172 Ga0495602_0070746
1173 Ga0495614_0022208
1174 Ga0495614_0058071
1175 Ga0496100_0064336
1176 Ga0496100_0436964
1177 Ga0496102_1085318
1178 Ga0496103_0052151
1179 Ga0496104_0013320
1180 Ga0496104_0023130
1181 Ga0496104_0038344
1182 Ga0496105_0076893
1183 Ga0496106_0268971
1184 Ga0496107_0082047
1185 Ga0496107_0425073
1186 Ga0496108_0066285
1187 Ga0496108_0680470
1188 Ga0496109_0022856
1189 Ga0496110_0006449
1190 Ga0496110_0027547
1191 Ga0496111_0088357
1192 Ga0496112_0148379
1193 Ga0496112_0540392
1194 Ga0496114_0304013
1195 Ga0496115_0346292
1196 Ga0496115_0402149
1197 Ga0496126_0000039
1198 Ga0496126_0167005
1199 Ga0501045_0006250
1200 nmdc:mga0n895_50369_c1
1201 nmdc:mga0n895_732556_c1
1202 nmdc:mga0rr50_204483_c1
1203 nmdc:mga0rr50_2787_c1
1204 nmdc:mga0rr50_780084_c1
1205 nmdc:mga08x19_15954_c1
1206 nmdc:mga08x19_34405_c1
1207 nmdc:mga08x19_62065_c1
1208 nmdc:mga0a205_36260_c1
1209 Ga0495601_0008032
1210 Ga0495601_0082475
1211 Ga0495612_0133789
1212 Ga0495595_0004092
1213 Ga0495595_0013004
1214 Ga0495595_0018190
1215 Ga0495619_0012882
1216 Ga0495619_0027871
1217 Ga0495619_0122998
1218 Ga0500651_0088080
1219 Ga0500652_058580
1220 Ga0500611_029872
1221 2866616928
1222 2899368729
1223 2917740904
1224 8003322373

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00196

GerE

Bacterial regulatory proteins, luxR family

171

221

0.93

PF00072

Response_reg

Response regulator receiver domain

30

136

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vim-assembly1.cif.gz_A the c-terminal dna binding domain of esrb from edwardsiella piscicida 0.9954 151 194
4qic-assembly1.cif.gz_A co-crystal structure of anti-anti-sigma factor phyr complexed with anti-sigma factor nepr from bartonella quintana 0.9384 2 79
4g97-assembly1.cif.gz_A crystal structure of the response regulator phyr from brucella abortus 0.9353 2 85
1je8-assembly2.cif.gz_E two-component response regulator narl/dna complex: dna bending found in a high affinity site 0.9334 148 210
4qic-assembly1.cif.gz_C co-crystal structure of anti-anti-sigma factor phyr complexed with anti-sigma factor nepr from bartonella quintana 0.9269 2 81
ID Description Score Start End Superfamily
1zn2A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9819 151 197 1.10.10.10
3vepH00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9456 144 194 1.10.10.10
af_O69730_8_88_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9359 1 83 3.40.50.2300
3vfzA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9343 144 194 1.10.10.10
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9307 1 83 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A538JGH7-F1-model_v4 Response regulator 0.9996 2 134 GO:0000160
GO:0004016
GO:0009190
AF-A0A538J270-F1-model_v4 Response regulator 0.9954 2 140 GO:0000160
GO:0004016
GO:0009190
AF-A0A7Y7IIA2-F1-model_v4 Response regulator transcription factor 0.9908 1 75 GO:0000160
AF-A0A1I2SCA5-F1-model_v4 Response regulator receiver domain-containing protein 0.9871 2 134 GO:0000160
GO:0003677
AF-A0A3N0DSD5-F1-model_v4 Response regulator 0.9863 2 140 GO:0000160
GO:0004016
GO:0009190

Map