F469102

General Info

Members Datasets Scaffolds Average Seq Length
611 235 1222 219

Family's Representative Sequence

Representative Sequence 3300049587|Ga0501071_0268363|Ga0501071_0268363_181_924
Length 247
Sequence VAGRVIVPRQKPNVGVPASGSKTQRERRVTAAKTISAIEAVGKIGSGNTVLVGGFGLVGAPLTLIDALADHSDATDLTVVSNNIGEPGKGLGKLLRQGRIRRGISSYFTSNPEAVAAVNSGEMEATLLPQGTFAEAIRAGGAGIGGFFTPVGAGTLLAEGKEERVIDGVAHVLEEPIRGDVALVYAARGDELGNLWYRGTARNFNPLMATAARITVAEVGELVPAGELEPESVVTPHLYVDFLVRRA

Samples

Sample ID Description Type Environment
1 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
151 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
152 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
157 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
158 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
159 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
160 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
163 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
164 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
165 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
166 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
167 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
168 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
169 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
170 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
171 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
172 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
187 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
203 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
204 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
205 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
206 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
207 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
208 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
209 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
210 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
211 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
212 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
215 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
219 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
222 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
223 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
227 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
228 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
229 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
230 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
231 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
232 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
233 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
234 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
235 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.53
Metatranscriptomes 0.65
Isolates 0.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.65
Nodule 0
Rhizoplane 5.89
Rhizosphere 92.64
Stem 0
Stem Tuber 0
Unclassified 0.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501071_0268363 3300049587 Bacteria 1290
2 JGI24743J22301_10004038 3300001991 Bacteria 2362
3 JGI24738J21930_10008763 3300002075 Bacteria 2294
4 Ga0070658_10004518 3300005327 Bacteria 11311
5 Ga0070683_100060200 3300005329 Bacteria 3529
6 Ga0070683_100064082 3300005329 Bacteria 3420
7 Ga0070683_100219075 3300005329 Bacteria 1809
8 Ga0070683_100262068 3300005329 Bacteria 1644
9 Ga0070690_100141484 3300005330 Bacteria 1634
10 Ga0070690_100398136 3300005330 Bacteria 1011
11 Ga0070670_100010472 3300005331 Bacteria 7914
12 Ga0068869_100033559 3300005334 Bacteria 3623
13 Ga0070680_100021172 3300005336 Bacteria 5166
14 Ga0070680_100451162 3300005336 Bacteria 1098
15 Ga0070682_100001969 3300005337 Bacteria 11452
16 Ga0070682_100074234 3300005337 Bacteria 2184
17 Ga0070682_100160767 3300005337 Bacteria 1551
18 Ga0068868_100070274 3300005338 Bacteria 2791
19 Ga0068868_100071326 3300005338 Bacteria 2770
20 Ga0068868_100788823 3300005338 Bacteria 856
21 Ga0070660_100019863 3300005339 Bacteria 4929
22 Ga0070660_100030332 3300005339 Bacteria 4057
23 Ga0070660_100047611 3300005339 Bacteria 3291
24 Ga0070660_100252865 3300005339 Bacteria 1437
25 Ga0070689_100031766 3300005340 Bacteria 4013
26 Ga0070691_10002590 3300005341 Bacteria 8066
27 Ga0070691_10006701 3300005341 Bacteria 5272
28 Ga0070661_100018147 3300005344 Bacteria 5000
29 Ga0070661_100074518 3300005344 Bacteria 2499
30 Ga0070692_10000701 3300005345 Bacteria 10792
31 Ga0070692_10048019 3300005345 Bacteria 2210
32 Ga0070675_100006014 3300005354 Bacteria 9299
33 Ga0070675_100019856 3300005354 Bacteria 5360
34 Ga0070675_100040183 3300005354 Bacteria 3818
35 Ga0070671_100425506 3300005355 Bacteria 1137
36 Ga0070671_100606963 3300005355 Bacteria 946
37 Ga0070674_100016328 3300005356 Bacteria 4653
38 Ga0070674_100065578 3300005356 Bacteria 2549
39 Ga0070674_100203069 3300005356 Bacteria 1532
40 Ga0070674_100235673 3300005356 Bacteria 1430
41 Ga0070674_100649451 3300005356 Bacteria 897
42 Ga0070673_100370175 3300005364 Bacteria 1276
43 Ga0070673_100464432 3300005364 Bacteria 1140
44 Ga0070688_100058113 3300005365 Bacteria 2434
45 Ga0070688_100100650 3300005365 Bacteria 1905
46 Ga0070688_100333101 3300005365 Bacteria 1106
47 Ga0070659_100053021 3300005366 Bacteria 3191
48 Ga0070659_100074913 3300005366 Bacteria 2697
49 Ga0070659_100124968 3300005366 Bacteria 2087
50 Ga0070659_100139747 3300005366 Bacteria 1972
51 Ga0070667_100779732 3300005367 Bacteria 887
52 Ga0070701_10074809 3300005438 Bacteria 1820
53 Ga0070705_100012898 3300005440 Bacteria 4262
54 Ga0070705_100042366 3300005440 Bacteria 2602
55 Ga0070700_100030148 3300005441 Bacteria 3239
56 Ga0070700_100335460 3300005441 Bacteria 1116
57 Ga0070700_100367594 3300005441 Bacteria 1071
58 Ga0070700_100533471 3300005441 Bacteria 909
59 Ga0070708_100020742 3300005445 Bacteria 5548
60 Ga0070678_100009953 3300005456 Bacteria 5783
61 Ga0070678_100120440 3300005456 Bacteria 2068
62 Ga0070662_100022506 3300005457 Bacteria 4317
63 Ga0070662_100098115 3300005457 Bacteria 2212
64 Ga0070662_100279505 3300005457 Bacteria 1351
65 Ga0070681_10038448 3300005458 Bacteria 4798
66 Ga0068867_100039980 3300005459 Bacteria 3420
67 Ga0068867_100046023 3300005459 Bacteria 3203
68 Ga0068867_100200369 3300005459 Bacteria 1598
69 Ga0068867_100265180 3300005459 Bacteria 1402
70 Ga0070685_10001614 3300005466 Bacteria 11898
71 Ga0070685_10034015 3300005466 Bacteria 2868
72 Ga0070685_10190922 3300005466 Bacteria 1325
73 Ga0070698_100054157 3300005471 Bacteria 4074
74 Ga0070699_100062017 3300005518 Bacteria 3240
75 Ga0070679_100041574 3300005530 Bacteria 4574
76 Ga0070679_100150874 3300005530 Bacteria 2301
77 Ga0070679_100438832 3300005530 Bacteria 1251
78 Ga0070679_100739911 3300005530 Bacteria 926
79 Ga0070684_100023862 3300005535 Bacteria 5123
80 Ga0070684_100040917 3300005535 Bacteria 3993
81 Ga0070684_100046944 3300005535 Bacteria 3743
82 Ga0070684_100119486 3300005535 Bacteria 2370
83 Ga0070684_100132192 3300005535 Bacteria 2251
84 Ga0070697_100400268 3300005536 Bacteria 1191
85 Ga0068853_100025879 3300005539 Bacteria 4925
86 Ga0068853_100108683 3300005539 Bacteria 2461
87 Ga0068853_100713518 3300005539 Bacteria 957
88 Ga0070672_100007082 3300005543 Bacteria 7585
89 Ga0070672_100017859 3300005543 Bacteria 5115
90 Ga0070696_100174418 3300005546 Bacteria 1591
91 Ga0070696_100396348 3300005546 Bacteria 1079
92 Ga0070693_100039428 3300005547 Bacteria 2646
93 Ga0070665_100081316 3300005548 Bacteria 3246
94 Ga0070665_100212625 3300005548 Bacteria 1935
95 Ga0070665_100276383 3300005548 Bacteria 1681
96 Ga0070704_100384925 3300005549 Bacteria 1193
97 Ga0070704_100426411 3300005549 Bacteria 1137
98 Ga0068855_100005064 3300005563 Bacteria 16074
99 Ga0068855_100046877 3300005563 Bacteria 5108
100 Ga0070664_100120063 3300005564 Bacteria 2301
101 Ga0070664_100228729 3300005564 Bacteria 1666
102 Ga0068857_100055280 3300005577 Bacteria 3523
103 Ga0068857_100275574 3300005577 Bacteria 1546
104 Ga0068857_100433691 3300005577 Bacteria 1227
105 Ga0068857_100811053 3300005577 Bacteria 894
106 Ga0068854_100020907 3300005578 Bacteria 4435
107 Ga0068854_100042116 3300005578 Bacteria 3230
108 Ga0068854_100248216 3300005578 Bacteria 1420
109 Ga0068856_100110279 3300005614 Bacteria 2749
110 Ga0070702_100004419 3300005615 Bacteria 6418
111 Ga0070702_100029543 3300005615 Bacteria 2982
112 Ga0068852_100041545 3300005616 Bacteria 3887
113 Ga0068859_100130176 3300005617 Bacteria 2587
114 Ga0068866_10052851 3300005718 Bacteria 2074
115 Ga0068866_10186353 3300005718 Bacteria 1230
116 Ga0068861_100186715 3300005719 Bacteria 1729
117 Ga0068861_100512115 3300005719 Bacteria 1087
118 Ga0068851_10005763 3300005834 Bacteria 5641
119 Ga0068851_10074995 3300005834 Bacteria 1757
120 Ga0068851_10107389 3300005834 Bacteria 1487
121 Ga0068870_10006246 3300005840 Bacteria 5244
122 Ga0068870_10200558 3300005840 Bacteria 1209
123 Ga0068870_10254614 3300005840 Bacteria 1090
124 Ga0068863_100012681 3300005841 Bacteria 8129
125 Ga0068858_100217503 3300005842 Bacteria 1809
126 Ga0068860_100027171 3300005843 Bacteria 5513
127 Ga0081455_10012601 3300005937 Bacteria 8427
128 Ga0081455_10018534 3300005937 Bacteria 6625
129 Ga0075365_10063190 3300006038 Bacteria 2478
130 Ga0075432_10001828 3300006058 Bacteria 7009
131 Ga0097621_100037886 3300006237 Bacteria 3868
132 Ga0097621_100116981 3300006237 Bacteria 2258
133 Ga0097621_100252536 3300006237 Bacteria 1544
134 Ga0097621_100312731 3300006237 Bacteria 1390
135 Ga0068871_100049291 3300006358 Bacteria 3403
136 Ga0075428_100001371 3300006844 Bacteria 25896
137 Ga0075428_100233464 3300006844 Bacteria 1985
138 Ga0075428_100339969 3300006844 Bacteria 1612
139 Ga0075431_100569144 3300006847 Bacteria 1119
140 Ga0075433_10185380 3300006852 Bacteria 1852
141 Ga0075433_10207557 3300006852 Bacteria 1742
142 Ga0075433_10592838 3300006852 Bacteria 973
143 Ga0075434_100013480 3300006871 Bacteria 7782
144 Ga0075429_100118235 3300006880 Bacteria 2317
145 Ga0075429_100133594 3300006880 Bacteria 2171
146 Ga0068865_100009088 3300006881 Bacteria 6150
147 Ga0068865_100017399 3300006881 Bacteria 4624
148 Ga0068865_100112764 3300006881 Bacteria 2009
149 Ga0068865_100159583 3300006881 Bacteria 1719
150 Ga0068865_100198619 3300006881 Bacteria 1556
151 Ga0068865_100465955 3300006881 Bacteria 1047
152 Ga0097620_100130171 3300006931 Bacteria 2587
153 Ga0105240_10003214 3300009093 Bacteria 25601
154 Ga0111539_10003651 3300009094 Bacteria 20267
155 Ga0111539_10137468 3300009094 Bacteria 2861
156 Ga0111539_10146820 3300009094 Bacteria 2761
157 Ga0111539_10153629 3300009094 Bacteria 2694
158 Ga0111539_10409095 3300009094 Bacteria 1580
159 Ga0111539_10473260 3300009094 Bacteria 1459
160 Ga0111539_10745911 3300009094 Bacteria 1140
161 Ga0111539_11202196 3300009094 Bacteria 880
162 Ga0105245_10001051 3300009098 Bacteria 24993
163 Ga0105245_10010438 3300009098 Bacteria 8086
164 Ga0105245_10044947 3300009098 Bacteria 3943
165 Ga0105245_10592567 3300009098 Bacteria 1134
166 Ga0105245_10630519 3300009098 Bacteria 1101
167 Ga0105245_10694981 3300009098 Bacteria 1050
168 Ga0105247_10007567 3300009101 Bacteria 6654
169 Ga0105247_10022709 3300009101 Bacteria 3778
170 Ga0114129_10007210 3300009147 Bacteria 15822
171 Ga0114129_10124756 3300009147 Bacteria 3541
172 Ga0114129_10133557 3300009147 Bacteria 3407
173 Ga0114129_10251215 3300009147 Bacteria 2374
174 Ga0114129_10751925 3300009147 Bacteria 1248
175 Ga0114129_11599639 3300009147 Bacteria 798
176 Ga0105243_10002773 3300009148 Bacteria 14574
177 Ga0105243_10008798 3300009148 Bacteria 7731
178 Ga0105243_10024213 3300009148 Bacteria 4630
179 Ga0105243_10040442 3300009148 Bacteria 3641
180 Ga0105243_10086487 3300009148 Bacteria 2571
181 Ga0105243_10123316 3300009148 Bacteria 2188
182 Ga0105243_10201285 3300009148 Bacteria 1746
183 Ga0105242_10007752 3300009176 Bacteria 8260
184 Ga0105242_10054471 3300009176 Bacteria 3269
185 Ga0105242_10398375 3300009176 Bacteria 1284
186 Ga0105248_10159172 3300009177 Bacteria 2548
187 Ga0105248_10248052 3300009177 Bacteria 2004
188 Ga0105248_10694794 3300009177 Bacteria 1148
189 Ga0105238_10122204 3300009551 Bacteria 2583
190 Ga0105238_10152747 3300009551 Bacteria 2284
191 Ga0105238_10350087 3300009551 Unclassified 1466
192 Ga0105249_10121038 3300009553 Bacteria 2487
193 Ga0105249_10377397 3300009553 Bacteria 1443
194 Ga0105249_10379099 3300009553 Bacteria 1440
195 Ga0105249_11200785 3300009553 Bacteria 829
196 Ga0105035_100734 3300009988 Bacteria 2058
197 Ga0105239_10034054 3300010375 Bacteria 5592
198 Ga0105239_10074000 3300010375 Bacteria 3745
199 Ga0105239_10288861 3300010375 Bacteria 1847
200 Ga0105246_10145661 3300011119 Bacteria 1787
201 Ga0105246_10678585 3300011119 Bacteria 900
202 Ga0105246_10876378 3300011119 Bacteria 803
203 Ga0157371_10015911 3300013102 Bacteria 5627
204 Ga0157371_10262030 3300013102 Unclassified 1246
205 Ga0157371_10323569 3300013102 Bacteria 1119
206 Ga0157370_10003097 3300013104 Bacteria 19682
207 Ga0157369_10002116 3300013105 Bacteria 23937
208 Ga0157378_10014950 3300013297 Bacteria 6794
209 Ga0157378_11134707 3300013297 Bacteria 820
210 Ga0163162_10190308 3300013306 Bacteria 2179
211 Ga0157372_10064031 3300013307 Bacteria 4125
212 Ga0157372_10374212 3300013307 Bacteria 1660
213 Ga0157375_10013424 3300013308 Bacteria 7290
214 Ga0157375_10058742 3300013308 Bacteria 3807
215 Ga0157375_10078909 3300013308 Bacteria 3326
216 Ga0157375_10908042 3300013308 Bacteria 1024
217 Ga0163163_10096781 3300014325 Bacteria 2972
218 Ga0157380_10001694 3300014326 Bacteria 14565
219 Ga0157380_10007473 3300014326 Bacteria 7760
220 Ga0157380_10191495 3300014326 Bacteria 1806
221 Ga0157380_10429435 3300014326 Bacteria 1263
222 Ga0157380_10838145 3300014326 Bacteria 940
223 Ga0157377_10009551 3300014745 Bacteria 4765
224 Ga0157377_10040374 3300014745 Bacteria 2584
225 Ga0157377_10137007 3300014745 Bacteria 1501
226 Ga0157377_10164734 3300014745 Bacteria 1381
227 Ga0157379_10006395 3300014968 Bacteria 10150
228 Ga0157379_10117257 3300014968 Bacteria 2395
229 Ga0157376_10017308 3300014969 Bacteria 5493
230 Ga0157376_10051475 3300014969 Bacteria 3421
231 Ga0157376_10117802 3300014969 Bacteria 2349
232 Ga0163161_10239023 3300017792 Bacteria 1412
233 Ga0206356_10043986 3300020070 Bacteria 3597
234 Ga0206354_11035581 3300020081 Bacteria 1519
235 Ga0206353_10558678 3300020082 Bacteria 948
236 Ga0206353_11853102 3300020082 Bacteria 1095
237 Ga0209455_1006677 3300025272 Bacteria 3375
238 Ga0207656_10061090 3300025321 Bacteria 1653
239 Ga0207653_10010857 3300025885 Bacteria 2842
240 Ga0207682_10174460 3300025893 Bacteria 979
241 Ga0207642_10036225 3300025899 Bacteria 2115
242 Ga0207642_10147665 3300025899 Bacteria 1247
243 Ga0207688_10003229 3300025901 Bacteria 8901
244 Ga0207688_10034277 3300025901 Bacteria 2811
245 Ga0207647_10060104 3300025904 Bacteria 2324
246 Ga0207645_10030936 3300025907 Bacteria 3448
247 Ga0207643_10003445 3300025908 Bacteria 8507
248 Ga0207643_10244070 3300025908 Bacteria 1105
249 Ga0207705_10265986 3300025909 Bacteria 1310
250 Ga0207654_10127134 3300025911 Bacteria 1608
251 Ga0207707_10131870 3300025912 Bacteria 2185
252 Ga0207707_10172679 3300025912 Bacteria 1889
253 Ga0207695_10137700 3300025913 Bacteria 2393
254 Ga0207660_10013664 3300025917 Bacteria 5324
255 Ga0207660_10016708 3300025917 Bacteria 4864
256 Ga0207657_10009408 3300025919 Bacteria 9822
257 Ga0207657_10030060 3300025919 Bacteria 4935
258 Ga0207657_10067295 3300025919 Bacteria 3046
259 Ga0207657_10067411 3300025919 Bacteria 3043
260 Ga0207649_10023281 3300025920 Bacteria 3585
261 Ga0207652_10064752 3300025921 Bacteria 3163
262 Ga0207652_10080844 3300025921 Bacteria 2842
263 Ga0207652_10342254 3300025921 Bacteria 1350
264 Ga0207652_10736605 3300025921 Bacteria 878
265 Ga0207694_10721808 3300025924 Bacteria 841
266 Ga0207650_10006604 3300025925 Bacteria 7907
267 Ga0207659_10016981 3300025926 Bacteria 4748
268 Ga0207659_10212002 3300025926 Bacteria 1553
269 Ga0207687_10010790 3300025927 Bacteria 5972
270 Ga0207687_10022140 3300025927 Bacteria 4228
271 Ga0207687_10637753 3300025927 Bacteria 900
272 Ga0207644_10140856 3300025931 Bacteria 1857
273 Ga0207644_10420489 3300025931 Bacteria 1095
274 Ga0207690_10036124 3300025932 Bacteria 3197
275 Ga0207690_10071373 3300025932 Bacteria 2395
276 Ga0207690_10126457 3300025932 Bacteria 1864
277 Ga0207690_10132976 3300025932 Bacteria 1823
278 Ga0207690_10288834 3300025932 Bacteria 1279
279 Ga0207706_10010447 3300025933 Bacteria 8482
280 Ga0207706_10067440 3300025933 Bacteria 3147
281 Ga0207706_10167430 3300025933 Bacteria 1931
282 Ga0207686_10043495 3300025934 Bacteria 2752
283 Ga0207686_10232556 3300025934 Bacteria 1337
284 Ga0207709_10002814 3300025935 Bacteria 10700
285 Ga0207709_10023589 3300025935 Bacteria 3504
286 Ga0207709_10213056 3300025935 Bacteria 1388
287 Ga0207709_10286475 3300025935 Bacteria 1219
288 Ga0207669_10015237 3300025937 Bacteria 3873
289 Ga0207669_10071357 3300025937 Bacteria 2181
290 Ga0207669_10074021 3300025937 Bacteria 2152
291 Ga0207669_10126090 3300025937 Bacteria 1749
292 Ga0207704_10012133 3300025938 Bacteria 4268
293 Ga0207704_10031051 3300025938 Bacteria 3003
294 Ga0207704_10051657 3300025938 Bacteria 2488
295 Ga0207704_10248936 3300025938 Bacteria 1333
296 Ga0207691_10003414 3300025940 Bacteria 15440
297 Ga0207691_10048923 3300025940 Bacteria 3874
298 Ga0207691_10816805 3300025940 Bacteria 783
299 Ga0207711_10269122 3300025941 Bacteria 1567
300 Ga0207711_10290871 3300025941 Bacteria 1506
301 Ga0207689_10245640 3300025942 Bacteria 1480
302 Ga0207661_10053761 3300025944 Bacteria 3224
303 Ga0207661_10086247 3300025944 Bacteria 2605
304 Ga0207661_10089574 3300025944 Bacteria 2560
305 Ga0207661_10129199 3300025944 Bacteria 2162
306 Ga0207661_10142879 3300025944 Bacteria 2061
307 Ga0207661_10144027 3300025944 Bacteria 2054
308 Ga0207661_10156313 3300025944 Bacteria 1975
309 Ga0207661_10339663 3300025944 Bacteria 1353
310 Ga0207661_10702202 3300025944 Bacteria 930
311 Ga0207651_10193446 3300025960 Bacteria 1624
312 Ga0207651_10351359 3300025960 Bacteria 1241
313 Ga0207651_10394183 3300025960 Bacteria 1176
314 Ga0207712_10116147 3300025961 Bacteria 2016
315 Ga0207712_10395388 3300025961 Bacteria 1160
316 Ga0207640_10026911 3300025981 Bacteria 3498
317 Ga0207640_10154506 3300025981 Bacteria 1690
318 Ga0207640_10459527 3300025981 Bacteria 1051
319 Ga0207658_10415087 3300025986 Bacteria 1186
320 Ga0207677_10078973 3300026023 Bacteria 2352
321 Ga0207677_10348379 3300026023 Bacteria 1240
322 Ga0207703_10204441 3300026035 Bacteria 1757
323 Ga0207639_10037042 3300026041 Bacteria 3620
324 Ga0207639_10239762 3300026041 Bacteria 1576
325 Ga0207678_10260782 3300026067 Bacteria 1485
326 Ga0207708_10026305 3300026075 Bacteria 4402
327 Ga0207708_10034804 3300026075 Bacteria 3832
328 Ga0207648_10010878 3300026089 Bacteria 8598
329 Ga0207648_10089655 3300026089 Bacteria 2687
330 Ga0207648_10102994 3300026089 Bacteria 2503
331 Ga0207676_10098149 3300026095 Bacteria 2421
332 Ga0207674_10069692 3300026116 Bacteria 3536
333 Ga0207674_10095646 3300026116 Bacteria 2956
334 Ga0207674_10140464 3300026116 Bacteria 2375
335 Ga0207674_11085619 3300026116 Bacteria 770
336 Ga0207675_100011934 3300026118 Bacteria 8117
337 Ga0207675_100066265 3300026118 Bacteria 3375
338 Ga0207675_100217302 3300026118 Bacteria 1841
339 Ga0207675_100271635 3300026118 Bacteria 1645
340 Ga0207675_100334265 3300026118 Bacteria 1482
341 Ga0207683_10003328 3300026121 Bacteria 14006
342 Ga0207683_10051063 3300026121 Bacteria 3623
343 Ga0207683_10088751 3300026121 Bacteria 2752
344 Ga0207698_10002852 3300026142 Bacteria 10339
345 Ga0207698_10035961 3300026142 Bacteria 3629
346 Ga0207428_10001271 3300027907 Bacteria 26982
347 Ga0207428_10023568 3300027907 Bacteria 5174
348 Ga0207428_10137666 3300027907 Bacteria 1866
349 Ga0207428_10156049 3300027907 Bacteria 1736
350 Ga0207428_10314049 3300027907 Bacteria 1158
351 Ga0268266_10127134 3300028379 Bacteria 2276
352 Ga0268264_10041116 3300028381 Bacteria 3822
353 Ga0268264_10127850 3300028381 Bacteria 2248
354 Ga0265319_1013218 3300028563 Bacteria 3295
355 Ga0265338_10474230 3300028800 Bacteria 884
356 Ga0265320_10021080 3300031240 Bacteria 3515
357 Ga0265320_10035586 3300031240 Bacteria 2523
358 Ga0307413_10062502 3300031824 Bacteria 2304
359 Ga0307413_10342836 3300031824 Bacteria 1150
360 Ga0307406_10429528 3300031901 Bacteria 1055
361 Ga0307409_100443671 3300031995 Bacteria 1251
362 Ga0307409_100693024 3300031995 Bacteria 1017
363 Ga0373944_0062302 3300035089 Bacteria 1199
364 Ga0373951_0112877 3300035091 Bacteria 733
365 Ga0373952_0008403 3300035092 Bacteria 1959
366 Ga0373932_0113631 3300035112 Bacteria 895
367 Ga0373927_0423138 3300035695 Bacteria 879
368 Ga0395900_0289912 3300037418 Bacteria 1626
369 Ga0395900_0616954 3300037418 Bacteria 1024
370 Ga0451847_0614042 3300041503 Bacteria 906
371 Ga0450923_003558 3300042125 Bacteria 2367
372 Ga0439458_0106913 3300042157 Bacteria 730
373 Ga0466959_0157156 3300045049 Bacteria 1600
374 Ga0495603_0275638 3300046455 Bacteria 967
375 Ga0495603_0379701 3300046455 Bacteria 810
376 Ga0495656_0222186 3300046615 Bacteria 945
377 Ga0495658_0260309 3300046683 Bacteria 1092
378 Ga0495672_0010268 3300047320 Bacteria 6689
379 Ga0495676_0417519 3300047321 Bacteria 888
380 Ga0496100_0032237 3300048903 Bacteria 3265
381 Ga0496100_0070973 3300048903 Bacteria 2324
382 Ga0496100_0097753 3300048903 Bacteria 2017
383 Ga0496101_0013228 3300048904 Bacteria 5526
384 Ga0496101_0052792 3300048904 Bacteria 2931
385 Ga0496101_0107247 3300048904 Bacteria 2098
386 Ga0496101_0510501 3300048904 Bacteria 950
387 Ga0496102_0282185 3300048905 Bacteria 1565
388 Ga0496102_0342441 3300048905 Bacteria 1408
389 Ga0496103_0055822 3300048906 Bacteria 2450
390 Ga0496104_0023533 3300048907 Bacteria 5663
391 Ga0496104_0051771 3300048907 Bacteria 3876
392 Ga0496104_0059548 3300048907 Bacteria 3616
393 Ga0496105_0077325 3300048908 Bacteria 2748
394 Ga0496105_0096206 3300048908 Bacteria 2445
395 Ga0496106_0118726 3300048909 Bacteria 2065
396 Ga0496106_0123741 3300048909 Bacteria 2023
397 Ga0496107_0025831 3300048910 Bacteria 4161
398 Ga0496108_0006864 3300048911 Bacteria 9213
399 Ga0496109_0057601 3300048912 Bacteria 3547
400 Ga0496109_0117936 3300048912 Bacteria 2471
401 Ga0496109_0134832 3300048912 Bacteria 2306
402 Ga0496110_0063278 3300048913 Bacteria 3269
403 Ga0496110_0170757 3300048913 Bacteria 1973
404 Ga0496110_0395882 3300048913 Bacteria 1259
405 Ga0496110_0441110 3300048913 Bacteria 1187
406 Ga0496111_0009129 3300048914 Bacteria 6600
407 Ga0496111_0009721 3300048914 Bacteria 6429
408 Ga0496112_0238738 3300048915 Bacteria 1771
409 Ga0496112_0373265 3300048915 Bacteria 1368
410 Ga0496113_0118537 3300048916 Bacteria 2067
411 Ga0496114_0008450 3300048917 Bacteria 8158
412 Ga0496114_0028287 3300048917 Bacteria 4598
413 Ga0496114_0080288 3300048917 Bacteria 2754
414 Ga0496114_0358274 3300048917 Bacteria 1290
415 Ga0496114_0522283 3300048917 Bacteria 1050
416 Ga0496126_0002867 3300048929 Bacteria 22507
417 Ga0501031_0008096 3300049568 Bacteria 6848
418 Ga0501031_0072128 3300049568 Bacteria 2248
419 Ga0501031_0152540 3300049568 Bacteria 1510
420 Ga0501031_0262615 3300049568 Bacteria 1122
421 Ga0501032_0032649 3300049569 Bacteria 3567
422 Ga0501032_0168448 3300049569 Bacteria 1437
423 Ga0501033_0005573 3300049570 Bacteria 9959
424 Ga0501033_0016134 3300049570 Bacteria 5656
425 Ga0501033_0144984 3300049570 Bacteria 1715
426 Ga0501034_0760563 3300049571 Unclassified 864
427 Ga0501036_0022290 3300049572 Bacteria 5327
428 Ga0501036_0038791 3300049572 Bacteria 4032
429 Ga0501036_0088659 3300049572 Bacteria 2614
430 Ga0501036_0235686 3300049572 Bacteria 1535
431 Ga0501036_0330323 3300049572 Bacteria 1274
432 Ga0501036_0397877 3300049572 Bacteria 1149
433 Ga0501036_0469027 3300049572 Bacteria 1048
434 Ga0501037_0019647 3300049573 Bacteria 4984
435 Ga0501037_0070034 3300049573 Bacteria 2553
436 Ga0501037_0084247 3300049573 Bacteria 2302
437 Ga0501038_0021980 3300049574 Bacteria 5721
438 Ga0501038_0083652 3300049574 Bacteria 2686
439 Ga0501038_0616290 3300049574 Bacteria 820
440 Ga0501039_0008894 3300049575 Bacteria 7651
441 Ga0501039_0092160 3300049575 Bacteria 2362
442 Ga0501039_0169305 3300049575 Bacteria 1717
443 Ga0501039_0249140 3300049575 Bacteria 1397
444 Ga0501040_0002817 3300049576 Bacteria 11219
445 Ga0501040_0013180 3300049576 Bacteria 5437
446 Ga0501040_0024748 3300049576 Bacteria 4031
447 Ga0501040_0140779 3300049576 Bacteria 1699
448 Ga0501040_0229513 3300049576 Bacteria 1322
449 Ga0501041_0004590 3300049577 Bacteria 8013
450 Ga0501041_0012905 3300049577 Bacteria 4950
451 Ga0501041_0030711 3300049577 Bacteria 3243
452 Ga0501042_0004285 3300049578 Bacteria 9084
453 Ga0501042_0015577 3300049578 Bacteria 5208
454 Ga0501042_0034203 3300049578 Bacteria 3604
455 Ga0501042_0034374 3300049578 Bacteria 3595
456 Ga0501042_0161955 3300049578 Bacteria 1614
457 Ga0501042_0174968 3300049578 Bacteria 1548
458 Ga0501042_0180655 3300049578 Bacteria 1522
459 Ga0501042_0203781 3300049578 Bacteria 1426
460 Ga0501042_0294728 3300049578 Bacteria 1172
461 Ga0501043_0009425 3300049579 Bacteria 7663
462 Ga0501046_0019245 3300049580 Bacteria 5663
463 Ga0501046_0028578 3300049580 Bacteria 4540
464 Ga0501046_0166232 3300049580 Bacteria 1657
465 Ga0501047_0180266 3300049581 Bacteria 1979
466 Ga0501048_0009210 3300049582 Bacteria 7418
467 Ga0501048_0026273 3300049582 Bacteria 4238
468 Ga0501048_0049344 3300049582 Bacteria 3000
469 Ga0501048_0070959 3300049582 Bacteria 2459
470 Ga0501048_0088033 3300049582 Bacteria 2190
471 Ga0501048_0146124 3300049582 Bacteria 1672
472 Ga0501067_0004310 3300049583 Bacteria 7838
473 Ga0501067_0134558 3300049583 Bacteria 1376
474 Ga0501068_0007231 3300049584 Bacteria 6146
475 Ga0501068_0009929 3300049584 Bacteria 5336
476 Ga0501068_0011079 3300049584 Bacteria 5075
477 Ga0501068_0011798 3300049584 Bacteria 4941
478 Ga0501068_0021779 3300049584 Bacteria 3746
479 Ga0501068_0025073 3300049584 Bacteria 3506
480 Ga0501069_0001405 3300049585 Bacteria 11802
481 Ga0501069_0014713 3300049585 Bacteria 4184
482 Ga0501069_0017397 3300049585 Bacteria 3867
483 Ga0501070_0004678 3300049586 Bacteria 11720
484 Ga0501070_0421417 3300049586 Bacteria 1078
485 Ga0501071_0008670 3300049587 Bacteria 6726
486 Ga0501071_0027360 3300049587 Bacteria 4011
487 Ga0501071_0066042 3300049587 Bacteria 2628
488 Ga0501071_0262345 3300049587 Bacteria 1305
489 Ga0501071_0302674 3300049587 Bacteria 1212
490 Ga0501071_0321707 3300049587 Bacteria 1175
491 Ga0501072_0006605 3300049588 Bacteria 8831
492 Ga0501072_0018027 3300049588 Bacteria 5428
493 Ga0501072_0019579 3300049588 Bacteria 5234
494 Ga0501072_0050156 3300049588 Bacteria 3286
495 Ga0501072_0068584 3300049588 Bacteria 2799
496 Ga0501072_0080504 3300049588 Bacteria 2581
497 Ga0501072_0214622 3300049588 Bacteria 1533
498 Ga0501072_0215066 3300049588 Bacteria 1532
499 Ga0501072_0261406 3300049588 Bacteria 1377
500 Ga0501072_0268707 3300049588 Bacteria 1357
501 Ga0501072_0296610 3300049588 Bacteria 1285
502 Ga0501072_0536730 3300049588 Bacteria 924
503 Ga0501072_0681671 3300049588 Bacteria 808
504 Ga0501073_0029648 3300049589 Bacteria 3909
505 Ga0501073_0066481 3300049589 Bacteria 2513
506 Ga0501074_0002513 3300049590 Bacteria 12790
507 Ga0501074_0027641 3300049590 Bacteria 4113
508 Ga0501074_0088740 3300049590 Bacteria 2214
509 Ga0501074_0112281 3300049590 Bacteria 1950
510 Ga0501074_0189618 3300049590 Bacteria 1466
511 Ga0501074_0312437 3300049590 Bacteria 1116
512 Ga0501075_0011323 3300049591 Bacteria 6310
513 Ga0501075_0013079 3300049591 Bacteria 5915
514 Ga0501075_0017997 3300049591 Bacteria 5107
515 Ga0501075_0025002 3300049591 Bacteria 4385
516 Ga0501075_0053810 3300049591 Bacteria 3027
517 Ga0501075_0084260 3300049591 Bacteria 2407
518 Ga0501075_0622481 3300049591 Bacteria 823
519 Ga0501076_0018875 3300049592 Bacteria 5262
520 Ga0501076_0019934 3300049592 Bacteria 5131
521 Ga0501076_0037106 3300049592 Bacteria 3821
522 Ga0501076_0046733 3300049592 Bacteria 3420
523 Ga0501076_0095256 3300049592 Bacteria 2397
524 Ga0501076_0219867 3300049592 Bacteria 1553
525 Ga0501076_0227728 3300049592 Bacteria 1524
526 Ga0501076_0264603 3300049592 Bacteria 1408
527 Ga0501076_0377342 3300049592 Bacteria 1165
528 Ga0501076_0570846 3300049592 Bacteria 933
529 Ga0501077_0018031 3300049593 Bacteria 4461
530 Ga0501077_0020641 3300049593 Bacteria 4171
531 Ga0501077_0088934 3300049593 Bacteria 1957
532 Ga0501077_0121209 3300049593 Bacteria 1657
533 Ga0501077_0121636 3300049593 Bacteria 1654
534 Ga0501077_0236455 3300049593 Bacteria 1161
535 Ga0501077_0610702 3300049593 Bacteria 700
536 Ga0501079_0023283 3300049741 Bacteria 4754
537 Ga0501079_0023312 3300049741 Bacteria 4751
538 Ga0501079_0118503 3300049741 Bacteria 2058
539 Ga0501079_0218318 3300049741 Bacteria 1489
540 Ga0501080_0039450 3300049742 Bacteria 4407
541 Ga0501080_0128658 3300049742 Bacteria 2345
542 Ga0501080_0403725 3300049742 Bacteria 1229
543 Ga0501081_0019434 3300049743 Bacteria 4524
544 Ga0501081_0145080 3300049743 Bacteria 1703
545 Ga0501081_0168019 3300049743 Bacteria 1583
546 Ga0501083_0002351 3300049744 Bacteria 12948
547 Ga0501083_0528739 3300049744 Bacteria 767
548 Ga0501035_0037279 3300049822 Bacteria 4403
549 Ga0501035_0458010 3300049822 Bacteria 1054
550 Ga0501044_0220495 3300049823 Bacteria 1847
551 Ga0501045_0055780 3300049824 Bacteria 2889
552 Ga0501045_0062406 3300049824 Bacteria 2734
553 Ga0501045_0133368 3300049824 Bacteria 1846
554 Ga0501045_0192793 3300049824 Bacteria 1518
555 Ga0501045_0268906 3300049824 Bacteria 1269
556 nmdc:mga00v17_20690_c1 3300050491 Bacteria 3773
557 nmdc:mga05p37_22579_c1 3300050507 Bacteria 7630
558 nmdc:mga05p37_27819_c1 3300050507 Bacteria 6887
559 nmdc:mga05p37_47154_c1 3300050507 Bacteria 5299
560 nmdc:mga05p37_863741_c1 3300050507 Bacteria 981
561 nmdc:mga05p37_88735_c1 3300050507 Bacteria 3811
562 nmdc:mga09592_139567_c1 3300050508 Bacteria 2088
563 nmdc:mga09592_155977_c1 3300050508 Bacteria 1971
564 nmdc:mga09592_195928_c1 3300050508 Bacteria 1749
565 nmdc:mga09592_910131_c1 3300050508 Bacteria 739
566 nmdc:mga0qj67_121037_c1 3300050509 Bacteria 2117
567 nmdc:mga06r32_128372_c1 3300050510 Bacteria 2505
568 nmdc:mga06r32_420686_c1 3300050510 Bacteria 1317
569 nmdc:mga08y16_277304_c1 3300050511 Bacteria 1730
570 nmdc:mga08y16_282195_c1 3300050511 Bacteria 1713
571 nmdc:mga08y16_362975_c1 3300050511 Bacteria 1487
572 nmdc:mga08y16_367761_c1 3300050511 Bacteria 1475
573 nmdc:mga08y16_569500_c1 3300050511 Bacteria 1145
574 nmdc:mga08y16_80074_c1 3300050511 Bacteria 3405
575 nmdc:mga08y16_9567_c1 3300050511 Bacteria 10175
576 nmdc:mga0n895_797420_c1 3300050512 Bacteria 935
577 nmdc:mga08x19_153041_c1 3300050514 Bacteria 1563
578 nmdc:mga0a205_6589_c1 3300050515 Bacteria 10503
579 Ga0500618_003082 3300053125 Bacteria 5896
580 Ga0501084_0004998 3300054114 Bacteria 10848
581 Ga0501084_0034740 3300054114 Bacteria 4215
582 Ga0501084_0047072 3300054114 Bacteria 3612
583 Ga0501084_0068548 3300054114 Bacteria 2970
584 Ga0501084_0144992 3300054114 Bacteria 2000
585 Ga0501084_0169383 3300054114 Bacteria 1843
586 Ga0501084_0291352 3300054114 Bacteria 1379
587 Ga0501084_0315393 3300054114 Bacteria 1321
588 Ga0501084_0331461 3300054114 Bacteria 1285
589 Ga0501082_0007129 3300060353 Bacteria 9636
590 Ga0501082_0015423 3300060353 Bacteria 6576
591 Ga0501082_0018961 3300060353 Bacteria 5927
592 Ga0501082_0067587 3300060353 Bacteria 3078
593 Ga0501082_0172971 3300060353 Bacteria 1878
594 Ga0501082_0176028 3300060353 Bacteria 1860
595 Ga0501082_0181885 3300060353 Bacteria 1829
596 Ga0501082_0190261 3300060353 Bacteria 1785
597 Ga0501082_0222999 3300060353 Bacteria 1640
598 Ga0501082_0299291 3300060353 Bacteria 1401
599 Ga0530510_0004477 3300061734 Bacteria 9673
600 Ga0530510_0018886 3300061734 Bacteria 4889
601 Ga0530510_0019103 3300061734 Bacteria 4860
602 Ga0530510_0027497 3300061734 Bacteria 4075
603 Ga0530510_0036288 3300061734 Bacteria 3553
604 Ga0530510_0128117 3300061734 Bacteria 1866
605 Ga0530510_0132850 3300061734 Bacteria 1831
606 Ga0530510_0346310 3300061734 Bacteria 1116
607 2839991163 2839989709 Bacteria 3773432
608 2870786903 2870782633 Bacteria 9624083
609 2884635208 2884634485 Bacteria 3928637
610 3001892571 3001892409 Bacteria 6328293
611 3001893217 3001892409 Bacteria 6328293
612 Ga0501071_0268363
613 JGI24743J22301_10004038
614 JGI24738J21930_10008763
615 Ga0070658_10004518
616 Ga0070683_100060200
617 Ga0070683_100064082
618 Ga0070683_100219075
619 Ga0070683_100262068
620 Ga0070690_100141484
621 Ga0070690_100398136
622 Ga0070670_100010472
623 Ga0068869_100033559
624 Ga0070680_100021172
625 Ga0070680_100451162
626 Ga0070682_100001969
627 Ga0070682_100074234
628 Ga0070682_100160767
629 Ga0068868_100070274
630 Ga0068868_100071326
631 Ga0068868_100788823
632 Ga0070660_100019863
633 Ga0070660_100030332
634 Ga0070660_100047611
635 Ga0070660_100252865
636 Ga0070689_100031766
637 Ga0070691_10002590
638 Ga0070691_10006701
639 Ga0070661_100018147
640 Ga0070661_100074518
641 Ga0070692_10000701
642 Ga0070692_10048019
643 Ga0070675_100006014
644 Ga0070675_100019856
645 Ga0070675_100040183
646 Ga0070671_100425506
647 Ga0070671_100606963
648 Ga0070674_100016328
649 Ga0070674_100065578
650 Ga0070674_100203069
651 Ga0070674_100235673
652 Ga0070674_100649451
653 Ga0070673_100370175
654 Ga0070673_100464432
655 Ga0070688_100058113
656 Ga0070688_100100650
657 Ga0070688_100333101
658 Ga0070659_100053021
659 Ga0070659_100074913
660 Ga0070659_100124968
661 Ga0070659_100139747
662 Ga0070667_100779732
663 Ga0070701_10074809
664 Ga0070705_100012898
665 Ga0070705_100042366
666 Ga0070700_100030148
667 Ga0070700_100335460
668 Ga0070700_100367594
669 Ga0070700_100533471
670 Ga0070708_100020742
671 Ga0070678_100009953
672 Ga0070678_100120440
673 Ga0070662_100022506
674 Ga0070662_100098115
675 Ga0070662_100279505
676 Ga0070681_10038448
677 Ga0068867_100039980
678 Ga0068867_100046023
679 Ga0068867_100200369
680 Ga0068867_100265180
681 Ga0070685_10001614
682 Ga0070685_10034015
683 Ga0070685_10190922
684 Ga0070698_100054157
685 Ga0070699_100062017
686 Ga0070679_100041574
687 Ga0070679_100150874
688 Ga0070679_100438832
689 Ga0070679_100739911
690 Ga0070684_100023862
691 Ga0070684_100040917
692 Ga0070684_100046944
693 Ga0070684_100119486
694 Ga0070684_100132192
695 Ga0070697_100400268
696 Ga0068853_100025879
697 Ga0068853_100108683
698 Ga0068853_100713518
699 Ga0070672_100007082
700 Ga0070672_100017859
701 Ga0070696_100174418
702 Ga0070696_100396348
703 Ga0070693_100039428
704 Ga0070665_100081316
705 Ga0070665_100212625
706 Ga0070665_100276383
707 Ga0070704_100384925
708 Ga0070704_100426411
709 Ga0068855_100005064
710 Ga0068855_100046877
711 Ga0070664_100120063
712 Ga0070664_100228729
713 Ga0068857_100055280
714 Ga0068857_100275574
715 Ga0068857_100433691
716 Ga0068857_100811053
717 Ga0068854_100020907
718 Ga0068854_100042116
719 Ga0068854_100248216
720 Ga0068856_100110279
721 Ga0070702_100004419
722 Ga0070702_100029543
723 Ga0068852_100041545
724 Ga0068859_100130176
725 Ga0068866_10052851
726 Ga0068866_10186353
727 Ga0068861_100186715
728 Ga0068861_100512115
729 Ga0068851_10005763
730 Ga0068851_10074995
731 Ga0068851_10107389
732 Ga0068870_10006246
733 Ga0068870_10200558
734 Ga0068870_10254614
735 Ga0068863_100012681
736 Ga0068858_100217503
737 Ga0068860_100027171
738 Ga0081455_10012601
739 Ga0081455_10018534
740 Ga0075365_10063190
741 Ga0075432_10001828
742 Ga0097621_100037886
743 Ga0097621_100116981
744 Ga0097621_100252536
745 Ga0097621_100312731
746 Ga0068871_100049291
747 Ga0075428_100001371
748 Ga0075428_100233464
749 Ga0075428_100339969
750 Ga0075431_100569144
751 Ga0075433_10185380
752 Ga0075433_10207557
753 Ga0075433_10592838
754 Ga0075434_100013480
755 Ga0075429_100118235
756 Ga0075429_100133594
757 Ga0068865_100009088
758 Ga0068865_100017399
759 Ga0068865_100112764
760 Ga0068865_100159583
761 Ga0068865_100198619
762 Ga0068865_100465955
763 Ga0097620_100130171
764 Ga0105240_10003214
765 Ga0111539_10003651
766 Ga0111539_10137468
767 Ga0111539_10146820
768 Ga0111539_10153629
769 Ga0111539_10409095
770 Ga0111539_10473260
771 Ga0111539_10745911
772 Ga0111539_11202196
773 Ga0105245_10001051
774 Ga0105245_10010438
775 Ga0105245_10044947
776 Ga0105245_10592567
777 Ga0105245_10630519
778 Ga0105245_10694981
779 Ga0105247_10007567
780 Ga0105247_10022709
781 Ga0114129_10007210
782 Ga0114129_10124756
783 Ga0114129_10133557
784 Ga0114129_10251215
785 Ga0114129_10751925
786 Ga0114129_11599639
787 Ga0105243_10002773
788 Ga0105243_10008798
789 Ga0105243_10024213
790 Ga0105243_10040442
791 Ga0105243_10086487
792 Ga0105243_10123316
793 Ga0105243_10201285
794 Ga0105242_10007752
795 Ga0105242_10054471
796 Ga0105242_10398375
797 Ga0105248_10159172
798 Ga0105248_10248052
799 Ga0105248_10694794
800 Ga0105238_10122204
801 Ga0105238_10152747
802 Ga0105238_10350087
803 Ga0105249_10121038
804 Ga0105249_10377397
805 Ga0105249_10379099
806 Ga0105249_11200785
807 Ga0105035_100734
808 Ga0105239_10034054
809 Ga0105239_10074000
810 Ga0105239_10288861
811 Ga0105246_10145661
812 Ga0105246_10678585
813 Ga0105246_10876378
814 Ga0157371_10015911
815 Ga0157371_10262030
816 Ga0157371_10323569
817 Ga0157370_10003097
818 Ga0157369_10002116
819 Ga0157378_10014950
820 Ga0157378_11134707
821 Ga0163162_10190308
822 Ga0157372_10064031
823 Ga0157372_10374212
824 Ga0157375_10013424
825 Ga0157375_10058742
826 Ga0157375_10078909
827 Ga0157375_10908042
828 Ga0163163_10096781
829 Ga0157380_10001694
830 Ga0157380_10007473
831 Ga0157380_10191495
832 Ga0157380_10429435
833 Ga0157380_10838145
834 Ga0157377_10009551
835 Ga0157377_10040374
836 Ga0157377_10137007
837 Ga0157377_10164734
838 Ga0157379_10006395
839 Ga0157379_10117257
840 Ga0157376_10017308
841 Ga0157376_10051475
842 Ga0157376_10117802
843 Ga0163161_10239023
844 Ga0206356_10043986
845 Ga0206354_11035581
846 Ga0206353_10558678
847 Ga0206353_11853102
848 Ga0209455_1006677
849 Ga0207656_10061090
850 Ga0207653_10010857
851 Ga0207682_10174460
852 Ga0207642_10036225
853 Ga0207642_10147665
854 Ga0207688_10003229
855 Ga0207688_10034277
856 Ga0207647_10060104
857 Ga0207645_10030936
858 Ga0207643_10003445
859 Ga0207643_10244070
860 Ga0207705_10265986
861 Ga0207654_10127134
862 Ga0207707_10131870
863 Ga0207707_10172679
864 Ga0207695_10137700
865 Ga0207660_10013664
866 Ga0207660_10016708
867 Ga0207657_10009408
868 Ga0207657_10030060
869 Ga0207657_10067295
870 Ga0207657_10067411
871 Ga0207649_10023281
872 Ga0207652_10064752
873 Ga0207652_10080844
874 Ga0207652_10342254
875 Ga0207652_10736605
876 Ga0207694_10721808
877 Ga0207650_10006604
878 Ga0207659_10016981
879 Ga0207659_10212002
880 Ga0207687_10010790
881 Ga0207687_10022140
882 Ga0207687_10637753
883 Ga0207644_10140856
884 Ga0207644_10420489
885 Ga0207690_10036124
886 Ga0207690_10071373
887 Ga0207690_10126457
888 Ga0207690_10132976
889 Ga0207690_10288834
890 Ga0207706_10010447
891 Ga0207706_10067440
892 Ga0207706_10167430
893 Ga0207686_10043495
894 Ga0207686_10232556
895 Ga0207709_10002814
896 Ga0207709_10023589
897 Ga0207709_10213056
898 Ga0207709_10286475
899 Ga0207669_10015237
900 Ga0207669_10071357
901 Ga0207669_10074021
902 Ga0207669_10126090
903 Ga0207704_10012133
904 Ga0207704_10031051
905 Ga0207704_10051657
906 Ga0207704_10248936
907 Ga0207691_10003414
908 Ga0207691_10048923
909 Ga0207691_10816805
910 Ga0207711_10269122
911 Ga0207711_10290871
912 Ga0207689_10245640
913 Ga0207661_10053761
914 Ga0207661_10086247
915 Ga0207661_10089574
916 Ga0207661_10129199
917 Ga0207661_10142879
918 Ga0207661_10144027
919 Ga0207661_10156313
920 Ga0207661_10339663
921 Ga0207661_10702202
922 Ga0207651_10193446
923 Ga0207651_10351359
924 Ga0207651_10394183
925 Ga0207712_10116147
926 Ga0207712_10395388
927 Ga0207640_10026911
928 Ga0207640_10154506
929 Ga0207640_10459527
930 Ga0207658_10415087
931 Ga0207677_10078973
932 Ga0207677_10348379
933 Ga0207703_10204441
934 Ga0207639_10037042
935 Ga0207639_10239762
936 Ga0207678_10260782
937 Ga0207708_10026305
938 Ga0207708_10034804
939 Ga0207648_10010878
940 Ga0207648_10089655
941 Ga0207648_10102994
942 Ga0207676_10098149
943 Ga0207674_10069692
944 Ga0207674_10095646
945 Ga0207674_10140464
946 Ga0207674_11085619
947 Ga0207675_100011934
948 Ga0207675_100066265
949 Ga0207675_100217302
950 Ga0207675_100271635
951 Ga0207675_100334265
952 Ga0207683_10003328
953 Ga0207683_10051063
954 Ga0207683_10088751
955 Ga0207698_10002852
956 Ga0207698_10035961
957 Ga0207428_10001271
958 Ga0207428_10023568
959 Ga0207428_10137666
960 Ga0207428_10156049
961 Ga0207428_10314049
962 Ga0268266_10127134
963 Ga0268264_10041116
964 Ga0268264_10127850
965 Ga0265319_1013218
966 Ga0265338_10474230
967 Ga0265320_10021080
968 Ga0265320_10035586
969 Ga0307413_10062502
970 Ga0307413_10342836
971 Ga0307406_10429528
972 Ga0307409_100443671
973 Ga0307409_100693024
974 Ga0373944_0062302
975 Ga0373951_0112877
976 Ga0373952_0008403
977 Ga0373932_0113631
978 Ga0373927_0423138
979 Ga0395900_0289912
980 Ga0395900_0616954
981 Ga0451847_0614042
982 Ga0450923_003558
983 Ga0439458_0106913
984 Ga0466959_0157156
985 Ga0495603_0275638
986 Ga0495603_0379701
987 Ga0495656_0222186
988 Ga0495658_0260309
989 Ga0495672_0010268
990 Ga0495676_0417519
991 Ga0496100_0032237
992 Ga0496100_0070973
993 Ga0496100_0097753
994 Ga0496101_0013228
995 Ga0496101_0052792
996 Ga0496101_0107247
997 Ga0496101_0510501
998 Ga0496102_0282185
999 Ga0496102_0342441
1000 Ga0496103_0055822
1001 Ga0496104_0023533
1002 Ga0496104_0051771
1003 Ga0496104_0059548
1004 Ga0496105_0077325
1005 Ga0496105_0096206
1006 Ga0496106_0118726
1007 Ga0496106_0123741
1008 Ga0496107_0025831
1009 Ga0496108_0006864
1010 Ga0496109_0057601
1011 Ga0496109_0117936
1012 Ga0496109_0134832
1013 Ga0496110_0063278
1014 Ga0496110_0170757
1015 Ga0496110_0395882
1016 Ga0496110_0441110
1017 Ga0496111_0009129
1018 Ga0496111_0009721
1019 Ga0496112_0238738
1020 Ga0496112_0373265
1021 Ga0496113_0118537
1022 Ga0496114_0008450
1023 Ga0496114_0028287
1024 Ga0496114_0080288
1025 Ga0496114_0358274
1026 Ga0496114_0522283
1027 Ga0496126_0002867
1028 Ga0501031_0008096
1029 Ga0501031_0072128
1030 Ga0501031_0152540
1031 Ga0501031_0262615
1032 Ga0501032_0032649
1033 Ga0501032_0168448
1034 Ga0501033_0005573
1035 Ga0501033_0016134
1036 Ga0501033_0144984
1037 Ga0501034_0760563
1038 Ga0501036_0022290
1039 Ga0501036_0038791
1040 Ga0501036_0088659
1041 Ga0501036_0235686
1042 Ga0501036_0330323
1043 Ga0501036_0397877
1044 Ga0501036_0469027
1045 Ga0501037_0019647
1046 Ga0501037_0070034
1047 Ga0501037_0084247
1048 Ga0501038_0021980
1049 Ga0501038_0083652
1050 Ga0501038_0616290
1051 Ga0501039_0008894
1052 Ga0501039_0092160
1053 Ga0501039_0169305
1054 Ga0501039_0249140
1055 Ga0501040_0002817
1056 Ga0501040_0013180
1057 Ga0501040_0024748
1058 Ga0501040_0140779
1059 Ga0501040_0229513
1060 Ga0501041_0004590
1061 Ga0501041_0012905
1062 Ga0501041_0030711
1063 Ga0501042_0004285
1064 Ga0501042_0015577
1065 Ga0501042_0034203
1066 Ga0501042_0034374
1067 Ga0501042_0161955
1068 Ga0501042_0174968
1069 Ga0501042_0180655
1070 Ga0501042_0203781
1071 Ga0501042_0294728
1072 Ga0501043_0009425
1073 Ga0501046_0019245
1074 Ga0501046_0028578
1075 Ga0501046_0166232
1076 Ga0501047_0180266
1077 Ga0501048_0009210
1078 Ga0501048_0026273
1079 Ga0501048_0049344
1080 Ga0501048_0070959
1081 Ga0501048_0088033
1082 Ga0501048_0146124
1083 Ga0501067_0004310
1084 Ga0501067_0134558
1085 Ga0501068_0007231
1086 Ga0501068_0009929
1087 Ga0501068_0011079
1088 Ga0501068_0011798
1089 Ga0501068_0021779
1090 Ga0501068_0025073
1091 Ga0501069_0001405
1092 Ga0501069_0014713
1093 Ga0501069_0017397
1094 Ga0501070_0004678
1095 Ga0501070_0421417
1096 Ga0501071_0008670
1097 Ga0501071_0027360
1098 Ga0501071_0066042
1099 Ga0501071_0262345
1100 Ga0501071_0302674
1101 Ga0501071_0321707
1102 Ga0501072_0006605
1103 Ga0501072_0018027
1104 Ga0501072_0019579
1105 Ga0501072_0050156
1106 Ga0501072_0068584
1107 Ga0501072_0080504
1108 Ga0501072_0214622
1109 Ga0501072_0215066
1110 Ga0501072_0261406
1111 Ga0501072_0268707
1112 Ga0501072_0296610
1113 Ga0501072_0536730
1114 Ga0501072_0681671
1115 Ga0501073_0029648
1116 Ga0501073_0066481
1117 Ga0501074_0002513
1118 Ga0501074_0027641
1119 Ga0501074_0088740
1120 Ga0501074_0112281
1121 Ga0501074_0189618
1122 Ga0501074_0312437
1123 Ga0501075_0011323
1124 Ga0501075_0013079
1125 Ga0501075_0017997
1126 Ga0501075_0025002
1127 Ga0501075_0053810
1128 Ga0501075_0084260
1129 Ga0501075_0622481
1130 Ga0501076_0018875
1131 Ga0501076_0019934
1132 Ga0501076_0037106
1133 Ga0501076_0046733
1134 Ga0501076_0095256
1135 Ga0501076_0219867
1136 Ga0501076_0227728
1137 Ga0501076_0264603
1138 Ga0501076_0377342
1139 Ga0501076_0570846
1140 Ga0501077_0018031
1141 Ga0501077_0020641
1142 Ga0501077_0088934
1143 Ga0501077_0121209
1144 Ga0501077_0121636
1145 Ga0501077_0236455
1146 Ga0501077_0610702
1147 Ga0501079_0023283
1148 Ga0501079_0023312
1149 Ga0501079_0118503
1150 Ga0501079_0218318
1151 Ga0501080_0039450
1152 Ga0501080_0128658
1153 Ga0501080_0403725
1154 Ga0501081_0019434
1155 Ga0501081_0145080
1156 Ga0501081_0168019
1157 Ga0501083_0002351
1158 Ga0501083_0528739
1159 Ga0501035_0037279
1160 Ga0501035_0458010
1161 Ga0501044_0220495
1162 Ga0501045_0055780
1163 Ga0501045_0062406
1164 Ga0501045_0133368
1165 Ga0501045_0192793
1166 Ga0501045_0268906
1167 nmdc:mga00v17_20690_c1
1168 nmdc:mga05p37_22579_c1
1169 nmdc:mga05p37_27819_c1
1170 nmdc:mga05p37_47154_c1
1171 nmdc:mga05p37_863741_c1
1172 nmdc:mga05p37_88735_c1
1173 nmdc:mga09592_139567_c1
1174 nmdc:mga09592_155977_c1
1175 nmdc:mga09592_195928_c1
1176 nmdc:mga09592_910131_c1
1177 nmdc:mga0qj67_121037_c1
1178 nmdc:mga06r32_128372_c1
1179 nmdc:mga06r32_420686_c1
1180 nmdc:mga08y16_277304_c1
1181 nmdc:mga08y16_282195_c1
1182 nmdc:mga08y16_362975_c1
1183 nmdc:mga08y16_367761_c1
1184 nmdc:mga08y16_569500_c1
1185 nmdc:mga08y16_80074_c1
1186 nmdc:mga08y16_9567_c1
1187 nmdc:mga0n895_797420_c1
1188 nmdc:mga08x19_153041_c1
1189 nmdc:mga0a205_6589_c1
1190 Ga0500618_003082
1191 Ga0501084_0004998
1192 Ga0501084_0034740
1193 Ga0501084_0047072
1194 Ga0501084_0068548
1195 Ga0501084_0144992
1196 Ga0501084_0169383
1197 Ga0501084_0291352
1198 Ga0501084_0315393
1199 Ga0501084_0331461
1200 Ga0501082_0007129
1201 Ga0501082_0015423
1202 Ga0501082_0018961
1203 Ga0501082_0067587
1204 Ga0501082_0172971
1205 Ga0501082_0176028
1206 Ga0501082_0181885
1207 Ga0501082_0190261
1208 Ga0501082_0222999
1209 Ga0501082_0299291
1210 Ga0530510_0004477
1211 Ga0530510_0018886
1212 Ga0530510_0019103
1213 Ga0530510_0027497
1214 Ga0530510_0036288
1215 Ga0530510_0128117
1216 Ga0530510_0132850
1217 Ga0530510_0346310
1218 2839991163
1219 2870786903
1220 2884635208
1221 3001892571
1222 3001893217

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01144

CoA_trans

Coenzyme A transferase

34

246

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dbn-assembly2.cif.gz_E crystal structure of atoda complex 0.9672 5 215
3cdk-assembly1.cif.gz_C crystal structure of the co-expressed succinyl-coa transferase a and b complex from bacillus subtilis 0.9656 3 218
3dlx-assembly1.cif.gz_B crystal structure of human 3-oxoacid coa transferase 1 0.9654 4 217
3dlx-assembly2.cif.gz_D crystal structure of human 3-oxoacid coa transferase 1 0.9653 5 217
1ooz-assembly1.cif.gz_A deletion mutant of succinyl-coa:3-ketoacid coa transferase from pig heart 0.9641 5 217
ID Description Score Start End Superfamily
5dbnA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9619 1 215 3.40.1080.10
af_A4I5L9_2_259_3.40.1080.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9605 2 216 3.40.1080.10
2nrbB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9544 5 216 3.40.1080.10
5dbnA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9489 1 215 3.40.1080.10
af_Q4E2P8_5_264_3.40.1080.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9465 2 216 3.40.1080.10
ID Description Score Start End GO Terms
AF-A0A536WWE7-F1-model_v4 CoA transferase subunit A 0.9893 150 218 GO:0008410
AF-A0A0F3QH76-F1-model_v4 Coenzyme A transferase family protein 0.9879 145 216 GO:0008410
AF-A0A154BTJ0-F1-model_v4 Succinyl-CoA--3-ketoacid-CoA transferase 0.9856 13 218 GO:0008410
AF-A0A7W0NVV8-F1-model_v4 3-oxoacid CoA-transferase subunit A 0.9848 100 216 GO:0008410
AF-A0A1Y1NB37-F1-model_v4 Succinyl-CoA--3-ketoacid-CoA transferase 0.9846 132 218 GO:0008260
GO:0046950

Map