F469040

General Info

Members Datasets Scaffolds Average Seq Length
611 311 1222 85

Family's Representative Sequence

Representative Sequence 3300005341|Ga0070691_10733461|Ga0070691_107334612
Length 90
Sequence VTLWWIGNAILVLVVLPVVVYLLHGVLTAARSIVPSVEQIGRAAAAGSKDLDAAALLLTTQEQVSQTIQHAANYGGSLAVILDDAEGARP

Samples

Sample ID Description Type Environment
1 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
95 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
145 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
146 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
147 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
148 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
151 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
152 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
153 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
154 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
155 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
158 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
170 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
171 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
172 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
173 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
174 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
175 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
176 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
177 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
178 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
179 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
183 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
189 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
190 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
191 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
194 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
195 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
196 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
197 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
198 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
199 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
200 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
201 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
202 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
203 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
204 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
205 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
206 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
207 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
208 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
209 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
210 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
211 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
212 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
213 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
214 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
215 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
216 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
217 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
218 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
219 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
220 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
221 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
222 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
223 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
224 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
225 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
226 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
227 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
228 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
229 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
230 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
231 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
232 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
233 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
234 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
235 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
236 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
237 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
238 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
239 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
240 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
241 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
242 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
243 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
244 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
245 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
246 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
247 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
248 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
249 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
250 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
251 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
254 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
255 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
256 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
257 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
258 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
259 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
260 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
261 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
262 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
263 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
275 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
276 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
277 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
278 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
279 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
280 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
281 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
282 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
283 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
284 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
285 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
286 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
287 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
289 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
290 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
291 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
292 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
293 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
294 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
295 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
296 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
297 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
298 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
299 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
300 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
301 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
302 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
303 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
304 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
305 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
306 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
307 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
308 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
309 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
310 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
311 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.64
Nodule 0
Rhizoplane 9.82
Rhizosphere 87.07
Stem 0
Stem Tuber 0
Unclassified 8.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070691_10733461 3300005341 Unclassified 596
2 Ga0070683_101238403 3300005329 Bacteria 717
3 Ga0070690_100689138 3300005330 Bacteria 784
4 Ga0068869_100009771 3300005334 Bacteria 6231
5 Ga0070680_100010600 3300005336 Bacteria 7112
6 Ga0070680_100139820 3300005336 Bacteria 2030
7 Ga0070682_100066179 3300005337 Bacteria 2298
8 Ga0068868_100542638 3300005338 Bacteria 1024
9 Ga0068868_101538429 3300005338 Bacteria 624
10 Ga0070660_100194616 3300005339 Bacteria 1643
11 Ga0070660_100485159 3300005339 Bacteria 1027
12 Ga0070691_10281124 3300005341 Unclassified 903
13 Ga0070687_100159570 3300005343 Bacteria 1332
14 Ga0070692_10840604 3300005345 Bacteria 630
15 Ga0070671_100650198 3300005355 Bacteria 913
16 Ga0070673_100654710 3300005364 Bacteria 962
17 Ga0070688_100455925 3300005365 Unclassified 957
18 Ga0070659_100035661 3300005366 Bacteria 3874
19 Ga0070659_100743935 3300005366 Bacteria 850
20 Ga0070667_101197345 3300005367 Bacteria 711
21 Ga0070709_10404451 3300005434 Bacteria 1020
22 Ga0070709_10847920 3300005434 Bacteria 720
23 Ga0070714_100892774 3300005435 Bacteria 863
24 Ga0070714_101155433 3300005435 Bacteria 755
25 Ga0070714_101901204 3300005435 Unclassified 581
26 Ga0070713_100018301 3300005436 Bacteria 5326
27 Ga0070713_100404369 3300005436 Bacteria 1275
28 Ga0070710_10009988 3300005437 Bacteria 4653
29 Ga0070710_10035290 3300005437 Bacteria 2726
30 Ga0070710_10071688 3300005437 Bacteria 1999
31 Ga0070710_10075356 3300005437 Bacteria 1955
32 Ga0070710_10381851 3300005437 Bacteria 940
33 Ga0070710_11331423 3300005437 Bacteria 535
34 Ga0070711_100011846 3300005439 Bacteria 5427
35 Ga0070711_100065804 3300005439 Bacteria 2537
36 Ga0070711_100134878 3300005439 Bacteria 1844
37 Ga0070711_100597118 3300005439 Bacteria 920
38 Ga0070711_100677306 3300005439 Unclassified 867
39 Ga0070711_101122014 3300005439 Bacteria 678
40 Ga0070700_100137944 3300005441 Bacteria 1654
41 Ga0070708_102141282 3300005445 Bacteria 517
42 Ga0070678_100425152 3300005456 Bacteria 1159
43 Ga0070662_100399347 3300005457 Bacteria 1134
44 Ga0070681_10013010 3300005458 Bacteria 8264
45 Ga0070681_10646744 3300005458 Bacteria 972
46 Ga0068867_101430486 3300005459 Unclassified 642
47 Ga0070706_101084755 3300005467 Unclassified 737
48 Ga0070706_101597058 3300005467 Bacteria 595
49 Ga0070698_100367365 3300005471 Bacteria 1371
50 Ga0070679_100058812 3300005530 Bacteria 3830
51 Ga0070684_100556281 3300005535 Bacteria 1065
52 Ga0070697_100872023 3300005536 Unclassified 798
53 Ga0070695_100899009 3300005545 Unclassified 715
54 Ga0070693_100031073 3300005547 Bacteria 2925
55 Ga0070693_100251941 3300005547 Bacteria 1171
56 Ga0070693_101669820 3300005547 Bacteria 502
57 Ga0068855_100064949 3300005563 Bacteria 4255
58 Ga0068854_100410305 3300005578 Bacteria 1123
59 Ga0068856_100014120 3300005614 Bacteria 7723
60 Ga0068856_100056348 3300005614 Bacteria 3878
61 Ga0068856_100923403 3300005614 Bacteria 892
62 Ga0070702_100092153 3300005615 Bacteria 1840
63 Ga0068852_100754123 3300005616 Bacteria 986
64 Ga0068859_100057132 3300005617 Bacteria 3931
65 Ga0068866_10297264 3300005718 Unclassified 1007
66 Ga0068861_102590958 3300005719 Unclassified 511
67 Ga0068870_10263733 3300005840 Bacteria 1073
68 Ga0068863_100571785 3300005841 Bacteria 1117
69 Ga0068858_100203985 3300005842 Bacteria 1870
70 Ga0068860_100313399 3300005843 Bacteria 1539
71 Ga0068860_102190679 3300005843 Bacteria 574
72 Ga0081538_10002084 3300005981 Bacteria 19923
73 Ga0081539_10238755 3300005985 Bacteria 815
74 Ga0070717_10041372 3300006028 Bacteria 3757
75 Ga0070717_10660473 3300006028 Bacteria 949
76 Ga0070717_10909803 3300006028 Bacteria 801
77 Ga0075365_10018463 3300006038 Bacteria 4289
78 Ga0075365_10223313 3300006038 Bacteria 1322
79 Ga0075364_10026365 3300006051 Bacteria 3708
80 Ga0075432_10404218 3300006058 Unclassified 590
81 Ga0070715_10347666 3300006163 Bacteria 809
82 Ga0070715_10883469 3300006163 Bacteria 549
83 Ga0070716_100203348 3300006173 Bacteria 1318
84 Ga0070712_100049056 3300006175 Bacteria 2930
85 Ga0070712_100051616 3300006175 Bacteria 2865
86 Ga0070712_100169789 3300006175 Bacteria 1691
87 Ga0070712_101644518 3300006175 Bacteria 562
88 Ga0075362_10161438 3300006177 Archaea 1079
89 Ga0097621_100323846 3300006237 Bacteria 1366
90 Ga0068871_100509267 3300006358 Bacteria 1086
91 Ga0075428_100017356 3300006844 Bacteria 7955
92 Ga0075428_100314825 3300006844 Unclassified 1682
93 Ga0075428_101266643 3300006844 Bacteria 776
94 Ga0075430_100015136 3300006846 Bacteria 6567
95 Ga0075430_100181451 3300006846 Bacteria 1751
96 Ga0075431_100007823 3300006847 Bacteria 10649
97 Ga0075431_100135537 3300006847 Bacteria 2538
98 Ga0075431_100550820 3300006847 Bacteria 1141
99 Ga0075431_100794150 3300006847 Bacteria 920
100 Ga0075433_10148510 3300006852 Unclassified 2085
101 Ga0075434_100001286 3300006871 Bacteria 20926
102 Ga0075434_100013897 3300006871 Bacteria 7680
103 Ga0075434_100043318 3300006871 Bacteria 4464
104 Ga0075434_100410844 3300006871 Unclassified 1375
105 Ga0075429_100020541 3300006880 Bacteria 5732
106 Ga0068865_100191600 3300006881 Bacteria 1582
107 Ga0075436_100012961 3300006914 Bacteria 5716
108 Ga0097620_100057135 3300006931 Bacteria 3931
109 Ga0075435_100024626 3300007076 Bacteria 4674
110 Ga0075435_100138007 3300007076 Unclassified 2044
111 Ga0075435_100154502 3300007076 Unclassified 1930
112 Ga0105251_10642301 3300009011 Bacteria 507
113 Ga0105240_10962402 3300009093 Bacteria 915
114 Ga0111539_10031803 3300009094 Bacteria 6412
115 Ga0111539_10039193 3300009094 Bacteria 5712
116 Ga0111539_10346524 3300009094 Bacteria 1729
117 Ga0105245_10002929 3300009098 Bacteria 15319
118 Ga0105245_10116655 3300009098 Bacteria 2489
119 Ga0105245_10139246 3300009098 Bacteria 2284
120 Ga0105247_11138470 3300009101 Bacteria 618
121 Ga0114129_10040022 3300009147 Bacteria 6611
122 Ga0114129_10116351 3300009147 Bacteria 3685
123 Ga0114129_10159690 3300009147 Bacteria 3081
124 Ga0114129_10173378 3300009147 Bacteria 2939
125 Ga0114129_10218498 3300009147 Bacteria 2573
126 Ga0105243_10202028 3300009148 Bacteria 1744
127 Ga0105241_10202420 3300009174 Bacteria 1659
128 Ga0105241_11076843 3300009174 Bacteria 756
129 Ga0105242_10208630 3300009176 Bacteria 1739
130 Ga0105242_11527404 3300009176 Viruses 699
131 Ga0105248_10242133 3300009177 Bacteria 2030
132 Ga0105248_12705071 3300009177 Bacteria 566
133 Ga0105237_10033925 3300009545 Bacteria 5170
134 Ga0105238_10222451 3300009551 Bacteria 1864
135 Ga0105249_10700970 3300009553 Bacteria 1072
136 Ga0105239_10016303 3300010375 Bacteria 8215
137 Ga0105239_10662084 3300010375 Bacteria 1193
138 Ga0105239_10676629 3300010375 Bacteria 1179
139 Ga0105239_13048747 3300010375 Unclassified 546
140 Ga0105246_10001080 3300011119 Bacteria 15765
141 Ga0105246_10919892 3300011119 Bacteria 786
142 Ga0157370_10281683 3300013104 Bacteria 1536
143 Ga0157369_10236152 3300013105 Bacteria 1910
144 Ga0157369_10540839 3300013105 Bacteria 1204
145 Ga0157374_10083994 3300013296 Bacteria 3026
146 Ga0157374_10451878 3300013296 Bacteria 1286
147 Ga0157374_10500642 3300013296 Bacteria 1219
148 Ga0157378_11404460 3300013297 Unclassified 741
149 Ga0163162_10941812 3300013306 Bacteria 975
150 Ga0163162_11014877 3300013306 Bacteria 938
151 Ga0163162_11783268 3300013306 Bacteria 703
152 Ga0157372_10197389 3300013307 Bacteria 2331
153 Ga0157372_10937820 3300013307 Bacteria 1003
154 Ga0157372_11955287 3300013307 Bacteria 674
155 Ga0157375_11094454 3300013308 Bacteria 933
156 Ga0163163_10548526 3300014325 Bacteria 1218
157 Ga0157377_10316806 3300014745 Unclassified 1035
158 Ga0157377_10865096 3300014745 Unclassified 672
159 Ga0157379_10050453 3300014968 Bacteria 3714
160 Ga0157376_10250557 3300014969 Bacteria 1654
161 Ga0157376_11428452 3300014969 Bacteria 724
162 Ga0157376_11593887 3300014969 Bacteria 687
163 Ga0213875_10000432 3300021388 Bacteria 36597
164 Ga0213875_10037660 3300021388 Bacteria 2279
165 Ga0213875_10105325 3300021388 Bacteria 1317
166 Ga0224712_10028632 3300022467 Bacteria 1993
167 Ga0224712_10092560 3300022467 Bacteria 1269
168 Ga0207692_10056193 3300025898 Bacteria 2018
169 Ga0207692_10311949 3300025898 Bacteria 960
170 Ga0207692_10334593 3300025898 Unclassified 930
171 Ga0207692_10876570 3300025898 Bacteria 590
172 Ga0207642_11037693 3300025899 Unclassified 529
173 Ga0207710_10581498 3300025900 Bacteria 584
174 Ga0207688_10284695 3300025901 Bacteria 1008
175 Ga0207680_10747129 3300025903 Bacteria 701
176 Ga0207685_10665943 3300025905 Bacteria 564
177 Ga0207699_10176778 3300025906 Bacteria 1432
178 Ga0207699_10507100 3300025906 Bacteria 871
179 Ga0207643_10145784 3300025908 Bacteria 1416
180 Ga0207684_10652323 3300025910 Bacteria 897
181 Ga0207654_11010678 3300025911 Bacteria 605
182 Ga0207654_11306998 3300025911 Bacteria 529
183 Ga0207707_10011787 3300025912 Bacteria 7605
184 Ga0207707_10511866 3300025912 Bacteria 1023
185 Ga0207671_10020275 3300025914 Bacteria 5064
186 Ga0207693_10008739 3300025915 Bacteria 8281
187 Ga0207693_10039201 3300025915 Bacteria 3731
188 Ga0207693_10173342 3300025915 Bacteria 1698
189 Ga0207693_10722937 3300025915 Bacteria 770
190 Ga0207693_11246019 3300025915 Bacteria 559
191 Ga0207693_11326998 3300025915 Bacteria 537
192 Ga0207663_10043957 3300025916 Bacteria 2739
193 Ga0207663_10069873 3300025916 Bacteria 2261
194 Ga0207663_10170641 3300025916 Bacteria 1545
195 Ga0207663_10623673 3300025916 Bacteria 849
196 Ga0207663_10759568 3300025916 Unclassified 770
197 Ga0207660_10047355 3300025917 Bacteria 3039
198 Ga0207662_10159629 3300025918 Bacteria 1439
199 Ga0207657_10323578 3300025919 Bacteria 1219
200 Ga0207652_10019961 3300025921 Bacteria 5518
201 Ga0207652_11071330 3300025921 Bacteria 706
202 Ga0207646_10602563 3300025922 Bacteria 986
203 Ga0207694_10169803 3300025924 Bacteria 1766
204 Ga0207687_10008371 3300025927 Bacteria 6767
205 Ga0207687_10012650 3300025927 Bacteria 5513
206 Ga0207687_10056136 3300025927 Bacteria 2761
207 Ga0207687_11561165 3300025927 Bacteria 567
208 Ga0207700_10086455 3300025928 Bacteria 2464
209 Ga0207700_10188456 3300025928 Bacteria 1732
210 Ga0207664_10344891 3300025929 Bacteria 1317
211 Ga0207664_10812383 3300025929 Bacteria 841
212 Ga0207664_11395394 3300025929 Bacteria 621
213 Ga0207644_11693535 3300025931 Bacteria 530
214 Ga0207690_10013023 3300025932 Bacteria 4989
215 Ga0207706_10511116 3300025933 Bacteria 1036
216 Ga0207686_10796853 3300025934 Bacteria 757
217 Ga0207686_10862607 3300025934 Bacteria 729
218 Ga0207709_10127712 3300025935 Bacteria 1727
219 Ga0207709_10362294 3300025935 Unclassified 1098
220 Ga0207709_11390428 3300025935 Bacteria 581
221 Ga0207670_10664579 3300025936 Bacteria 860
222 Ga0207704_10056080 3300025938 Bacteria 2412
223 Ga0207665_10403718 3300025939 Bacteria 1041
224 Ga0207711_10102999 3300025941 Bacteria 2527
225 Ga0207667_10010261 3300025949 Bacteria 10963
226 Ga0207651_11004244 3300025960 Bacteria 746
227 Ga0207712_10274820 3300025961 Bacteria 1372
228 Ga0207668_10675803 3300025972 Bacteria 906
229 Ga0207640_10153282 3300025981 Bacteria 1696
230 Ga0207640_10969607 3300025981 Bacteria 746
231 Ga0207640_11995410 3300025981 Bacteria 526
232 Ga0207677_10037743 3300026023 Bacteria 3160
233 Ga0207677_10172025 3300026023 Bacteria 1695
234 Ga0207677_11760285 3300026023 Unclassified 575
235 Ga0207703_10362404 3300026035 Bacteria 1337
236 Ga0207639_10649577 3300026041 Bacteria 976
237 Ga0207708_10303654 3300026075 Bacteria 1299
238 Ga0207702_10021410 3300026078 Bacteria 5353
239 Ga0207702_10156818 3300026078 Bacteria 2076
240 Ga0207702_10580469 3300026078 Bacteria 1099
241 Ga0207641_10254309 3300026088 Bacteria 1642
242 Ga0207675_100947715 3300026118 Bacteria 878
243 Ga0207683_10134128 3300026121 Bacteria 2228
244 Ga0207698_10019057 3300026142 Bacteria 4688
245 Ga0207698_10418834 3300026142 Bacteria 1285
246 Ga0207428_10012806 3300027907 Bacteria 7356
247 Ga0207428_10073032 3300027907 Bacteria 2692
248 Ga0207428_10227705 3300027907 Bacteria 1396
249 Ga0207428_10577542 3300027907 Bacteria 811
250 Ga0268264_10086504 3300028381 Bacteria 2693
251 Ga0268264_12304504 3300028381 Unclassified 545
252 Ga0265326_10055384 3300028558 Bacteria 1122
253 Ga0265319_1010290 3300028563 Bacteria 3911
254 Ga0265319_1126332 3300028563 Unclassified 796
255 Ga0265334_10074006 3300028573 Bacteria 1264
256 Ga0265318_10111284 3300028577 Bacteria 1007
257 Ga0265318_10167177 3300028577 Bacteria 806
258 Ga0265318_10207044 3300028577 Bacteria 717
259 Ga0265318_10313608 3300028577 Unclassified 572
260 Ga0265322_10021524 3300028654 Bacteria 1846
261 Ga0265322_10042524 3300028654 Bacteria 1293
262 Ga0265338_10007027 3300028800 Bacteria 14127
263 Ga0265338_10024394 3300028800 Bacteria 6179
264 Ga0265320_10023374 3300031240 Bacteria 3292
265 Ga0265325_10012542 3300031241 Bacteria 4844
266 Ga0265340_10026946 3300031247 Bacteria 2902
267 Ga0265340_10062888 3300031247 Bacteria 1772
268 Ga0265331_10123580 3300031250 Bacteria 1183
269 Ga0265327_10004386 3300031251 Bacteria 12523
270 Ga0265327_10014029 3300031251 Bacteria 5274
271 Ga0265316_10002547 3300031344 Bacteria 18835
272 Ga0307408_100425795 3300031548 Bacteria 1146
273 Ga0265313_10020063 3300031595 Bacteria 3699
274 Ga0265314_10009389 3300031711 Bacteria 8263
275 Ga0265314_10185495 3300031711 Archaea 1242
276 Ga0307413_10099895 3300031824 Bacteria 1914
277 Ga0307410_10005306 3300031852 Bacteria 6806
278 Ga0307406_10062879 3300031901 Bacteria 2402
279 Ga0307406_11182129 3300031901 Bacteria 663
280 Ga0307407_10028809 3300031903 Bacteria 2974
281 Ga0307412_10199534 3300031911 Bacteria 1518
282 Ga0307412_11237930 3300031911 Unclassified 670
283 Ga0307409_100043506 3300031995 Bacteria 3373
284 Ga0307416_100133780 3300032002 Bacteria 2238
285 Ga0307416_101250433 3300032002 Unclassified 848
286 Ga0307416_101764325 3300032002 Bacteria 723
287 Ga0307414_10050381 3300032004 Bacteria 2884
288 Ga0307414_11156887 3300032004 Bacteria 716
289 Ga0307411_10124273 3300032005 Bacteria 1873
290 Ga0307415_100167223 3300032126 Bacteria 1711
291 Ga0307415_100232898 3300032126 Bacteria 1484
292 Ga0373926_0019611 3300035083 Bacteria 2332
293 Ga0373934_0287199 3300035086 Bacteria 682
294 Ga0373934_0316527 3300035086 Bacteria 648
295 Ga0373944_0009259 3300035089 Bacteria 2669
296 Ga0373936_0398363 3300035113 Bacteria 632
297 Ga0373953_0535149 3300035117 Unclassified 520
298 Ga0373956_0100249 3300035119 Bacteria 1343
299 Ga0373956_0440835 3300035119 Bacteria 622
300 Ga0373957_0096890 3300035120 Bacteria 1178
301 Ga0373957_0213292 3300035120 Bacteria 807
302 Ga0373943_0004341 3300035170 Bacteria 6433
303 Ga0373946_0174555 3300035171 Bacteria 1016
304 Ga0373955_0035322 3300035172 Bacteria 2647
305 Ga0373955_0071396 3300035172 Bacteria 1942
306 Ga0373924_0006148 3300035410 Bacteria 4289
307 Ga0373924_0142566 3300035410 Bacteria 1046
308 Ga0373935_0012322 3300035692 Bacteria 5144
309 Ga0373927_0017377 3300035695 Bacteria 4734
310 Ga0373927_0255655 3300035695 Bacteria 1152
311 Ga0373933_0047520 3300035724 Bacteria 2553
312 Ga0373933_0135284 3300035724 Bacteria 1552
313 Ga0373933_0208046 3300035724 Bacteria 1253
314 Ga0373947_0011283 3300035725 Bacteria 5128
315 Ga0373937_0104501 3300036401 Bacteria 2631
316 Ga0373925_0002887 3300037068 Bacteria 13580
317 Ga0373925_0797618 3300037068 Bacteria 779
318 Ga0436364_0120862 3300037853 Bacteria 6879
319 Ga0436364_0364613 3300037853 Bacteria 9775
320 Ga0436364_0954780 3300037853 Bacteria 1588
321 Ga0436364_1031907 3300037853 Bacteria 102112
322 Ga0436365_0675347 3300039437 Bacteria 584
323 Ga0451853_2334201 3300041512 Unclassified 686
324 Ga0439463_034535 3300042016 Archaea 1279
325 Ga0450915_002729 3300042119 Archaea 948
326 Ga0439464_0300591 3300042439 Archaea 524
327 Ga0466967_0404445 3300045976 Bacteria 1329
328 Ga0466967_0761214 3300045976 Unclassified 961
329 Ga0495592_0121778 3300046454 Bacteria 1834
330 Ga0495592_0476622 3300046454 Bacteria 778
331 Ga0495629_0010815 3300046459 Bacteria 6638
332 Ga0495629_0079938 3300046459 Bacteria 2283
333 Ga0495641_0002945 3300046461 Bacteria 13114
334 Ga0495641_0062142 3300046461 Bacteria 1685
335 Ga0495641_0093782 3300046461 Bacteria 1341
336 Ga0495641_0119402 3300046461 Bacteria 1176
337 Ga0495651_0012517 3300046462 Bacteria 6544
338 Ga0495651_0035001 3300046462 Bacteria 3913
339 Ga0495651_0132649 3300046462 Bacteria 1817
340 Ga0495651_0341687 3300046462 Bacteria 992
341 Ga0495653_0003629 3300046463 Bacteria 12445
342 Ga0495653_0031135 3300046463 Bacteria 4242
343 Ga0495653_0925521 3300046463 Bacteria 518
344 Ga0495580_0013042 3300046472 Bacteria 6362
345 Ga0495582_0005354 3300046473 Bacteria 7163
346 Ga0495582_0257544 3300046473 Bacteria 1001
347 Ga0495605_0422017 3300046474 Bacteria 552
348 Ga0495639_0005141 3300046475 Bacteria 5620
349 Ga0495639_0351329 3300046475 Bacteria 740
350 Ga0495662_0000412 3300046476 Bacteria 19214
351 Ga0495662_0298617 3300046476 Bacteria 792
352 Ga0495662_0547128 3300046476 Bacteria 567
353 Ga0495664_0145848 3300046477 Bacteria 1435
354 Ga0495594_0038982 3300046499 Bacteria 2596
355 Ga0495594_0053159 3300046499 Bacteria 2231
356 Ga0495608_0002056 3300046511 Bacteria 14477
357 Ga0495608_0003901 3300046511 Bacteria 10723
358 Ga0495608_0124337 3300046511 Bacteria 1653
359 Ga0495608_0127498 3300046511 Bacteria 1630
360 Ga0495608_0486209 3300046511 Bacteria 748
361 Ga0495618_0002753 3300046514 Bacteria 11179
362 Ga0495618_0686709 3300046514 Bacteria 603
363 Ga0495618_0822804 3300046514 Unclassified 540
364 Ga0495620_0404968 3300046515 Unclassified 516
365 Ga0495628_0094963 3300046516 Bacteria 2304
366 Ga0495628_0211394 3300046516 Bacteria 1459
367 Ga0495628_0462680 3300046516 Bacteria 920
368 Ga0495630_0048581 3300046517 Bacteria 3175
369 Ga0495630_0129123 3300046517 Bacteria 1919
370 Ga0495631_0320805 3300046518 Unclassified 659
371 Ga0495644_0174878 3300046523 Bacteria 825
372 Ga0495644_0188051 3300046523 Bacteria 795
373 Ga0495666_0008214 3300046526 Bacteria 5232
374 Ga0495666_0544219 3300046526 Bacteria 518
375 Ga0495652_0027017 3300046529 Bacteria 5062
376 Ga0495652_0036180 3300046529 Bacteria 4294
377 Ga0495652_0297196 3300046529 Unclassified 1175
378 Ga0495652_0378322 3300046529 Bacteria 1008
379 Ga0495652_0457665 3300046529 Bacteria 892
380 Ga0495652_0860056 3300046529 Bacteria 600
381 Ga0495665_0000527 3300046531 Bacteria 19367
382 Ga0495640_0024525 3300046533 Bacteria 4386
383 Ga0495640_0103902 3300046533 Bacteria 1862
384 Ga0495586_0137834 3300046535 Bacteria 1368
385 Ga0495586_0505958 3300046535 Bacteria 697
386 Ga0495587_0056548 3300046536 Bacteria 2308
387 Ga0495587_0095708 3300046536 Bacteria 1713
388 Ga0495587_0106209 3300046536 Bacteria 1615
389 Ga0495645_0116200 3300046543 Bacteria 1889
390 Ga0495645_0219645 3300046543 Bacteria 1279
391 Ga0495645_0373896 3300046543 Bacteria 913
392 Ga0495645_0472394 3300046543 Bacteria 788
393 Ga0495622_0046916 3300046557 Bacteria 2008
394 Ga0495633_0242481 3300046558 Unclassified 823
395 Ga0495667_0001822 3300046559 Bacteria 14145
396 Ga0495667_0016501 3300046559 Bacteria 4989
397 Ga0495667_0058236 3300046559 Bacteria 2538
398 Ga0495656_0029704 3300046615 Bacteria 2203
399 Ga0495656_0405145 3300046615 Bacteria 714
400 Ga0495634_0014802 3300046642 Bacteria 5611
401 Ga0495634_0034182 3300046642 Bacteria 3489
402 Ga0495635_0004994 3300046663 Bacteria 9232
403 Ga0495635_0117115 3300046663 Bacteria 1818
404 Ga0495635_0159139 3300046663 Bacteria 1537
405 Ga0495635_0695636 3300046663 Bacteria 659
406 Ga0495661_0221963 3300046665 Bacteria 979
407 Ga0495588_0002905 3300046674 Bacteria 7391
408 Ga0495657_0005225 3300046675 Bacteria 10278
409 Ga0495657_0049586 3300046675 Bacteria 2827
410 Ga0495657_0142039 3300046675 Bacteria 1496
411 Ga0495599_0624197 3300046678 Bacteria 626
412 Ga0495599_0638703 3300046678 Bacteria 617
413 Ga0495623_0033371 3300046679 Bacteria 3303
414 Ga0495623_0039850 3300046679 Bacteria 3001
415 Ga0495623_0720811 3300046679 Bacteria 509
416 Ga0495646_0120366 3300046680 Bacteria 1486
417 Ga0495646_0219866 3300046680 Unclassified 1028
418 Ga0495647_0006973 3300046681 Bacteria 3765
419 Ga0495658_0003617 3300046683 Bacteria 7652
420 Ga0495658_0380127 3300046683 Bacteria 899
421 Ga0495613_0004498 3300046689 Bacteria 10445
422 Ga0495613_0047192 3300046689 Bacteria 3182
423 Ga0495613_0777892 3300046689 Unclassified 626
424 Ga0495624_0019615 3300046690 Bacteria 4509
425 Ga0495624_0263638 3300046690 Unclassified 1041
426 Ga0495624_0466861 3300046690 Bacteria 756
427 Ga0495624_0638207 3300046690 Bacteria 634
428 Ga0495671_0597162 3300046692 Unclassified 525
429 Ga0495589_0191116 3300046794 Unclassified 969
430 Ga0495600_0013003 3300046809 Bacteria 5219
431 Ga0495600_0063359 3300046809 Bacteria 2416
432 Ga0495600_0114154 3300046809 Bacteria 1759
433 Ga0495600_0120071 3300046809 Bacteria 1710
434 Ga0495581_0005975 3300047315 Bacteria 7051
435 Ga0495604_0032767 3300047317 Bacteria 4116
436 Ga0495604_0116515 3300047317 Bacteria 1939
437 Ga0495604_0133098 3300047317 Bacteria 1785
438 Ga0495674_0017807 3300047319 Bacteria 6615
439 Ga0495674_0023349 3300047319 Bacteria 5701
440 Ga0495674_0049365 3300047319 Bacteria 3719
441 Ga0495674_0616949 3300047319 Bacteria 858
442 Ga0495676_0029722 3300047321 Bacteria 4650
443 Ga0495676_0032063 3300047321 Bacteria 4440
444 Ga0495680_0000502 3300047322 Bacteria 44236
445 Ga0495680_0022598 3300047322 Bacteria 5239
446 Ga0495680_0112468 3300047322 Bacteria 2017
447 Ga0495680_0115841 3300047322 Bacteria 1982
448 Ga0495680_0333860 3300047322 Bacteria 1059
449 Ga0495680_0670154 3300047322 Unclassified 688
450 Ga0495675_0046142 3300047444 Bacteria 2774
451 Ga0495675_0152584 3300047444 Bacteria 1426
452 Ga0495675_0838234 3300047444 Bacteria 507
453 Ga0495675_0847469 3300047444 Bacteria 503
454 Ga0495684_0001792 3300047471 Bacteria 17242
455 Ga0495684_0008861 3300047471 Bacteria 7774
456 Ga0495684_0141158 3300047471 Bacteria 1806
457 Ga0495593_0002686 3300047673 Bacteria 10697
458 Ga0495602_0104615 3300048088 Bacteria 2315
459 Ga0495602_0175458 3300048088 Bacteria 1659
460 Ga0495602_0603260 3300048088 Unclassified 755
461 Ga0495602_0650100 3300048088 Bacteria 720
462 Ga0495614_0001922 3300048089 Bacteria 9108
463 Ga0496100_0012446 3300048903 Bacteria 4878
464 Ga0496100_0127573 3300048903 Bacteria 1787
465 Ga0496100_0136518 3300048903 Bacteria 1733
466 Ga0496100_0154012 3300048903 Bacteria 1642
467 Ga0496100_0491684 3300048903 Bacteria 944
468 Ga0496101_0054050 3300048904 Bacteria 2899
469 Ga0496101_0152174 3300048904 Bacteria 1770
470 Ga0496101_0254574 3300048904 Bacteria 1368
471 Ga0496102_0002361 3300048905 Bacteria 16111
472 Ga0496102_0100968 3300048905 Bacteria 2680
473 Ga0496102_0115980 3300048905 Bacteria 2499
474 Ga0496102_0184049 3300048905 Bacteria 1968
475 Ga0496103_0000900 3300048906 Bacteria 21361
476 Ga0496103_0283345 3300048906 Bacteria 1066
477 Ga0496104_0031074 3300048907 Bacteria 4965
478 Ga0496104_1357003 3300048907 Bacteria 614
479 Ga0496104_1529015 3300048907 Bacteria 570
480 Ga0496105_0059721 3300048908 Bacteria 3146
481 Ga0496105_0069163 3300048908 Bacteria 2918
482 Ga0496106_0008276 3300048909 Bacteria 7695
483 Ga0496106_0017839 3300048909 Bacteria 5248
484 Ga0496106_0038532 3300048909 Bacteria 3577
485 Ga0496106_0070203 3300048909 Bacteria 2675
486 Ga0496106_0089690 3300048909 Bacteria 2371
487 Ga0496106_0779553 3300048909 Bacteria 759
488 Ga0496107_0004266 3300048910 Bacteria 9671
489 Ga0496107_0007275 3300048910 Bacteria 7627
490 Ga0496107_0034785 3300048910 Bacteria 3610
491 Ga0496107_0170159 3300048910 Bacteria 1616
492 Ga0496107_0516516 3300048910 Bacteria 886
493 Ga0496108_0001177 3300048911 Bacteria 20397
494 Ga0496108_0007539 3300048911 Bacteria 8819
495 Ga0496108_0124437 3300048911 Bacteria 2213
496 Ga0496109_0000999 3300048912 Bacteria 23362
497 Ga0496109_0005691 3300048912 Bacteria 10433
498 Ga0496109_0035884 3300048912 Bacteria 4476
499 Ga0496109_0229387 3300048912 Bacteria 1747
500 Ga0496109_2016113 3300048912 Bacteria 509
501 Ga0496110_0001024 3300048913 Bacteria 19667
502 Ga0496110_0063190 3300048913 Bacteria 3271
503 Ga0496110_1339755 3300048913 Bacteria 625
504 Ga0496111_0000822 3300048914 Bacteria 16685
505 Ga0496111_0037932 3300048914 Bacteria 3450
506 Ga0496111_0324751 3300048914 Bacteria 1140
507 Ga0496112_0025280 3300048915 Bacteria 5701
508 Ga0496112_0033720 3300048915 Bacteria 4978
509 Ga0496112_0138148 3300048915 Bacteria 2407
510 Ga0496112_0635639 3300048915 Bacteria 998
511 Ga0496114_0027105 3300048917 Bacteria 4693
512 Ga0496114_0111698 3300048917 Bacteria 2342
513 Ga0496114_0168000 3300048917 Bacteria 1911
514 Ga0496114_0283937 3300048917 Bacteria 1460
515 Ga0496114_0286692 3300048917 Bacteria 1452
516 Ga0496115_0007206 3300048918 Bacteria 8170
517 Ga0496115_0011617 3300048918 Bacteria 6607
518 Ga0496115_0067927 3300048918 Bacteria 2884
519 Ga0496115_0127320 3300048918 Bacteria 2098
520 Ga0496115_0182353 3300048918 Bacteria 1735
521 Ga0496115_0199457 3300048918 Bacteria 1653
522 Ga0496115_0274415 3300048918 Bacteria 1385
523 Ga0501031_0011988 3300049568 Bacteria 5652
524 Ga0501032_0073270 3300049569 Bacteria 2282
525 Ga0501036_0006529 3300049572 Bacteria 9476
526 Ga0501038_0183071 3300049574 Bacteria 1689
527 Ga0501039_0003294 3300049575 Bacteria 12074
528 Ga0501040_0023875 3300049576 Bacteria 4100
529 Ga0501041_0003067 3300049577 Bacteria 9590
530 Ga0501041_0983878 3300049577 Bacteria 543
531 Ga0501041_1028302 3300049577 Bacteria 530
532 Ga0501042_0100029 3300049578 Bacteria 2084
533 Ga0501042_0616227 3300049578 Bacteria 789
534 Ga0501043_0049019 3300049579 Bacteria 3320
535 Ga0501046_0002853 3300049580 Bacteria 16077
536 Ga0501048_0007347 3300049582 Bacteria 8352
537 Ga0501048_0684965 3300049582 Bacteria 736
538 Ga0501048_1079278 3300049582 Bacteria 578
539 Ga0501068_0236845 3300049584 Bacteria 1161
540 Ga0501068_0335409 3300049584 Bacteria 971
541 Ga0501069_0404229 3300049585 Bacteria 808
542 Ga0501071_0000451 3300049587 Bacteria 20669
543 Ga0501072_0002520 3300049588 Bacteria 13718
544 Ga0501073_0301401 3300049589 Bacteria 1106
545 Ga0501074_0001257 3300049590 Bacteria 16755
546 Ga0501075_0000229 3300049591 Bacteria 29992
547 Ga0501076_0018893 3300049592 Bacteria 5259
548 Ga0501076_0206173 3300049592 Bacteria 1606
549 Ga0501077_0017228 3300049593 Bacteria 4557
550 Ga0501079_0006140 3300049741 Bacteria 9007
551 Ga0501079_0245892 3300049741 Bacteria 1398
552 Ga0501080_0028448 3300049742 Bacteria 5199
553 Ga0501081_0000210 3300049743 Bacteria 28824
554 Ga0501081_0487653 3300049743 Bacteria 918
555 Ga0501083_0266731 3300049744 Bacteria 1114
556 Ga0501035_0134961 3300049822 Bacteria 2149
557 Ga0501045_0001657 3300049824 Bacteria 14972
558 nmdc:mga03683_75135_c2 3300050489 Archaea 1108
559 nmdc:mga00v17_16497_c1 3300050491 Bacteria 3509
560 nmdc:mga0yw44_54079_c1 3300050492 Unclassified 2439
561 nmdc:mga0yw44_556906_c1 3300050492 Bacteria 778
562 nmdc:mga05p37_148157_c1 3300050507 Bacteria 2873
563 nmdc:mga05p37_17465_c1 3300050507 Bacteria 1616
564 nmdc:mga05p37_243170_c1 3300050507 Bacteria 2162
565 nmdc:mga05p37_684482_c1 3300050507 Bacteria 1142
566 nmdc:mga09592_27604_c1 3300050508 Bacteria 4712
567 nmdc:mga0qj67_119131_c1 3300050509 Unclassified 2135
568 nmdc:mga0qj67_1250886_c1 3300050509 Bacteria 576
569 nmdc:mga0qj67_148112_c1 3300050509 Bacteria 1903
570 nmdc:mga06r32_118156_c1 3300050510 Bacteria 2614
571 nmdc:mga06r32_120573_c1 3300050510 Bacteria 2587
572 nmdc:mga06r32_230941_c1 3300050510 Bacteria 1838
573 nmdc:mga06r32_459718_c1 3300050510 Bacteria 1252
574 nmdc:mga08y16_116151_c1 3300050511 Bacteria 2786
575 nmdc:mga08y16_16588_c1 3300050511 Bacteria 7747
576 nmdc:mga08y16_5385_c1 3300050511 Bacteria 13383
577 nmdc:mga0n895_64166_c1 3300050512 Bacteria 3633
578 nmdc:mga0n895_684148_c1 3300050512 Bacteria 1023
579 nmdc:mga0rr50_984154_c1 3300050513 Unclassified 719
580 nmdc:mga08x19_39586_c1 3300050514 Bacteria 2997
581 nmdc:mga08x19_573692_c1 3300050514 Unclassified 799
582 nmdc:mga0a205_240538_c1 3300050515 Bacteria 1691
583 nmdc:mga0sz30_179817_c1 3300050516 Unclassified 938
584 Ga0495601_0028092 3300053077 Bacteria 3482
585 Ga0495601_0051417 3300053077 Bacteria 2600
586 Ga0495601_0070338 3300053077 Bacteria 2234
587 Ga0495601_0086450 3300053077 Bacteria 2015
588 Ga0495601_0161011 3300053077 Bacteria 1467
589 Ga0495601_0575490 3300053077 Unclassified 724
590 Ga0495601_1078400 3300053077 Bacteria 503
591 Ga0495612_0013474 3300053078 Bacteria 3294
592 Ga0495612_0201810 3300053078 Bacteria 877
593 Ga0495612_0409188 3300053078 Bacteria 617
594 Ga0495595_0006299 3300053084 Bacteria 4832
595 Ga0495595_0023975 3300053084 Bacteria 2691
596 Ga0495595_0106512 3300053084 Bacteria 1357
597 Ga0495595_0369178 3300053084 Bacteria 725
598 Ga0495619_0026036 3300053085 Bacteria 3761
599 Ga0495619_0031706 3300053085 Bacteria 3425
600 Ga0495619_0038729 3300053085 Bacteria 3110
601 Ga0500566_0420458 3300053094 Bacteria 593
602 Ga0501084_0000526 3300054114 Bacteria 29269
603 Ga0501084_0697121 3300054114 Bacteria 856
604 Ga0590075_081187 3300059424 Bacteria 840
605 Ga0590077_147860 3300059426 Unclassified 562
606 Ga0501082_0002959 3300060353 Bacteria 14829
607 Ga0501082_0324790 3300060353 Bacteria 1341
608 Ga0501082_0481599 3300060353 Bacteria 1085
609 Ga0530510_0001078 3300061734 Bacteria 18095
610 Ga0530510_0150895 3300061734 Bacteria 1716
611 Ga0530510_1298614 3300061734 Bacteria 558
612 Ga0070691_10733461
613 Ga0070683_101238403
614 Ga0070690_100689138
615 Ga0068869_100009771
616 Ga0070680_100010600
617 Ga0070680_100139820
618 Ga0070682_100066179
619 Ga0068868_100542638
620 Ga0068868_101538429
621 Ga0070660_100194616
622 Ga0070660_100485159
623 Ga0070691_10281124
624 Ga0070687_100159570
625 Ga0070692_10840604
626 Ga0070671_100650198
627 Ga0070673_100654710
628 Ga0070688_100455925
629 Ga0070659_100035661
630 Ga0070659_100743935
631 Ga0070667_101197345
632 Ga0070709_10404451
633 Ga0070709_10847920
634 Ga0070714_100892774
635 Ga0070714_101155433
636 Ga0070714_101901204
637 Ga0070713_100018301
638 Ga0070713_100404369
639 Ga0070710_10009988
640 Ga0070710_10035290
641 Ga0070710_10071688
642 Ga0070710_10075356
643 Ga0070710_10381851
644 Ga0070710_11331423
645 Ga0070711_100011846
646 Ga0070711_100065804
647 Ga0070711_100134878
648 Ga0070711_100597118
649 Ga0070711_100677306
650 Ga0070711_101122014
651 Ga0070700_100137944
652 Ga0070708_102141282
653 Ga0070678_100425152
654 Ga0070662_100399347
655 Ga0070681_10013010
656 Ga0070681_10646744
657 Ga0068867_101430486
658 Ga0070706_101084755
659 Ga0070706_101597058
660 Ga0070698_100367365
661 Ga0070679_100058812
662 Ga0070684_100556281
663 Ga0070697_100872023
664 Ga0070695_100899009
665 Ga0070693_100031073
666 Ga0070693_100251941
667 Ga0070693_101669820
668 Ga0068855_100064949
669 Ga0068854_100410305
670 Ga0068856_100014120
671 Ga0068856_100056348
672 Ga0068856_100923403
673 Ga0070702_100092153
674 Ga0068852_100754123
675 Ga0068859_100057132
676 Ga0068866_10297264
677 Ga0068861_102590958
678 Ga0068870_10263733
679 Ga0068863_100571785
680 Ga0068858_100203985
681 Ga0068860_100313399
682 Ga0068860_102190679
683 Ga0081538_10002084
684 Ga0081539_10238755
685 Ga0070717_10041372
686 Ga0070717_10660473
687 Ga0070717_10909803
688 Ga0075365_10018463
689 Ga0075365_10223313
690 Ga0075364_10026365
691 Ga0075432_10404218
692 Ga0070715_10347666
693 Ga0070715_10883469
694 Ga0070716_100203348
695 Ga0070712_100049056
696 Ga0070712_100051616
697 Ga0070712_100169789
698 Ga0070712_101644518
699 Ga0075362_10161438
700 Ga0097621_100323846
701 Ga0068871_100509267
702 Ga0075428_100017356
703 Ga0075428_100314825
704 Ga0075428_101266643
705 Ga0075430_100015136
706 Ga0075430_100181451
707 Ga0075431_100007823
708 Ga0075431_100135537
709 Ga0075431_100550820
710 Ga0075431_100794150
711 Ga0075433_10148510
712 Ga0075434_100001286
713 Ga0075434_100013897
714 Ga0075434_100043318
715 Ga0075434_100410844
716 Ga0075429_100020541
717 Ga0068865_100191600
718 Ga0075436_100012961
719 Ga0097620_100057135
720 Ga0075435_100024626
721 Ga0075435_100138007
722 Ga0075435_100154502
723 Ga0105251_10642301
724 Ga0105240_10962402
725 Ga0111539_10031803
726 Ga0111539_10039193
727 Ga0111539_10346524
728 Ga0105245_10002929
729 Ga0105245_10116655
730 Ga0105245_10139246
731 Ga0105247_11138470
732 Ga0114129_10040022
733 Ga0114129_10116351
734 Ga0114129_10159690
735 Ga0114129_10173378
736 Ga0114129_10218498
737 Ga0105243_10202028
738 Ga0105241_10202420
739 Ga0105241_11076843
740 Ga0105242_10208630
741 Ga0105242_11527404
742 Ga0105248_10242133
743 Ga0105248_12705071
744 Ga0105237_10033925
745 Ga0105238_10222451
746 Ga0105249_10700970
747 Ga0105239_10016303
748 Ga0105239_10662084
749 Ga0105239_10676629
750 Ga0105239_13048747
751 Ga0105246_10001080
752 Ga0105246_10919892
753 Ga0157370_10281683
754 Ga0157369_10236152
755 Ga0157369_10540839
756 Ga0157374_10083994
757 Ga0157374_10451878
758 Ga0157374_10500642
759 Ga0157378_11404460
760 Ga0163162_10941812
761 Ga0163162_11014877
762 Ga0163162_11783268
763 Ga0157372_10197389
764 Ga0157372_10937820
765 Ga0157372_11955287
766 Ga0157375_11094454
767 Ga0163163_10548526
768 Ga0157377_10316806
769 Ga0157377_10865096
770 Ga0157379_10050453
771 Ga0157376_10250557
772 Ga0157376_11428452
773 Ga0157376_11593887
774 Ga0213875_10000432
775 Ga0213875_10037660
776 Ga0213875_10105325
777 Ga0224712_10028632
778 Ga0224712_10092560
779 Ga0207692_10056193
780 Ga0207692_10311949
781 Ga0207692_10334593
782 Ga0207692_10876570
783 Ga0207642_11037693
784 Ga0207710_10581498
785 Ga0207688_10284695
786 Ga0207680_10747129
787 Ga0207685_10665943
788 Ga0207699_10176778
789 Ga0207699_10507100
790 Ga0207643_10145784
791 Ga0207684_10652323
792 Ga0207654_11010678
793 Ga0207654_11306998
794 Ga0207707_10011787
795 Ga0207707_10511866
796 Ga0207671_10020275
797 Ga0207693_10008739
798 Ga0207693_10039201
799 Ga0207693_10173342
800 Ga0207693_10722937
801 Ga0207693_11246019
802 Ga0207693_11326998
803 Ga0207663_10043957
804 Ga0207663_10069873
805 Ga0207663_10170641
806 Ga0207663_10623673
807 Ga0207663_10759568
808 Ga0207660_10047355
809 Ga0207662_10159629
810 Ga0207657_10323578
811 Ga0207652_10019961
812 Ga0207652_11071330
813 Ga0207646_10602563
814 Ga0207694_10169803
815 Ga0207687_10008371
816 Ga0207687_10012650
817 Ga0207687_10056136
818 Ga0207687_11561165
819 Ga0207700_10086455
820 Ga0207700_10188456
821 Ga0207664_10344891
822 Ga0207664_10812383
823 Ga0207664_11395394
824 Ga0207644_11693535
825 Ga0207690_10013023
826 Ga0207706_10511116
827 Ga0207686_10796853
828 Ga0207686_10862607
829 Ga0207709_10127712
830 Ga0207709_10362294
831 Ga0207709_11390428
832 Ga0207670_10664579
833 Ga0207704_10056080
834 Ga0207665_10403718
835 Ga0207711_10102999
836 Ga0207667_10010261
837 Ga0207651_11004244
838 Ga0207712_10274820
839 Ga0207668_10675803
840 Ga0207640_10153282
841 Ga0207640_10969607
842 Ga0207640_11995410
843 Ga0207677_10037743
844 Ga0207677_10172025
845 Ga0207677_11760285
846 Ga0207703_10362404
847 Ga0207639_10649577
848 Ga0207708_10303654
849 Ga0207702_10021410
850 Ga0207702_10156818
851 Ga0207702_10580469
852 Ga0207641_10254309
853 Ga0207675_100947715
854 Ga0207683_10134128
855 Ga0207698_10019057
856 Ga0207698_10418834
857 Ga0207428_10012806
858 Ga0207428_10073032
859 Ga0207428_10227705
860 Ga0207428_10577542
861 Ga0268264_10086504
862 Ga0268264_12304504
863 Ga0265326_10055384
864 Ga0265319_1010290
865 Ga0265319_1126332
866 Ga0265334_10074006
867 Ga0265318_10111284
868 Ga0265318_10167177
869 Ga0265318_10207044
870 Ga0265318_10313608
871 Ga0265322_10021524
872 Ga0265322_10042524
873 Ga0265338_10007027
874 Ga0265338_10024394
875 Ga0265320_10023374
876 Ga0265325_10012542
877 Ga0265340_10026946
878 Ga0265340_10062888
879 Ga0265331_10123580
880 Ga0265327_10004386
881 Ga0265327_10014029
882 Ga0265316_10002547
883 Ga0307408_100425795
884 Ga0265313_10020063
885 Ga0265314_10009389
886 Ga0265314_10185495
887 Ga0307413_10099895
888 Ga0307410_10005306
889 Ga0307406_10062879
890 Ga0307406_11182129
891 Ga0307407_10028809
892 Ga0307412_10199534
893 Ga0307412_11237930
894 Ga0307409_100043506
895 Ga0307416_100133780
896 Ga0307416_101250433
897 Ga0307416_101764325
898 Ga0307414_10050381
899 Ga0307414_11156887
900 Ga0307411_10124273
901 Ga0307415_100167223
902 Ga0307415_100232898
903 Ga0373926_0019611
904 Ga0373934_0287199
905 Ga0373934_0316527
906 Ga0373944_0009259
907 Ga0373936_0398363
908 Ga0373953_0535149
909 Ga0373956_0100249
910 Ga0373956_0440835
911 Ga0373957_0096890
912 Ga0373957_0213292
913 Ga0373943_0004341
914 Ga0373946_0174555
915 Ga0373955_0035322
916 Ga0373955_0071396
917 Ga0373924_0006148
918 Ga0373924_0142566
919 Ga0373935_0012322
920 Ga0373927_0017377
921 Ga0373927_0255655
922 Ga0373933_0047520
923 Ga0373933_0135284
924 Ga0373933_0208046
925 Ga0373947_0011283
926 Ga0373937_0104501
927 Ga0373925_0002887
928 Ga0373925_0797618
929 Ga0436364_0120862
930 Ga0436364_0364613
931 Ga0436364_0954780
932 Ga0436364_1031907
933 Ga0436365_0675347
934 Ga0451853_2334201
935 Ga0439463_034535
936 Ga0450915_002729
937 Ga0439464_0300591
938 Ga0466967_0404445
939 Ga0466967_0761214
940 Ga0495592_0121778
941 Ga0495592_0476622
942 Ga0495629_0010815
943 Ga0495629_0079938
944 Ga0495641_0002945
945 Ga0495641_0062142
946 Ga0495641_0093782
947 Ga0495641_0119402
948 Ga0495651_0012517
949 Ga0495651_0035001
950 Ga0495651_0132649
951 Ga0495651_0341687
952 Ga0495653_0003629
953 Ga0495653_0031135
954 Ga0495653_0925521
955 Ga0495580_0013042
956 Ga0495582_0005354
957 Ga0495582_0257544
958 Ga0495605_0422017
959 Ga0495639_0005141
960 Ga0495639_0351329
961 Ga0495662_0000412
962 Ga0495662_0298617
963 Ga0495662_0547128
964 Ga0495664_0145848
965 Ga0495594_0038982
966 Ga0495594_0053159
967 Ga0495608_0002056
968 Ga0495608_0003901
969 Ga0495608_0124337
970 Ga0495608_0127498
971 Ga0495608_0486209
972 Ga0495618_0002753
973 Ga0495618_0686709
974 Ga0495618_0822804
975 Ga0495620_0404968
976 Ga0495628_0094963
977 Ga0495628_0211394
978 Ga0495628_0462680
979 Ga0495630_0048581
980 Ga0495630_0129123
981 Ga0495631_0320805
982 Ga0495644_0174878
983 Ga0495644_0188051
984 Ga0495666_0008214
985 Ga0495666_0544219
986 Ga0495652_0027017
987 Ga0495652_0036180
988 Ga0495652_0297196
989 Ga0495652_0378322
990 Ga0495652_0457665
991 Ga0495652_0860056
992 Ga0495665_0000527
993 Ga0495640_0024525
994 Ga0495640_0103902
995 Ga0495586_0137834
996 Ga0495586_0505958
997 Ga0495587_0056548
998 Ga0495587_0095708
999 Ga0495587_0106209
1000 Ga0495645_0116200
1001 Ga0495645_0219645
1002 Ga0495645_0373896
1003 Ga0495645_0472394
1004 Ga0495622_0046916
1005 Ga0495633_0242481
1006 Ga0495667_0001822
1007 Ga0495667_0016501
1008 Ga0495667_0058236
1009 Ga0495656_0029704
1010 Ga0495656_0405145
1011 Ga0495634_0014802
1012 Ga0495634_0034182
1013 Ga0495635_0004994
1014 Ga0495635_0117115
1015 Ga0495635_0159139
1016 Ga0495635_0695636
1017 Ga0495661_0221963
1018 Ga0495588_0002905
1019 Ga0495657_0005225
1020 Ga0495657_0049586
1021 Ga0495657_0142039
1022 Ga0495599_0624197
1023 Ga0495599_0638703
1024 Ga0495623_0033371
1025 Ga0495623_0039850
1026 Ga0495623_0720811
1027 Ga0495646_0120366
1028 Ga0495646_0219866
1029 Ga0495647_0006973
1030 Ga0495658_0003617
1031 Ga0495658_0380127
1032 Ga0495613_0004498
1033 Ga0495613_0047192
1034 Ga0495613_0777892
1035 Ga0495624_0019615
1036 Ga0495624_0263638
1037 Ga0495624_0466861
1038 Ga0495624_0638207
1039 Ga0495671_0597162
1040 Ga0495589_0191116
1041 Ga0495600_0013003
1042 Ga0495600_0063359
1043 Ga0495600_0114154
1044 Ga0495600_0120071
1045 Ga0495581_0005975
1046 Ga0495604_0032767
1047 Ga0495604_0116515
1048 Ga0495604_0133098
1049 Ga0495674_0017807
1050 Ga0495674_0023349
1051 Ga0495674_0049365
1052 Ga0495674_0616949
1053 Ga0495676_0029722
1054 Ga0495676_0032063
1055 Ga0495680_0000502
1056 Ga0495680_0022598
1057 Ga0495680_0112468
1058 Ga0495680_0115841
1059 Ga0495680_0333860
1060 Ga0495680_0670154
1061 Ga0495675_0046142
1062 Ga0495675_0152584
1063 Ga0495675_0838234
1064 Ga0495675_0847469
1065 Ga0495684_0001792
1066 Ga0495684_0008861
1067 Ga0495684_0141158
1068 Ga0495593_0002686
1069 Ga0495602_0104615
1070 Ga0495602_0175458
1071 Ga0495602_0603260
1072 Ga0495602_0650100
1073 Ga0495614_0001922
1074 Ga0496100_0012446
1075 Ga0496100_0127573
1076 Ga0496100_0136518
1077 Ga0496100_0154012
1078 Ga0496100_0491684
1079 Ga0496101_0054050
1080 Ga0496101_0152174
1081 Ga0496101_0254574
1082 Ga0496102_0002361
1083 Ga0496102_0100968
1084 Ga0496102_0115980
1085 Ga0496102_0184049
1086 Ga0496103_0000900
1087 Ga0496103_0283345
1088 Ga0496104_0031074
1089 Ga0496104_1357003
1090 Ga0496104_1529015
1091 Ga0496105_0059721
1092 Ga0496105_0069163
1093 Ga0496106_0008276
1094 Ga0496106_0017839
1095 Ga0496106_0038532
1096 Ga0496106_0070203
1097 Ga0496106_0089690
1098 Ga0496106_0779553
1099 Ga0496107_0004266
1100 Ga0496107_0007275
1101 Ga0496107_0034785
1102 Ga0496107_0170159
1103 Ga0496107_0516516
1104 Ga0496108_0001177
1105 Ga0496108_0007539
1106 Ga0496108_0124437
1107 Ga0496109_0000999
1108 Ga0496109_0005691
1109 Ga0496109_0035884
1110 Ga0496109_0229387
1111 Ga0496109_2016113
1112 Ga0496110_0001024
1113 Ga0496110_0063190
1114 Ga0496110_1339755
1115 Ga0496111_0000822
1116 Ga0496111_0037932
1117 Ga0496111_0324751
1118 Ga0496112_0025280
1119 Ga0496112_0033720
1120 Ga0496112_0138148
1121 Ga0496112_0635639
1122 Ga0496114_0027105
1123 Ga0496114_0111698
1124 Ga0496114_0168000
1125 Ga0496114_0283937
1126 Ga0496114_0286692
1127 Ga0496115_0007206
1128 Ga0496115_0011617
1129 Ga0496115_0067927
1130 Ga0496115_0127320
1131 Ga0496115_0182353
1132 Ga0496115_0199457
1133 Ga0496115_0274415
1134 Ga0501031_0011988
1135 Ga0501032_0073270
1136 Ga0501036_0006529
1137 Ga0501038_0183071
1138 Ga0501039_0003294
1139 Ga0501040_0023875
1140 Ga0501041_0003067
1141 Ga0501041_0983878
1142 Ga0501041_1028302
1143 Ga0501042_0100029
1144 Ga0501042_0616227
1145 Ga0501043_0049019
1146 Ga0501046_0002853
1147 Ga0501048_0007347
1148 Ga0501048_0684965
1149 Ga0501048_1079278
1150 Ga0501068_0236845
1151 Ga0501068_0335409
1152 Ga0501069_0404229
1153 Ga0501071_0000451
1154 Ga0501072_0002520
1155 Ga0501073_0301401
1156 Ga0501074_0001257
1157 Ga0501075_0000229
1158 Ga0501076_0018893
1159 Ga0501076_0206173
1160 Ga0501077_0017228
1161 Ga0501079_0006140
1162 Ga0501079_0245892
1163 Ga0501080_0028448
1164 Ga0501081_0000210
1165 Ga0501081_0487653
1166 Ga0501083_0266731
1167 Ga0501035_0134961
1168 Ga0501045_0001657
1169 nmdc:mga03683_75135_c2
1170 nmdc:mga00v17_16497_c1
1171 nmdc:mga0yw44_54079_c1
1172 nmdc:mga0yw44_556906_c1
1173 nmdc:mga05p37_148157_c1
1174 nmdc:mga05p37_17465_c1
1175 nmdc:mga05p37_243170_c1
1176 nmdc:mga05p37_684482_c1
1177 nmdc:mga09592_27604_c1
1178 nmdc:mga0qj67_119131_c1
1179 nmdc:mga0qj67_1250886_c1
1180 nmdc:mga0qj67_148112_c1
1181 nmdc:mga06r32_118156_c1
1182 nmdc:mga06r32_120573_c1
1183 nmdc:mga06r32_230941_c1
1184 nmdc:mga06r32_459718_c1
1185 nmdc:mga08y16_116151_c1
1186 nmdc:mga08y16_16588_c1
1187 nmdc:mga08y16_5385_c1
1188 nmdc:mga0n895_64166_c1
1189 nmdc:mga0n895_684148_c1
1190 nmdc:mga0rr50_984154_c1
1191 nmdc:mga08x19_39586_c1
1192 nmdc:mga08x19_573692_c1
1193 nmdc:mga0a205_240538_c1
1194 nmdc:mga0sz30_179817_c1
1195 Ga0495601_0028092
1196 Ga0495601_0051417
1197 Ga0495601_0070338
1198 Ga0495601_0086450
1199 Ga0495601_0161011
1200 Ga0495601_0575490
1201 Ga0495601_1078400
1202 Ga0495612_0013474
1203 Ga0495612_0201810
1204 Ga0495612_0409188
1205 Ga0495595_0006299
1206 Ga0495595_0023975
1207 Ga0495595_0106512
1208 Ga0495595_0369178
1209 Ga0495619_0026036
1210 Ga0495619_0031706
1211 Ga0495619_0038729
1212 Ga0500566_0420458
1213 Ga0501084_0000526
1214 Ga0501084_0697121
1215 Ga0590075_081187
1216 Ga0590077_147860
1217 Ga0501082_0002959
1218 Ga0501082_0324790
1219 Ga0501082_0481599
1220 Ga0530510_0001078
1221 Ga0530510_0150895
1222 Ga0530510_1298614

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map