F468867

General Info

Members Datasets Scaffolds Average Seq Length
609 253 609 235

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10018161|Ga0157373_100181614
Length 252
Sequence MKWRRLLMSDNGKMTDHTVRAFSDQLESLSSGVAQMGGLAEAQLADAVEAIARRDTKLAEGAIAGDPRIDELQQQIEAQALKLLALRQPMAVDLRDTLAAIKIAGELERIGDLAKHIAKRALVLNREPPIRLTQSLARMGRASLNQLKLVLDSYSDRDAKGAEAVWRNDGEIDEIYNSLFRELLTYMMEDPRTISLCTHLLFVAKNIERTGDHATNIAETVYHMVTGGHLAMERPKSDVTSSTTVPFERKTP

Samples

Sample ID Description Type Environment
1 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
86 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
141 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
142 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
143 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
144 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
145 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
146 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
147 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
148 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
149 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
150 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
151 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
152 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
153 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
154 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
157 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
158 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
159 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
161 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
162 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
163 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
164 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
174 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
175 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
178 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
179 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
180 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
181 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
182 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
183 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
184 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
185 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
186 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
187 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
188 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
189 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
190 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
191 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
192 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
193 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
194 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
195 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
196 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
197 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
198 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
199 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
200 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
201 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
202 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
203 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
204 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
208 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
209 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
223 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
224 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
225 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
226 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
227 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
228 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
229 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
230 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
231 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
232 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
236 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
237 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
238 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
239 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
240 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
241 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
242 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
243 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
244 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
245 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
246 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
247 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
248 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
249 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
250 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
251 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
252 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
253 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.12
Nodule 0
Rhizoplane 0.49
Rhizosphere 94.75
Stem 0
Stem Tuber 0
Unclassified 1.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000008 3300003214 Bacteria 478603
2 JGI25153J46596_10000526 3300003215 Bacteria 24044
3 JGI25405J52794_10011653 3300003911 Bacteria 1684
4 Ga0070658_10003357 3300005327 Bacteria 13201
5 Ga0070658_10023105 3300005327 Bacteria 4992
6 Ga0070658_10047580 3300005327 Bacteria 3471
7 Ga0070658_10376920 3300005327 Bacteria 1217
8 Ga0070676_10016304 3300005328 Bacteria 4107
9 Ga0070683_100086527 3300005329 Bacteria 2938
10 Ga0070690_100039280 3300005330 Bacteria 2990
11 Ga0070670_100187887 3300005331 Bacteria 1794
12 Ga0068869_100032532 3300005334 Bacteria 3676
13 Ga0068869_100311217 3300005334 Bacteria 1275
14 Ga0070666_10007718 3300005335 Bacteria 6645
15 Ga0070680_100000153 3300005336 Bacteria 42721
16 Ga0070680_100038695 3300005336 Bacteria 3858
17 Ga0070680_100059936 3300005336 Bacteria 3115
18 Ga0068868_100003905 3300005338 Bacteria 10409
19 Ga0068868_100187398 3300005338 Bacteria 1719
20 Ga0070660_100015109 3300005339 Bacteria 5571
21 Ga0070660_100040647 3300005339 Bacteria 3540
22 Ga0070660_100278366 3300005339 Bacteria 1369
23 Ga0070691_10000365 3300005341 Bacteria 16356
24 Ga0070691_10001050 3300005341 Bacteria 11389
25 Ga0070661_100000581 3300005344 Bacteria 27755
26 Ga0070671_100337798 3300005355 Bacteria 1284
27 Ga0070674_100580051 3300005356 Bacteria 945
28 Ga0070674_100596131 3300005356 Bacteria 933
29 Ga0070673_100022308 3300005364 Bacteria 4605
30 Ga0070673_100196315 3300005364 Bacteria 1736
31 Ga0070673_100354383 3300005364 Bacteria 1303
32 Ga0070673_100488752 3300005364 Bacteria 1112
33 Ga0070659_100033010 3300005366 Bacteria 4020
34 Ga0070659_100039022 3300005366 Bacteria 3706
35 Ga0070667_100122038 3300005367 Bacteria 2267
36 Ga0070703_10032496 3300005406 Bacteria 1585
37 Ga0070709_10000576 3300005434 Bacteria 21459
38 Ga0070714_100008568 3300005435 Bacteria 7997
39 Ga0070714_100433211 3300005435 Bacteria 1247
40 Ga0070713_100000001 3300005436 Bacteria 257984
41 Ga0070710_10081182 3300005437 Bacteria 1893
42 Ga0070711_100007422 3300005439 Bacteria 6668
43 Ga0070678_100039462 3300005456 Bacteria 3332
44 Ga0070678_100258042 3300005456 Bacteria 1464
45 Ga0070681_10000001 3300005458 Bacteria 946857
46 Ga0070681_10033253 3300005458 Bacteria 5177
47 Ga0070681_10048118 3300005458 Bacteria 4262
48 Ga0070681_10130175 3300005458 Bacteria 2448
49 Ga0068867_100015700 3300005459 Bacteria 5373
50 Ga0070679_100003754 3300005530 Bacteria 13931
51 Ga0070679_100017919 3300005530 Bacteria 6860
52 Ga0070679_100133996 3300005530 Bacteria 2458
53 Ga0070679_100236344 3300005530 Bacteria 1786
54 Ga0070679_100565418 3300005530 Bacteria 1081
55 Ga0070684_100032787 3300005535 Bacteria 4431
56 Ga0070684_100767359 3300005535 Bacteria 901
57 Ga0070697_100292611 3300005536 Bacteria 1399
58 Ga0068853_100007961 3300005539 Bacteria 8499
59 Ga0068853_100032144 3300005539 Bacteria 4444
60 Ga0068853_100053326 3300005539 Bacteria 3483
61 Ga0068853_100081697 3300005539 Bacteria 2830
62 Ga0068853_100380115 3300005539 Bacteria 1319
63 Ga0068853_100793596 3300005539 Bacteria 906
64 Ga0068853_100936979 3300005539 Bacteria 832
65 Ga0070672_100438380 3300005543 Bacteria 1124
66 Ga0070695_100030159 3300005545 Bacteria 3375
67 Ga0070693_100383003 3300005547 Bacteria 971
68 Ga0070665_100000707 3300005548 Bacteria 44382
69 Ga0070665_100026664 3300005548 Bacteria 5818
70 Ga0070665_100068703 3300005548 Bacteria 3552
71 Ga0070665_100101549 3300005548 Bacteria 2880
72 Ga0070665_100554434 3300005548 Bacteria 1161
73 Ga0068855_100000010 3300005563 Bacteria 246022
74 Ga0068855_100007439 3300005563 Bacteria 13261
75 Ga0068855_100013486 3300005563 Bacteria 9853
76 Ga0068855_100015637 3300005563 Bacteria 9131
77 Ga0068855_100157734 3300005563 Bacteria 2577
78 Ga0068855_100636834 3300005563 Bacteria 1146
79 Ga0070664_100100542 3300005564 Bacteria 2514
80 Ga0068857_100001101 3300005577 Bacteria 20972
81 Ga0068857_100104906 3300005577 Bacteria 2538
82 Ga0068857_100227480 3300005577 Bacteria 1705
83 Ga0068854_100214755 3300005578 Bacteria 1519
84 Ga0068854_100377226 3300005578 Bacteria 1168
85 Ga0068856_100001359 3300005614 Bacteria 25713
86 Ga0068856_100069296 3300005614 Bacteria 3488
87 Ga0068856_100075133 3300005614 Bacteria 3347
88 Ga0068856_100212695 3300005614 Bacteria 1949
89 Ga0068852_100023771 3300005616 Bacteria 4940
90 Ga0068852_100078350 3300005616 Bacteria 2923
91 Ga0068852_100079973 3300005616 Bacteria 2897
92 Ga0068852_100101203 3300005616 Bacteria 2601
93 Ga0068852_100281401 3300005616 Bacteria 1604
94 Ga0068852_100661453 3300005616 Bacteria 1053
95 Ga0068864_100044310 3300005618 Bacteria 3812
96 Ga0068864_100426047 3300005618 Bacteria 1265
97 Ga0068864_100622518 3300005618 Bacteria 1049
98 Ga0068866_10275708 3300005718 Bacteria 1040
99 Ga0068870_10170950 3300005840 Bacteria 1297
100 Ga0068863_100353909 3300005841 Bacteria 1430
101 Ga0068858_100028706 3300005842 Bacteria 5167
102 Ga0068858_100163958 3300005842 Bacteria 2094
103 Ga0068858_100267476 3300005842 Bacteria 1626
104 Ga0068858_100268644 3300005842 Bacteria 1622
105 Ga0068860_100642679 3300005843 Bacteria 1068
106 Ga0068860_100750166 3300005843 Bacteria 988
107 Ga0081455_10008827 3300005937 Bacteria 10430
108 Ga0070712_100000305 3300006175 Bacteria 27733
109 Ga0070712_100000761 3300006175 Bacteria 18982
110 Ga0070712_100222305 3300006175 Bacteria 1496
111 Ga0097621_100042490 3300006237 Bacteria 3661
112 Ga0097621_100058271 3300006237 Bacteria 3160
113 Ga0097621_100360542 3300006237 Bacteria 1295
114 Ga0097621_100440315 3300006237 Bacteria 1172
115 Ga0068871_100000610 3300006358 Bacteria 24579
116 Ga0068871_100005205 3300006358 Bacteria 9093
117 Ga0068865_100055190 3300006881 Bacteria 2763
118 Ga0068865_100617965 3300006881 Bacteria 918
119 Ga0075436_100002535 3300006914 Bacteria 12571
120 Ga0075436_100016286 3300006914 Bacteria 5089
121 Ga0075435_100092338 3300007076 Bacteria 2500
122 Ga0105240_10000189 3300009093 Bacteria 125396
123 Ga0105240_10012428 3300009093 Bacteria 11755
124 Ga0105240_10063306 3300009093 Bacteria 4602
125 Ga0105240_10071219 3300009093 Bacteria 4300
126 Ga0105240_10409290 3300009093 Bacteria 1526
127 Ga0105240_10800039 3300009093 Bacteria 1021
128 Ga0111539_10089127 3300009094 Bacteria 3625
129 Ga0105245_10050351 3300009098 Bacteria 3733
130 Ga0105245_10062378 3300009098 Bacteria 3363
131 Ga0105245_10088798 3300009098 Bacteria 2840
132 Ga0105247_10054265 3300009101 Bacteria 2473
133 Ga0105247_10122551 3300009101 Bacteria 1686
134 Ga0105243_10029864 3300009148 Bacteria 4195
135 Ga0105241_10016786 3300009174 Bacteria 5373
136 Ga0105241_10132259 3300009174 Bacteria 2022
137 Ga0105241_10159418 3300009174 Bacteria 1853
138 Ga0105241_10506223 3300009174 Bacteria 1078
139 Ga0105242_10020187 3300009176 Bacteria 5223
140 Ga0105242_10449446 3300009176 Bacteria 1214
141 Ga0105242_10630078 3300009176 Bacteria 1040
142 Ga0105248_10000001 3300009177 Bacteria 1881304
143 Ga0105248_10111993 3300009177 Bacteria 3078
144 Ga0105237_10005417 3300009545 Bacteria 14407
145 Ga0105237_10142097 3300009545 Bacteria 2395
146 Ga0105237_10170529 3300009545 Bacteria 2176
147 Ga0105237_10347556 3300009545 Bacteria 1487
148 Ga0105237_10430824 3300009545 Bacteria 1324
149 Ga0105237_10557003 3300009545 Bacteria 1153
150 Ga0105238_10002544 3300009551 Bacteria 18220
151 Ga0105238_10166738 3300009551 Bacteria 2178
152 Ga0105238_10221105 3300009551 Bacteria 1870
153 Ga0105238_10250587 3300009551 Bacteria 1749
154 Ga0105238_10335217 3300009551 Bacteria 1500
155 Ga0105249_10031918 3300009553 Bacteria 4764
156 Ga0105239_10002523 3300010375 Bacteria 23257
157 Ga0105239_10010826 3300010375 Bacteria 10192
158 Ga0105239_10022665 3300010375 Bacteria 6922
159 Ga0105239_10023500 3300010375 Bacteria 6789
160 Ga0105239_10049571 3300010375 Bacteria 4605
161 Ga0105239_10197489 3300010375 Bacteria 2253
162 Ga0105239_10765366 3300010375 Bacteria 1105
163 Ga0105246_10054633 3300011119 Bacteria 2753
164 Ga0157373_10002728 3300013100 Bacteria 13377
165 Ga0157373_10018161 3300013100 Bacteria 5122
166 Ga0157370_10009312 3300013104 Bacteria 10517
167 Ga0157370_10031407 3300013104 Bacteria 5195
168 Ga0157370_10430432 3300013104 Bacteria 1213
169 Ga0157369_10004483 3300013105 Bacteria 16454
170 Ga0157369_10012365 3300013105 Bacteria 9691
171 Ga0157369_10089183 3300013105 Bacteria 3293
172 Ga0157369_10205309 3300013105 Bacteria 2067
173 Ga0157374_10032828 3300013296 Bacteria 4731
174 Ga0157378_10035998 3300013297 Bacteria 4380
175 Ga0157378_10096883 3300013297 Bacteria 2688
176 Ga0157378_10238400 3300013297 Bacteria 1737
177 Ga0163162_10032156 3300013306 Bacteria 5209
178 Ga0163162_10048238 3300013306 Bacteria 4267
179 Ga0163162_10277121 3300013306 Bacteria 1809
180 Ga0163162_10492473 3300013306 Bacteria 1357
181 Ga0157372_10051294 3300013307 Bacteria 4591
182 Ga0157372_10102044 3300013307 Bacteria 3276
183 Ga0157372_10206467 3300013307 Bacteria 2276
184 Ga0157375_10232289 3300013308 Bacteria 2003
185 Ga0163163_10000016 3300014325 Bacteria 213966
186 Ga0163163_10420057 3300014325 Bacteria 1396
187 Ga0157380_10034879 3300014326 Bacteria 3883
188 Ga0157379_10001102 3300014968 Bacteria 22075
189 Ga0157379_10002471 3300014968 Bacteria 15470
190 Ga0157379_10006337 3300014968 Bacteria 10190
191 Ga0157379_10022423 3300014968 Bacteria 5593
192 Ga0157379_10082810 3300014968 Bacteria 2875
193 Ga0157379_10679298 3300014968 Bacteria 965
194 Ga0157376_10436812 3300014969 Bacteria 1274
195 Ga0163161_10016459 3300017792 Bacteria 5162
196 Ga0213874_10001290 3300021377 Bacteria 5185
197 Ga0213876_10001710 3300021384 Bacteria 13330
198 Ga0213876_10005787 3300021384 Bacteria 6770
199 Ga0209233_1000006 3300025261 Bacteria 1473685
200 Ga0209758_1000032 3300025297 Bacteria 481623
201 Ga0209758_1039154 3300025297 Bacteria 1807
202 Ga0207656_10092426 3300025321 Bacteria 1375
203 Ga0207692_10508796 3300025898 Bacteria 765
204 Ga0207710_10019836 3300025900 Bacteria 2870
205 Ga0207710_10119546 3300025900 Bacteria 1257
206 Ga0207680_10085889 3300025903 Bacteria 1988
207 Ga0207699_10000445 3300025906 Bacteria 21151
208 Ga0207645_10020714 3300025907 Bacteria 4300
209 Ga0207643_10039094 3300025908 Bacteria 2669
210 Ga0207705_10000098 3300025909 Bacteria 104428
211 Ga0207705_10005859 3300025909 Bacteria 9147
212 Ga0207705_10295110 3300025909 Bacteria 1242
213 Ga0207705_10299470 3300025909 Bacteria 1233
214 Ga0207654_10138258 3300025911 Bacteria 1550
215 Ga0207654_10193967 3300025911 Bacteria 1333
216 Ga0207654_10265647 3300025911 Bacteria 1156
217 Ga0207654_10367104 3300025911 Bacteria 994
218 Ga0207707_10000001 3300025912 Bacteria 1212482
219 Ga0207707_10000678 3300025912 Bacteria 33769
220 Ga0207707_10025131 3300025912 Bacteria 5210
221 Ga0207707_10038895 3300025912 Bacteria 4158
222 Ga0207707_10153658 3300025912 Bacteria 2012
223 Ga0207695_10000003 3300025913 Bacteria 1368691
224 Ga0207695_10015190 3300025913 Bacteria 9079
225 Ga0207695_10025117 3300025913 Bacteria 6682
226 Ga0207695_10052311 3300025913 Bacteria 4280
227 Ga0207695_10079110 3300025913 Bacteria 3334
228 Ga0207695_10225113 3300025913 Bacteria 1782
229 Ga0207695_10326816 3300025913 Bacteria 1423
230 Ga0207695_10344639 3300025913 Bacteria 1377
231 Ga0207671_10027027 3300025914 Bacteria 4293
232 Ga0207671_10037081 3300025914 Bacteria 3615
233 Ga0207671_10178340 3300025914 Bacteria 1652
234 Ga0207671_10215001 3300025914 Bacteria 1505
235 Ga0207671_10246647 3300025914 Bacteria 1404
236 Ga0207671_10384619 3300025914 Bacteria 1115
237 Ga0207693_10000116 3300025915 Bacteria 71473
238 Ga0207693_10000456 3300025915 Bacteria 37291
239 Ga0207663_10023982 3300025916 Bacteria 3510
240 Ga0207660_10000128 3300025917 Bacteria 44898
241 Ga0207660_10008285 3300025917 Bacteria 6717
242 Ga0207657_10002111 3300025919 Bacteria 21491
243 Ga0207657_10006117 3300025919 Bacteria 12511
244 Ga0207649_10000036 3300025920 Bacteria 132545
245 Ga0207649_10092864 3300025920 Bacteria 1979
246 Ga0207652_10002777 3300025921 Bacteria 14717
247 Ga0207652_10003066 3300025921 Bacteria 13948
248 Ga0207652_10005101 3300025921 Bacteria 10658
249 Ga0207652_10125116 3300025921 Bacteria 2289
250 Ga0207652_10195052 3300025921 Bacteria 1822
251 Ga0207652_10729650 3300025921 Bacteria 883
252 Ga0207694_10000011 3300025924 Bacteria 417640
253 Ga0207694_10017308 3300025924 Bacteria 5449
254 Ga0207694_10050982 3300025924 Bacteria 3207
255 Ga0207694_10102159 3300025924 Bacteria 2273
256 Ga0207694_10174977 3300025924 Bacteria 1739
257 Ga0207694_10226945 3300025924 Bacteria 1524
258 Ga0207650_10044345 3300025925 Bacteria 3268
259 Ga0207650_10145352 3300025925 Bacteria 1867
260 Ga0207650_10166704 3300025925 Bacteria 1748
261 Ga0207659_10661996 3300025926 Bacteria 893
262 Ga0207687_10035132 3300025927 Bacteria 3408
263 Ga0207687_10071185 3300025927 Bacteria 2484
264 Ga0207700_10000015 3300025928 Bacteria 224772
265 Ga0207664_10317180 3300025929 Bacteria 1375
266 Ga0207664_10512466 3300025929 Bacteria 1075
267 Ga0207664_10890924 3300025929 Bacteria 799
268 Ga0207644_10187891 3300025931 Bacteria 1623
269 Ga0207686_10041472 3300025934 Bacteria 2807
270 Ga0207686_10107284 3300025934 Bacteria 1876
271 Ga0207709_10012253 3300025935 Bacteria 4726
272 Ga0207669_10095672 3300025937 Bacteria 1947
273 Ga0207704_10083728 3300025938 Bacteria 2071
274 Ga0207704_10112825 3300025938 Bacteria 1842
275 Ga0207691_10437015 3300025940 Bacteria 1114
276 Ga0207711_10000002 3300025941 Bacteria 1228676
277 Ga0207711_10002955 3300025941 Bacteria 14865
278 Ga0207711_10586549 3300025941 Bacteria 1040
279 Ga0207689_10058700 3300025942 Bacteria 3165
280 Ga0207689_10318436 3300025942 Bacteria 1291
281 Ga0207661_10176429 3300025944 Bacteria 1863
282 Ga0207667_10000093 3300025949 Bacteria 145814
283 Ga0207667_10005157 3300025949 Bacteria 15956
284 Ga0207667_10009417 3300025949 Bacteria 11505
285 Ga0207667_10547806 3300025949 Bacteria 1170
286 Ga0207667_10872230 3300025949 Bacteria 893
287 Ga0207651_10024088 3300025960 Bacteria 3758
288 Ga0207651_10025715 3300025960 Bacteria 3664
289 Ga0207712_10204332 3300025961 Bacteria 1569
290 Ga0207640_10298470 3300025981 Bacteria 1273
291 Ga0207658_10119771 3300025986 Bacteria 2096
292 Ga0207677_10001820 3300026023 Bacteria 11272
293 Ga0207677_10215007 3300026023 Bacteria 1538
294 Ga0207703_10034272 3300026035 Bacteria 4029
295 Ga0207703_10056025 3300026035 Bacteria 3209
296 Ga0207703_10134458 3300026035 Bacteria 2139
297 Ga0207703_10175283 3300026035 Bacteria 1889
298 Ga0207639_10015953 3300026041 Bacteria 5305
299 Ga0207639_10022994 3300026041 Bacteria 4496
300 Ga0207639_10158078 3300026041 Bacteria 1907
301 Ga0207639_10345635 3300026041 Bacteria 1327
302 Ga0207639_10752289 3300026041 Bacteria 906
303 Ga0207678_10127546 3300026067 Bacteria 2170
304 Ga0207702_10000011 3300026078 Bacteria 284514
305 Ga0207702_10027197 3300026078 Bacteria 4750
306 Ga0207702_10056719 3300026078 Bacteria 3326
307 Ga0207702_10264537 3300026078 Bacteria 1620
308 Ga0207641_10005742 3300026088 Bacteria 10542
309 Ga0207648_10034577 3300026089 Bacteria 4454
310 Ga0207676_10355372 3300026095 Bacteria 1356
311 Ga0207674_10000002 3300026116 Bacteria 279738
312 Ga0207674_10038487 3300026116 Bacteria 4962
313 Ga0207674_10149132 3300026116 Bacteria 2296
314 Ga0207674_10180895 3300026116 Bacteria 2060
315 Ga0207674_10322894 3300026116 Bacteria 1493
316 Ga0207675_100443100 3300026118 Bacteria 1286
317 Ga0207683_10047500 3300026121 Bacteria 3760
318 Ga0207683_10058388 3300026121 Bacteria 3388
319 Ga0207683_10061374 3300026121 Bacteria 3308
320 Ga0207683_10326151 3300026121 Bacteria 1407
321 Ga0207698_10012802 3300026142 Bacteria 5507
322 Ga0207698_10220004 3300026142 Bacteria 1715
323 Ga0207698_10254058 3300026142 Bacteria 1610
324 Ga0207698_10358391 3300026142 Bacteria 1380
325 Ga0207698_10412552 3300026142 Bacteria 1294
326 Ga0207428_10083240 3300027907 Bacteria 2496
327 Ga0268266_10001112 3300028379 Bacteria 33635
328 Ga0268266_10019570 3300028379 Bacteria 5767
329 Ga0268266_10024113 3300028379 Bacteria 5175
330 Ga0268266_10031961 3300028379 Bacteria 4472
331 Ga0268266_10242408 3300028379 Bacteria 1664
332 Ga0268266_10268729 3300028379 Bacteria 1582
333 Ga0268266_10418758 3300028379 Bacteria 1269
334 Ga0268264_10445598 3300028381 Bacteria 1253
335 Ga0268264_10462357 3300028381 Bacteria 1231
336 Ga0268264_10550739 3300028381 Bacteria 1131
337 Ga0265337_1004926 3300028556 Bacteria 5433
338 Ga0265334_10000808 3300028573 Bacteria 15652
339 Ga0265334_10016634 3300028573 Bacteria 3040
340 Ga0265334_10084099 3300028573 Bacteria 1169
341 Ga0265318_10000018 3300028577 Bacteria 173038
342 Ga0265318_10000703 3300028577 Bacteria 22479
343 Ga0265338_10000006 3300028800 Bacteria 570804
344 Ga0265338_10004162 3300028800 Bacteria 19765
345 Ga0265338_10006785 3300028800 Bacteria 14434
346 Ga0265338_10024579 3300028800 Bacteria 6150
347 Ga0265338_10065540 3300028800 Bacteria 3149
348 Ga0265338_10209249 3300028800 Bacteria 1465
349 Ga0265330_10048674 3300031235 Bacteria 1864
350 Ga0265330_10097431 3300031235 Bacteria 1260
351 Ga0265332_10014628 3300031238 Bacteria 3470
352 Ga0265328_10030360 3300031239 Bacteria 2014
353 Ga0265328_10051349 3300031239 Bacteria 1514
354 Ga0265325_10000007 3300031241 Bacteria 208874
355 Ga0265325_10000284 3300031241 Bacteria 35970
356 Ga0265325_10001302 3300031241 Bacteria 17663
357 Ga0265325_10003823 3300031241 Bacteria 9699
358 Ga0265325_10060372 3300031241 Bacteria 1926
359 Ga0265325_10085479 3300031241 Bacteria 1563
360 Ga0265325_10242265 3300031241 Bacteria 819
361 Ga0265329_10010602 3300031242 Bacteria 3374
362 Ga0265329_10028519 3300031242 Bacteria 1830
363 Ga0265340_10000258 3300031247 Bacteria 27510
364 Ga0265340_10006025 3300031247 Bacteria 6693
365 Ga0265340_10106602 3300031247 Bacteria 1298
366 Ga0265339_10000547 3300031249 Bacteria 29408
367 Ga0265339_10003368 3300031249 Bacteria 11186
368 Ga0265339_10016046 3300031249 Bacteria 4474
369 Ga0265339_10028241 3300031249 Bacteria 3192
370 Ga0265339_10122789 3300031249 Bacteria 1333
371 Ga0265331_10000011 3300031250 Bacteria 308171
372 Ga0265331_10014678 3300031250 Bacteria 4162
373 Ga0265331_10019776 3300031250 Bacteria 3469
374 Ga0265331_10067556 3300031250 Bacteria 1677
375 Ga0265327_10000007 3300031251 Bacteria 678515
376 Ga0265316_10013364 3300031344 Bacteria 7297
377 Ga0265316_10015311 3300031344 Bacteria 6709
378 Ga0265316_10115653 3300031344 Bacteria 2028
379 Ga0265316_10247333 3300031344 Bacteria 1310
380 Ga0265313_10001228 3300031595 Bacteria 24429
381 Ga0265313_10001568 3300031595 Bacteria 21212
382 Ga0265313_10007842 3300031595 Bacteria 7201
383 Ga0265313_10009447 3300031595 Bacteria 6332
384 Ga0265313_10039162 3300031595 Bacteria 2353
385 Ga0265314_10001380 3300031711 Bacteria 27286
386 Ga0265314_10001388 3300031711 Bacteria 27152
387 Ga0265314_10006012 3300031711 Bacteria 10816
388 Ga0265314_10010013 3300031711 Bacteria 7948
389 Ga0265314_10045634 3300031711 Bacteria 3096
390 Ga0265314_10046833 3300031711 Bacteria 3048
391 Ga0265314_10059634 3300031711 Bacteria 2609
392 Ga0265314_10085487 3300031711 Bacteria 2068
393 Ga0265314_10085615 3300031711 Bacteria 2066
394 Ga0265314_10094592 3300031711 Bacteria 1937
395 Ga0265314_10189312 3300031711 Bacteria 1226
396 Ga0265314_10190099 3300031711 Bacteria 1222
397 Ga0265314_10281085 3300031711 Bacteria 941
398 Ga0265342_10007148 3300031712 Bacteria 8216
399 Ga0265342_10009412 3300031712 Bacteria 6893
400 Ga0265342_10047223 3300031712 Bacteria 2585
401 Ga0265342_10117670 3300031712 Bacteria 1499
402 Ga0265342_10254382 3300031712 Bacteria 936
403 Ga0307516_10043047 3300031730 Bacteria 4476
404 Ga0373926_0076790 3300035083 Bacteria 1232
405 Ga0373936_0116933 3300035113 Bacteria 1136
406 Ga0373941_0048365 3300035115 Bacteria 1343
407 Ga0373956_0114606 3300035119 Bacteria 1256
408 Ga0373943_0005973 3300035170 Bacteria 5463
409 Ga0373955_0215491 3300035172 Bacteria 1146
410 Ga0373942_0007529 3300035207 Bacteria 2527
411 Ga0373931_0018014 3300035691 Bacteria 3504
412 Ga0373935_0006457 3300035692 Bacteria 7002
413 Ga0373935_0122677 3300035692 Bacteria 1738
414 Ga0373935_0143849 3300035692 Bacteria 1612
415 Ga0373935_0436935 3300035692 Bacteria 944
416 Ga0373927_0321294 3300035695 Bacteria 1019
417 Ga0373927_0348637 3300035695 Bacteria 976
418 Ga0373933_0114395 3300035724 Bacteria 1685
419 Ga0373933_0436235 3300035724 Bacteria 856
420 Ga0373947_0032046 3300035725 Bacteria 3096
421 Ga0373937_0017820 3300036401 Bacteria 6337
422 Ga0373937_0071714 3300036401 Bacteria 3194
423 Ga0373937_0170864 3300036401 Bacteria 2040
424 Ga0373937_0210195 3300036401 Bacteria 1831
425 Ga0373937_0226347 3300036401 Bacteria 1760
426 Ga0373937_0277042 3300036401 Bacteria 1583
427 Ga0373937_0409279 3300036401 Bacteria 1287
428 Ga0373925_0001183 3300037068 Bacteria 23049
429 Ga0373925_0029166 3300037068 Bacteria 4047
430 Ga0373925_0420242 3300037068 Bacteria 1092
431 Ga0395901_0855514 3300038443 Bacteria 894
432 Ga0436365_0269340 3300039437 Bacteria 68150
433 Ga0436365_0543489 3300039437 Bacteria 1308
434 Ga0436365_1599398 3300039437 Bacteria 6456
435 Ga0436360_1166098 3300039438 Bacteria 904
436 Ga0436363_0055150 3300039450 Bacteria 919
437 Ga0436363_1205068 3300039450 Bacteria 7230
438 Ga0466967_0609241 3300045976 Bacteria 1078
439 Ga0495591_065139 3300046458 Bacteria 959
440 Ga0495650_0114363 3300046471 Bacteria 999
441 Ga0495580_0011364 3300046472 Bacteria 6890
442 Ga0495582_0007506 3300046473 Bacteria 6029
443 Ga0495582_0077846 3300046473 Bacteria 1839
444 Ga0495605_0125775 3300046474 Bacteria 1159
445 Ga0495664_0070693 3300046477 Bacteria 2084
446 Ga0495606_0165709 3300046507 Bacteria 1286
447 Ga0495642_0095150 3300046528 Bacteria 1264
448 Ga0495652_0094582 3300046529 Bacteria 2437
449 Ga0495652_0230715 3300046529 Bacteria 1385
450 Ga0495654_0144527 3300046530 Bacteria 1057
451 Ga0495665_0009673 3300046531 Bacteria 5221
452 Ga0495665_0293703 3300046531 Bacteria 833
453 Ga0495586_0375793 3300046535 Bacteria 817
454 Ga0495621_0014849 3300046539 Bacteria 2473
455 Ga0495597_0124540 3300046542 Bacteria 1072
456 Ga0495622_0003987 3300046557 Bacteria 6892
457 Ga0495611_0006371 3300046648 Bacteria 5032
458 Ga0495611_0048576 3300046648 Bacteria 1908
459 Ga0495625_0107681 3300046660 Bacteria 1908
460 Ga0495623_0041213 3300046679 Bacteria 2947
461 Ga0495623_0229917 3300046679 Bacteria 1052
462 Ga0495658_0004835 3300046683 Bacteria 6609
463 Ga0495658_0102175 3300046683 Bacteria 1713
464 Ga0495669_0222907 3300046684 Bacteria 904
465 Ga0495671_0128538 3300046692 Bacteria 1236
466 Ga0495649_0017914 3300046694 Bacteria 3992
467 Ga0495589_0174964 3300046794 Bacteria 1020
468 Ga0495589_0215668 3300046794 Bacteria 903
469 Ga0495600_0062163 3300046809 Bacteria 2440
470 Ga0495600_0339181 3300046809 Bacteria 943
471 Ga0495581_0323155 3300047315 Bacteria 901
472 Ga0495672_0016162 3300047320 Bacteria 5042
473 Ga0495675_0139192 3300047444 Bacteria 1505
474 Ga0495602_0105433 3300048088 Bacteria 2304
475 Ga0496107_0047226 3300048910 Bacteria 3101
476 Ga0496107_0433424 3300048910 Bacteria 977
477 Ga0496115_0277936 3300048918 Bacteria 1375
478 Ga0496121_0050256 3300048924 Bacteria 3524
479 Ga0495682_0002577 3300049460 Bacteria 8515
480 Ga0501031_0546343 3300049568 Bacteria 746
481 Ga0501032_0066193 3300049569 Bacteria 2415
482 Ga0501032_0087885 3300049569 Bacteria 2064
483 Ga0501032_0090270 3300049569 Bacteria 2033
484 Ga0501032_0408574 3300049569 Bacteria 872
485 Ga0501033_0008702 3300049570 Bacteria 7851
486 Ga0501033_0013154 3300049570 Bacteria 6304
487 Ga0501033_0015659 3300049570 Bacteria 5749
488 Ga0501033_0026234 3300049570 Bacteria 4387
489 Ga0501033_0027909 3300049570 Bacteria 4242
490 Ga0501034_0017190 3300049571 Bacteria 7420
491 Ga0501034_0036875 3300049571 Bacteria 4951
492 Ga0501034_0038869 3300049571 Bacteria 4820
493 Ga0501034_0040638 3300049571 Bacteria 4707
494 Ga0501034_0062462 3300049571 Bacteria 3740
495 Ga0501034_0226337 3300049571 Bacteria 1821
496 Ga0501034_0287125 3300049571 Bacteria 1584
497 Ga0501034_0329710 3300049571 Bacteria 1458
498 Ga0501034_0568452 3300049571 Bacteria 1042
499 Ga0501036_0058104 3300049572 Bacteria 3277
500 Ga0501036_0103872 3300049572 Bacteria 2403
501 Ga0501036_0139796 3300049572 Bacteria 2044
502 Ga0501036_0319081 3300049572 Bacteria 1298
503 Ga0501037_0030060 3300049573 Bacteria 4014
504 Ga0501037_0409381 3300049573 Bacteria 929
505 Ga0501038_0027268 3300049574 Bacteria 5084
506 Ga0501038_0035407 3300049574 Bacteria 4383
507 Ga0501038_0106589 3300049574 Bacteria 2326
508 Ga0501038_0210383 3300049574 Bacteria 1556
509 Ga0501039_0481341 3300049575 Bacteria 975
510 Ga0501042_0262534 3300049578 Bacteria 1247
511 Ga0501043_0161192 3300049579 Bacteria 1752
512 Ga0501043_0180416 3300049579 Bacteria 1645
513 Ga0501043_0186263 3300049579 Bacteria 1616
514 Ga0501046_0002062 3300049580 Bacteria 19066
515 Ga0501046_0011642 3300049580 Bacteria 7519
516 Ga0501046_0281438 3300049580 Bacteria 1218
517 Ga0501047_0011754 3300049581 Bacteria 8279
518 Ga0501047_0021289 3300049581 Bacteria 6225
519 Ga0501047_0023641 3300049581 Bacteria 5900
520 Ga0501047_0045279 3300049581 Bacteria 4254
521 Ga0501047_0047802 3300049581 Bacteria 4133
522 Ga0501047_0089770 3300049581 Bacteria 2950
523 Ga0501047_0090675 3300049581 Bacteria 2934
524 Ga0501047_0111651 3300049581 Bacteria 2616
525 Ga0501047_0158160 3300049581 Bacteria 2138
526 Ga0501047_0281373 3300049581 Bacteria 1508
527 Ga0501047_0345584 3300049581 Bacteria 1325
528 Ga0501047_0446343 3300049581 Bacteria 1123
529 Ga0501047_0473434 3300049581 Bacteria 1080
530 Ga0501047_0474908 3300049581 Bacteria 1078
531 Ga0501048_0313155 3300049582 Bacteria 1118
532 Ga0501067_0013966 3300049583 Bacteria 4448
533 Ga0501067_0041239 3300049583 Bacteria 2563
534 Ga0501069_0043540 3300049585 Bacteria 2485
535 Ga0501070_0000031 3300049586 Bacteria 138137
536 Ga0501070_0007183 3300049586 Bacteria 9456
537 Ga0501070_0047955 3300049586 Bacteria 3549
538 Ga0501070_0049651 3300049586 Bacteria 3484
539 Ga0501072_0040560 3300049588 Bacteria 3655
540 Ga0501073_0019003 3300049589 Bacteria 4965
541 Ga0501073_0043441 3300049589 Bacteria 3169
542 Ga0501073_0133686 3300049589 Bacteria 1719
543 Ga0501073_0213799 3300049589 Bacteria 1332
544 Ga0501073_0237861 3300049589 Bacteria 1258
545 Ga0501073_0261816 3300049589 Bacteria 1193
546 Ga0501074_0077256 3300049590 Bacteria 2389
547 Ga0501077_0144951 3300049593 Bacteria 1506
548 Ga0501079_0026535 3300049741 Bacteria 4440
549 Ga0501080_0004780 3300049742 Bacteria 12082
550 Ga0501080_0005230 3300049742 Bacteria 11560
551 Ga0501080_0023461 3300049742 Bacteria 5717
552 Ga0501080_0107239 3300049742 Bacteria 2589
553 Ga0501080_0152225 3300049742 Bacteria 2137
554 Ga0501080_0153321 3300049742 Bacteria 2129
555 Ga0501080_0165291 3300049742 Bacteria 2042
556 Ga0501080_0385053 3300049742 Bacteria 1263
557 Ga0501081_0631253 3300049743 Bacteria 803
558 Ga0501083_0056414 3300049744 Bacteria 2632
559 Ga0501035_0000593 3300049822 Bacteria 39882
560 Ga0501035_0008843 3300049822 Bacteria 9370
561 Ga0501035_0028647 3300049822 Bacteria 5083
562 Ga0501035_0039200 3300049822 Bacteria 4288
563 Ga0501035_0084505 3300049822 Bacteria 2799
564 Ga0501035_0092111 3300049822 Bacteria 2667
565 Ga0501035_0251832 3300049822 Bacteria 1499
566 Ga0501035_0277493 3300049822 Bacteria 1417
567 Ga0501035_0402665 3300049822 Bacteria 1138
568 Ga0501044_0006216 3300049823 Bacteria 13198
569 Ga0501044_0011582 3300049823 Bacteria 9558
570 Ga0501044_0013488 3300049823 Bacteria 8839
571 Ga0501044_0015989 3300049823 Bacteria 8073
572 Ga0501044_0017846 3300049823 Bacteria 7613
573 Ga0501044_0018107 3300049823 Bacteria 7553
574 Ga0501044_0018950 3300049823 Bacteria 7369
575 Ga0501044_0051119 3300049823 Bacteria 4262
576 Ga0501044_0069415 3300049823 Bacteria 3587
577 Ga0501044_0111989 3300049823 Bacteria 2736
578 Ga0501044_0121164 3300049823 Bacteria 2616
579 Ga0501044_0152796 3300049823 Bacteria 2290
580 Ga0501044_0190277 3300049823 Bacteria 2015
581 Ga0501044_0279467 3300049823 Bacteria 1603
582 nmdc:mga0qj67_312442_c1 3300050509 Bacteria 1272
583 nmdc:mga08y16_42797_c1 3300050511 Bacteria 4743
584 nmdc:mga0n895_276223_c1 3300050512 Bacteria 1704
585 nmdc:mga0rr50_183875_c1 3300050513 Bacteria 1710
586 nmdc:mga08x19_1603_c1 3300050514 Bacteria 14031
587 nmdc:mga08x19_31641_c1 3300050514 Bacteria 3330
588 Ga0500635_0008892 3300053080 Bacteria 2770
589 Ga0500635_0016502 3300053080 Bacteria 2198
590 Ga0495595_0070834 3300053084 Bacteria 1648
591 Ga0500643_000008 3300053087 Bacteria 457931
592 Ga0500646_0005639 3300053090 Bacteria 3169
593 Ga0500555_010279 3300053103 Bacteria 2680
594 Ga0500595_001100 3300053119 Bacteria 15008
595 Ga0500595_026733 3300053119 Bacteria 1986
596 Ga0500595_034452 3300053119 Bacteria 1674
597 Ga0500655_011816 3300053133 Bacteria 1585
598 Ga0500559_0027171 3300053136 Bacteria 2441
599 Ga0500568_0031758 3300053139 Bacteria 2176
600 Ga0500573_0000051 3300053140 Bacteria 95469
601 Ga0500619_084991 3300053154 Bacteria 1065
602 Ga0500637_0034197 3300053178 Bacteria 2843
603 Ga0501084_0000472 3300054114 Bacteria 30948
604 Ga0501084_0008411 3300054114 Bacteria 8526
605 Ga0501084_0144870 3300054114 Bacteria 2001
606 Ga0501084_0212278 3300054114 Bacteria 1633
607 Ga0501082_0111477 3300060353 Bacteria 2368
608 Ga0501082_0163186 3300060353 Bacteria 1936
609 Ga0501082_0278133 3300060353 Bacteria 1457

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046660 Ga0495625_0107681 Ga0495625_0107681_730_1446 176
2 3300053087 Ga0500643_000008 Ga0500643_000008_154423_155139 176
3 3300053090 Ga0500646_0005639 Ga0500646_0005639_77_793 176
4 3300053139 Ga0500568_0031758 Ga0500568_0031758_1280_1996 176
5 3300049589 Ga0501073_0213799 Ga0501073_0213799_669_1316 185
6 3300046809 Ga0495600_0339181 Ga0495600_0339181_283_933 186
7 3300049568 Ga0501031_0546343 Ga0501031_0546343_76_729 186
8 3300049581 Ga0501047_0473434 Ga0501047_0473434_409_1059 186
9 3300050513 nmdc:mga0rr50_183875_c1 nmdc:mga0rr50_183875_c1_41_691 186
10 3300046694 Ga0495649_0017914 Ga0495649_0017914_3288_3971 194
11 3300046535 Ga0495586_0375793 Ga0495586_0375793_113_793 196
12 3300035691 Ga0373931_0018014 Ga0373931_0018014_99_815 197
13 3300009098 Ga0105245_10050351 Ga0105245_100503515 200
14 3300035115 Ga0373941_0048365 Ga0373941_0048365_467_1162 201
15 3300036401 Ga0373937_0170864 Ga0373937_0170864_70_777 203
16 3300005539 Ga0068853_100936979 Ga0068853_1009369791 204
17 3300005718 Ga0068866_10275708 Ga0068866_102757082 204
18 3300006237 Ga0097621_100042490 Ga0097621_1000424902 204
19 3300006358 Ga0068871_100005205 Ga0068871_10000520510 204
20 3300006881 Ga0068865_100055190 Ga0068865_1000551902 204
21 3300009174 Ga0105241_10016786 Ga0105241_100167864 204
22 3300017792 Ga0163161_10016459 Ga0163161_100164591 204
23 3300025925 Ga0207650_10166704 Ga0207650_101667042 204
24 3300025938 Ga0207704_10083728 Ga0207704_100837282 204
25 3300025986 Ga0207658_10119771 Ga0207658_101197711 204
26 3300026041 Ga0207639_10345635 Ga0207639_103456352 204
27 3300026118 Ga0207675_100443100 Ga0207675_1004431001 204
28 3300026121 Ga0207683_10047500 Ga0207683_100475002 204
29 3300028381 Ga0268264_10462357 Ga0268264_104623572 204
30 3300005364 Ga0070673_100354383 Ga0070673_1003543832 206
31 3300005366 Ga0070659_100039022 Ga0070659_1000390222 206
32 3300005437 Ga0070710_10081182 Ga0070710_100811822 206
33 3300005530 Ga0070679_100236344 Ga0070679_1002363443 206
34 3300005548 Ga0070665_100026664 Ga0070665_1000266645 206
35 3300005841 Ga0068863_100353909 Ga0068863_1003539091 206
36 3300005842 Ga0068858_100163958 Ga0068858_1001639582 206
37 3300005843 Ga0068860_100750166 Ga0068860_1007501662 206
38 3300009093 Ga0105240_10071219 Ga0105240_100712192 206
39 3300009093 Ga0105240_10409290 Ga0105240_104092902 206
40 3300009093 Ga0105240_10800039 Ga0105240_108000392 206
41 3300009101 Ga0105247_10122551 Ga0105247_101225512 206
42 3300009176 Ga0105242_10449446 Ga0105242_104494462 206
43 3300009545 Ga0105237_10347556 Ga0105237_103475562 206
44 3300009553 Ga0105249_10031918 Ga0105249_100319185 206
45 3300010375 Ga0105239_10765366 Ga0105239_107653662 206
46 3300014968 Ga0157379_10679298 Ga0157379_106792982 206
47 3300025297 Ga0209758_1039154 Ga0209758_10391542 206
48 3300025900 Ga0207710_10119546 Ga0207710_101195462 206
49 3300025911 Ga0207654_10138258 Ga0207654_101382582 206
50 3300025913 Ga0207695_10344639 Ga0207695_103446392 206
51 3300025914 Ga0207671_10178340 Ga0207671_101783402 206
52 3300025914 Ga0207671_10384619 Ga0207671_103846192 206
53 3300025921 Ga0207652_10195052 Ga0207652_101950521 206
54 3300025924 Ga0207694_10226945 Ga0207694_102269452 206
55 3300025941 Ga0207711_10002955 Ga0207711_100029557 206
56 3300025961 Ga0207712_10204332 Ga0207712_102043322 206
57 3300026088 Ga0207641_10005742 Ga0207641_100057426 206
58 3300026121 Ga0207683_10061374 Ga0207683_100613742 206
59 3300028381 Ga0268264_10445598 Ga0268264_104455982 206
60 3300031239 Ga0265328_10030360 Ga0265328_100303603 206
61 3300031241 Ga0265325_10003823 Ga0265325_100038239 206
62 3300031247 Ga0265340_10000258 Ga0265340_1000025816 206
63 3300031249 Ga0265339_10016046 Ga0265339_100160465 206
64 3300031249 Ga0265339_10122789 Ga0265339_101227892 206
65 3300031344 Ga0265316_10015311 Ga0265316_100153113 206
66 3300031595 Ga0265313_10007842 Ga0265313_100078425 206
67 3300031595 Ga0265313_10039162 Ga0265313_100391622 206
68 3300031711 Ga0265314_10189312 Ga0265314_101893121 206
69 3300031712 Ga0265342_10009412 Ga0265342_100094123 206
70 3300035119 Ga0373956_0114606 Ga0373956_0114606_458_1168 206
71 3300035172 Ga0373955_0215491 Ga0373955_0215491_202_912 206
72 3300035207 Ga0373942_0007529 Ga0373942_0007529_1033_1746 206
73 3300035692 Ga0373935_0436935 Ga0373935_0436935_21_731 206
74 3300036401 Ga0373937_0017820 Ga0373937_0017820_1683_2393 206
75 3300036401 Ga0373937_0277042 Ga0373937_0277042_450_1160 206
76 3300046458 Ga0495591_065139 Ga0495591_065139_46_762 206
77 3300046474 Ga0495605_0125775 Ga0495605_0125775_269_982 206
78 3300046528 Ga0495642_0095150 Ga0495642_0095150_120_833 206
79 3300046530 Ga0495654_0144527 Ga0495654_0144527_59_772 206
80 3300046539 Ga0495621_0014849 Ga0495621_0014849_1526_2242 206
81 3300046542 Ga0495597_0124540 Ga0495597_0124540_133_846 206
82 3300046648 Ga0495611_0006371 Ga0495611_0006371_2213_2926 206
83 3300046683 Ga0495658_0102175 Ga0495658_0102175_140_853 206
84 3300046794 Ga0495589_0174964 Ga0495589_0174964_269_982 206
85 3300047320 Ga0495672_0016162 Ga0495672_0016162_1854_2567 206
86 3300049569 Ga0501032_0087885 Ga0501032_0087885_776_1486 206
87 3300049570 Ga0501033_0008702 Ga0501033_0008702_5089_5799 206
88 3300049570 Ga0501033_0026234 Ga0501033_0026234_817_1527 206
89 3300049571 Ga0501034_0062462 Ga0501034_0062462_1797_2531 206
90 3300049571 Ga0501034_0287125 Ga0501034_0287125_506_1216 206
91 3300049571 Ga0501034_0568452 Ga0501034_0568452_208_918 206
92 3300049572 Ga0501036_0058104 Ga0501036_0058104_943_1653 206
93 3300049574 Ga0501038_0106589 Ga0501038_0106589_305_1015 206
94 3300049575 Ga0501039_0481341 Ga0501039_0481341_75_809 206
95 3300049579 Ga0501043_0186263 Ga0501043_0186263_239_976 206
96 3300049581 Ga0501047_0011754 Ga0501047_0011754_3673_4383 206
97 3300049581 Ga0501047_0111651 Ga0501047_0111651_952_1662 206
98 3300049742 Ga0501080_0385053 Ga0501080_0385053_291_1025 206
99 3300049822 Ga0501035_0008843 Ga0501035_0008843_3162_3872 206
100 3300049822 Ga0501035_0028647 Ga0501035_0028647_2553_3263 206
101 3300049822 Ga0501035_0251832 Ga0501035_0251832_62_772 206
102 3300049823 Ga0501044_0121164 Ga0501044_0121164_1679_2389 206
103 3300049823 Ga0501044_0152796 Ga0501044_0152796_646_1380 206
104 3300049823 Ga0501044_0279467 Ga0501044_0279467_463_1173 206
105 3300053080 Ga0500635_0016502 Ga0500635_0016502_113_826 206
106 3300053084 Ga0495595_0070834 Ga0495595_0070834_613_1323 206
107 3300053133 Ga0500655_011816 Ga0500655_011816_615_1328 206
108 3300053140 Ga0500573_0000051 Ga0500573_0000051_69583_70299 206
109 3300053178 Ga0500637_0034197 Ga0500637_0034197_634_1347 206
110 3300005331 Ga0070670_100187887 Ga0070670_1001878872 207
111 3300005344 Ga0070661_100000581 Ga0070661_10000058125 207
112 3300005364 Ga0070673_100196315 Ga0070673_1001963152 207
113 3300005406 Ga0070703_10032496 Ga0070703_100324962 207
114 3300005614 Ga0068856_100212695 Ga0068856_1002126953 207
115 3300009094 Ga0111539_10089127 Ga0111539_100891272 207
116 3300021384 Ga0213876_10005787 Ga0213876_100057879 207
117 3300025920 Ga0207649_10000036 Ga0207649_10000036111 207
118 3300025925 Ga0207650_10145352 Ga0207650_101453522 207
119 3300027907 Ga0207428_10083240 Ga0207428_100832402 207
120 3300028556 Ga0265337_1004926 Ga0265337_10049266 207
121 3300028573 Ga0265334_10000808 Ga0265334_100008086 207
122 3300028577 Ga0265318_10000018 Ga0265318_1000001851 207
123 3300028800 Ga0265338_10024579 Ga0265338_100245796 207
124 3300031241 Ga0265325_10085479 Ga0265325_100854792 207
125 3300031250 Ga0265331_10000011 Ga0265331_10000011138 207
126 3300031250 Ga0265331_10014678 Ga0265331_100146782 207
127 3300031251 Ga0265327_10000007 Ga0265327_1000000761 207
128 3300031711 Ga0265314_10094592 Ga0265314_100945922 207
129 3300031711 Ga0265314_10190099 Ga0265314_101900992 207
130 3300031711 Ga0265314_10281085 Ga0265314_102810851 207
131 3300035692 Ga0373935_0122677 Ga0373935_0122677_450_1163 207
132 3300037068 Ga0373925_0420242 Ga0373925_0420242_60_773 207
133 3300039437 Ga0436365_1599398 Ga0436365_1599398_413_1129 207
134 3300039438 Ga0436360_1166098 Ga0436360_1166098_66_779 207
135 3300046473 Ga0495582_0077846 Ga0495582_0077846_97_810 207
136 3300046531 Ga0495665_0009673 Ga0495665_0009673_3156_3869 207
137 3300049570 Ga0501033_0015659 Ga0501033_0015659_1139_1852 207
138 3300049571 Ga0501034_0017190 Ga0501034_0017190_2124_2837 207
139 3300049572 Ga0501036_0319081 Ga0501036_0319081_362_1075 207
140 3300049574 Ga0501038_0027268 Ga0501038_0027268_3808_4521 207
141 3300049578 Ga0501042_0262534 Ga0501042_0262534_84_797 207
142 3300049580 Ga0501046_0011642 Ga0501046_0011642_2029_2742 207
143 3300049581 Ga0501047_0158160 Ga0501047_0158160_163_876 207
144 3300049586 Ga0501070_0047955 Ga0501070_0047955_693_1406 207
145 3300049586 Ga0501070_0049651 Ga0501070_0049651_1774_2490 207
146 3300049589 Ga0501073_0043441 Ga0501073_0043441_1937_2650 207
147 3300049589 Ga0501073_0237861 Ga0501073_0237861_383_1099 207
148 3300049593 Ga0501077_0144951 Ga0501077_0144951_781_1494 207
149 3300049742 Ga0501080_0152225 Ga0501080_0152225_843_1556 207
150 3300049742 Ga0501080_0165291 Ga0501080_0165291_940_1653 207
151 3300049743 Ga0501081_0631253 Ga0501081_0631253_37_750 207
152 3300049823 Ga0501044_0011582 Ga0501044_0011582_8534_9247 207
153 3300050509 nmdc:mga0qj67_312442_c1 nmdc:mga0qj67_312442_c1_220_933 207
154 3300050511 nmdc:mga08y16_42797_c1 nmdc:mga08y16_42797_c1_1542_2255 207
155 3300054114 Ga0501084_0144870 Ga0501084_0144870_1251_1964 207
156 3300060353 Ga0501082_0111477 Ga0501082_0111477_1217_1930 207
157 3300003214 JGI25165J46597_1000008 JGI25165J46597_1000008294 208
158 3300003215 JGI25153J46596_10000526 JGI25153J46596_1000052626 208
159 3300003911 JGI25405J52794_10011653 JGI25405J52794_100116531 208
160 3300005327 Ga0070658_10003357 Ga0070658_1000335714 208
161 3300005327 Ga0070658_10023105 Ga0070658_100231052 208
162 3300005327 Ga0070658_10047580 Ga0070658_100475802 208
163 3300005327 Ga0070658_10376920 Ga0070658_103769201 208
164 3300005328 Ga0070676_10016304 Ga0070676_100163041 208
165 3300005329 Ga0070683_100086527 Ga0070683_1000865272 208
166 3300005330 Ga0070690_100039280 Ga0070690_1000392802 208
167 3300005334 Ga0068869_100032532 Ga0068869_1000325325 208
168 3300005334 Ga0068869_100311217 Ga0068869_1003112172 208
169 3300005335 Ga0070666_10007718 Ga0070666_100077186 208
170 3300005336 Ga0070680_100000153 Ga0070680_10000015331 208
171 3300005336 Ga0070680_100038695 Ga0070680_1000386953 208
172 3300005336 Ga0070680_100059936 Ga0070680_1000599364 208
173 3300005338 Ga0068868_100003905 Ga0068868_10000390511 208
174 3300005338 Ga0068868_100187398 Ga0068868_1001873982 208
175 3300005339 Ga0070660_100015109 Ga0070660_1000151094 208
176 3300005339 Ga0070660_100040647 Ga0070660_1000406474 208
177 3300005339 Ga0070660_100278366 Ga0070660_1002783662 208
178 3300005341 Ga0070691_10000365 Ga0070691_100003655 208
179 3300005341 Ga0070691_10001050 Ga0070691_100010503 208
180 3300005355 Ga0070671_100337798 Ga0070671_1003377981 208
181 3300005356 Ga0070674_100580051 Ga0070674_1005800511 208
182 3300005356 Ga0070674_100596131 Ga0070674_1005961311 208
183 3300005364 Ga0070673_100022308 Ga0070673_1000223085 208
184 3300005364 Ga0070673_100488752 Ga0070673_1004887521 208
185 3300005366 Ga0070659_100033010 Ga0070659_1000330102 208
186 3300005367 Ga0070667_100122038 Ga0070667_1001220381 208
187 3300005434 Ga0070709_10000576 Ga0070709_1000057620 208
188 3300005435 Ga0070714_100008568 Ga0070714_1000085685 208
189 3300005435 Ga0070714_100433211 Ga0070714_1004332112 208
190 3300005436 Ga0070713_100000001 Ga0070713_100000001216 208
191 3300005439 Ga0070711_100007422 Ga0070711_1000074227 208
192 3300005456 Ga0070678_100039462 Ga0070678_1000394623 208
193 3300005456 Ga0070678_100258042 Ga0070678_1002580422 208
194 3300005458 Ga0070681_10000001 Ga0070681_10000001843 208
195 3300005458 Ga0070681_10033253 Ga0070681_100332536 208
196 3300005458 Ga0070681_10048118 Ga0070681_100481185 208
197 3300005458 Ga0070681_10130175 Ga0070681_101301752 208
198 3300005459 Ga0068867_100015700 Ga0068867_1000157003 208
199 3300005530 Ga0070679_100003754 Ga0070679_1000037548 208
200 3300005530 Ga0070679_100017919 Ga0070679_1000179192 208
201 3300005530 Ga0070679_100133996 Ga0070679_1001339962 208
202 3300005530 Ga0070679_100565418 Ga0070679_1005654181 208
203 3300005535 Ga0070684_100032787 Ga0070684_1000327872 208
204 3300005535 Ga0070684_100767359 Ga0070684_1007673591 208
205 3300005536 Ga0070697_100292611 Ga0070697_1002926112 208
206 3300005539 Ga0068853_100007961 Ga0068853_1000079618 208
207 3300005539 Ga0068853_100032144 Ga0068853_1000321444 208
208 3300005539 Ga0068853_100053326 Ga0068853_1000533262 208
209 3300005539 Ga0068853_100081697 Ga0068853_1000816972 208
210 3300005539 Ga0068853_100380115 Ga0068853_1003801152 208
211 3300005539 Ga0068853_100793596 Ga0068853_1007935961 208
212 3300005543 Ga0070672_100438380 Ga0070672_1004383802 208
213 3300005545 Ga0070695_100030159 Ga0070695_1000301594 208
214 3300005547 Ga0070693_100383003 Ga0070693_1003830032 208
215 3300005548 Ga0070665_100000707 Ga0070665_10000070715 208
216 3300005548 Ga0070665_100068703 Ga0070665_1000687033 208
217 3300005548 Ga0070665_100101549 Ga0070665_1001015492 208
218 3300005548 Ga0070665_100554434 Ga0070665_1005544342 208
219 3300005563 Ga0068855_100000010 Ga0068855_10000001074 208
220 3300005563 Ga0068855_100007439 Ga0068855_10000743911 208
221 3300005563 Ga0068855_100013486 Ga0068855_1000134869 208
222 3300005563 Ga0068855_100015637 Ga0068855_1000156375 208
223 3300005563 Ga0068855_100157734 Ga0068855_1001577342 208
224 3300005563 Ga0068855_100636834 Ga0068855_1006368342 208
225 3300005564 Ga0070664_100100542 Ga0070664_1001005423 208
226 3300005577 Ga0068857_100001101 Ga0068857_1000011012 208
227 3300005577 Ga0068857_100104906 Ga0068857_1001049063 208
228 3300005577 Ga0068857_100227480 Ga0068857_1002274802 208
229 3300005578 Ga0068854_100214755 Ga0068854_1002147552 208
230 3300005578 Ga0068854_100377226 Ga0068854_1003772262 208
231 3300005614 Ga0068856_100001359 Ga0068856_10000135926 208
232 3300005614 Ga0068856_100069296 Ga0068856_1000692965 208
233 3300005614 Ga0068856_100075133 Ga0068856_1000751332 208
234 3300005616 Ga0068852_100023771 Ga0068852_1000237715 208
235 3300005616 Ga0068852_100078350 Ga0068852_1000783503 208
236 3300005616 Ga0068852_100079973 Ga0068852_1000799733 208
237 3300005616 Ga0068852_100101203 Ga0068852_1001012032 208
238 3300005616 Ga0068852_100281401 Ga0068852_1002814013 208
239 3300005616 Ga0068852_100661453 Ga0068852_1006614531 208
240 3300005618 Ga0068864_100044310 Ga0068864_1000443102 208
241 3300005618 Ga0068864_100426047 Ga0068864_1004260472 208
242 3300005618 Ga0068864_100622518 Ga0068864_1006225182 208
243 3300005840 Ga0068870_10170950 Ga0068870_101709502 208
244 3300005842 Ga0068858_100028706 Ga0068858_1000287062 208
245 3300005842 Ga0068858_100267476 Ga0068858_1002674761 208
246 3300005842 Ga0068858_100268644 Ga0068858_1002686442 208
247 3300005843 Ga0068860_100642679 Ga0068860_1006426791 208
248 3300005937 Ga0081455_10008827 Ga0081455_100088277 208
249 3300006175 Ga0070712_100000305 Ga0070712_10000030524 208
250 3300006175 Ga0070712_100000761 Ga0070712_1000007617 208
251 3300006175 Ga0070712_100222305 Ga0070712_1002223052 208
252 3300006237 Ga0097621_100058271 Ga0097621_1000582715 208
253 3300006237 Ga0097621_100360542 Ga0097621_1003605422 208
254 3300006237 Ga0097621_100440315 Ga0097621_1004403152 208
255 3300006358 Ga0068871_100000610 Ga0068871_10000061034 208
256 3300006881 Ga0068865_100617965 Ga0068865_1006179651 208
257 3300006914 Ga0075436_100002535 Ga0075436_1000025358 208
258 3300006914 Ga0075436_100016286 Ga0075436_1000162867 208
259 3300007076 Ga0075435_100092338 Ga0075435_1000923383 208
260 3300009093 Ga0105240_10000189 Ga0105240_1000018919 208
261 3300009093 Ga0105240_10012428 Ga0105240_100124286 208
262 3300009093 Ga0105240_10063306 Ga0105240_100633063 208
263 3300009098 Ga0105245_10062378 Ga0105245_100623783 208
264 3300009098 Ga0105245_10088798 Ga0105245_100887982 208
265 3300009101 Ga0105247_10054265 Ga0105247_100542652 208
266 3300009148 Ga0105243_10029864 Ga0105243_100298644 208
267 3300009174 Ga0105241_10132259 Ga0105241_101322592 208
268 3300009174 Ga0105241_10159418 Ga0105241_101594182 208
269 3300009174 Ga0105241_10506223 Ga0105241_105062231 208
270 3300009176 Ga0105242_10020187 Ga0105242_100201874 208
271 3300009176 Ga0105242_10630078 Ga0105242_106300781 208
272 3300009177 Ga0105248_10000001 Ga0105248_10000001468 208
273 3300009177 Ga0105248_10111993 Ga0105248_101119932 208
274 3300009545 Ga0105237_10005417 Ga0105237_1000541712 208
275 3300009545 Ga0105237_10142097 Ga0105237_101420972 208
276 3300009545 Ga0105237_10170529 Ga0105237_101705293 208
277 3300009545 Ga0105237_10430824 Ga0105237_104308241 208
278 3300009545 Ga0105237_10557003 Ga0105237_105570032 208
279 3300009551 Ga0105238_10002544 Ga0105238_100025448 208
280 3300009551 Ga0105238_10166738 Ga0105238_101667382 208
281 3300009551 Ga0105238_10221105 Ga0105238_102211052 208
282 3300009551 Ga0105238_10250587 Ga0105238_102505872 208
283 3300009551 Ga0105238_10335217 Ga0105238_103352172 208
284 3300010375 Ga0105239_10002523 Ga0105239_1000252317 208
285 3300010375 Ga0105239_10010826 Ga0105239_100108267 208
286 3300010375 Ga0105239_10022665 Ga0105239_100226652 208
287 3300010375 Ga0105239_10023500 Ga0105239_100235002 208
288 3300010375 Ga0105239_10049571 Ga0105239_100495712 208
289 3300010375 Ga0105239_10197489 Ga0105239_101974892 208
290 3300011119 Ga0105246_10054633 Ga0105246_100546334 208
291 3300013100 Ga0157373_10002728 Ga0157373_100027285 208
292 3300013100 Ga0157373_10018161 Ga0157373_100181614 208
293 3300013104 Ga0157370_10009312 Ga0157370_1000931212 208
294 3300013104 Ga0157370_10031407 Ga0157370_100314075 208
295 3300013104 Ga0157370_10430432 Ga0157370_104304322 208
296 3300013105 Ga0157369_10004483 Ga0157369_1000448321 208
297 3300013105 Ga0157369_10012365 Ga0157369_100123658 208
298 3300013105 Ga0157369_10089183 Ga0157369_100891833 208
299 3300013105 Ga0157369_10205309 Ga0157369_102053092 208
300 3300013296 Ga0157374_10032828 Ga0157374_100328283 208
301 3300013297 Ga0157378_10035998 Ga0157378_100359985 208
302 3300013297 Ga0157378_10096883 Ga0157378_100968832 208
303 3300013297 Ga0157378_10238400 Ga0157378_102384001 208
304 3300013306 Ga0163162_10032156 Ga0163162_100321565 208
305 3300013306 Ga0163162_10048238 Ga0163162_100482383 208
306 3300013306 Ga0163162_10277121 Ga0163162_102771212 208
307 3300013306 Ga0163162_10492473 Ga0163162_104924732 208
308 3300013307 Ga0157372_10051294 Ga0157372_100512945 208
309 3300013307 Ga0157372_10102044 Ga0157372_101020442 208
310 3300013307 Ga0157372_10206467 Ga0157372_102064673 208
311 3300013308 Ga0157375_10232289 Ga0157375_102322891 208
312 3300014325 Ga0163163_10000016 Ga0163163_1000001641 208
313 3300014325 Ga0163163_10420057 Ga0163163_104200572 208
314 3300014326 Ga0157380_10034879 Ga0157380_100348795 208
315 3300014968 Ga0157379_10001102 Ga0157379_1000110213 208
316 3300014968 Ga0157379_10002471 Ga0157379_100024719 208
317 3300014968 Ga0157379_10006337 Ga0157379_100063375 208
318 3300014968 Ga0157379_10022423 Ga0157379_100224236 208
319 3300014968 Ga0157379_10082810 Ga0157379_100828103 208
320 3300014969 Ga0157376_10436812 Ga0157376_104368122 208
321 3300021377 Ga0213874_10001290 Ga0213874_100012904 208
322 3300021384 Ga0213876_10001710 Ga0213876_1000171010 208
323 3300025261 Ga0209233_1000006 Ga0209233_10000061243 208
324 3300025297 Ga0209758_1000032 Ga0209758_100003282 208
325 3300025321 Ga0207656_10092426 Ga0207656_100924262 208
326 3300025898 Ga0207692_10508796 Ga0207692_105087961 208
327 3300025900 Ga0207710_10019836 Ga0207710_100198362 208
328 3300025903 Ga0207680_10085889 Ga0207680_100858892 208
329 3300025906 Ga0207699_10000445 Ga0207699_1000044520 208
330 3300025907 Ga0207645_10020714 Ga0207645_100207142 208
331 3300025908 Ga0207643_10039094 Ga0207643_100390943 208
332 3300025909 Ga0207705_10000098 Ga0207705_1000009881 208
333 3300025909 Ga0207705_10005859 Ga0207705_100058598 208
334 3300025909 Ga0207705_10295110 Ga0207705_102951102 208
335 3300025909 Ga0207705_10299470 Ga0207705_102994701 208
336 3300025911 Ga0207654_10193967 Ga0207654_101939672 208
337 3300025911 Ga0207654_10265647 Ga0207654_102656472 208
338 3300025911 Ga0207654_10367104 Ga0207654_103671042 208
339 3300025912 Ga0207707_10000001 Ga0207707_10000001522 208
340 3300025912 Ga0207707_10000678 Ga0207707_1000067831 208
341 3300025912 Ga0207707_10025131 Ga0207707_100251312 208
342 3300025912 Ga0207707_10038895 Ga0207707_100388955 208
343 3300025912 Ga0207707_10153658 Ga0207707_101536582 208
344 3300025913 Ga0207695_10000003 Ga0207695_10000003447 208
345 3300025913 Ga0207695_10015190 Ga0207695_100151909 208
346 3300025913 Ga0207695_10025117 Ga0207695_100251173 208
347 3300025913 Ga0207695_10052311 Ga0207695_100523112 208
348 3300025913 Ga0207695_10079110 Ga0207695_100791103 208
349 3300025913 Ga0207695_10225113 Ga0207695_102251133 208
350 3300025913 Ga0207695_10326816 Ga0207695_103268162 208
351 3300025914 Ga0207671_10027027 Ga0207671_100270272 208
352 3300025914 Ga0207671_10037081 Ga0207671_100370815 208
353 3300025914 Ga0207671_10215001 Ga0207671_102150012 208
354 3300025914 Ga0207671_10246647 Ga0207671_102466472 208
355 3300025915 Ga0207693_10000116 Ga0207693_1000011634 208
356 3300025915 Ga0207693_10000456 Ga0207693_1000045622 208
357 3300025916 Ga0207663_10023982 Ga0207663_100239822 208
358 3300025917 Ga0207660_10000128 Ga0207660_1000012837 208
359 3300025917 Ga0207660_10008285 Ga0207660_100082855 208
360 3300025919 Ga0207657_10002111 Ga0207657_1000211112 208
361 3300025919 Ga0207657_10006117 Ga0207657_100061175 208
362 3300025920 Ga0207649_10092864 Ga0207649_100928642 208
363 3300025921 Ga0207652_10002777 Ga0207652_1000277711 208
364 3300025921 Ga0207652_10003066 Ga0207652_100030668 208
365 3300025921 Ga0207652_10005101 Ga0207652_100051018 208
366 3300025921 Ga0207652_10125116 Ga0207652_101251162 208
367 3300025921 Ga0207652_10729650 Ga0207652_107296501 208
368 3300025924 Ga0207694_10000011 Ga0207694_10000011312 208
369 3300025924 Ga0207694_10017308 Ga0207694_100173084 208
370 3300025924 Ga0207694_10050982 Ga0207694_100509824 208
371 3300025924 Ga0207694_10102159 Ga0207694_101021592 208
372 3300025924 Ga0207694_10174977 Ga0207694_101749772 208
373 3300025925 Ga0207650_10044345 Ga0207650_100443454 208
374 3300025926 Ga0207659_10661996 Ga0207659_106619961 208
375 3300025927 Ga0207687_10035132 Ga0207687_100351322 208
376 3300025927 Ga0207687_10071185 Ga0207687_100711852 208
377 3300025928 Ga0207700_10000015 Ga0207700_1000001551 208
378 3300025929 Ga0207664_10317180 Ga0207664_103171802 208
379 3300025929 Ga0207664_10512466 Ga0207664_105124662 208
380 3300025929 Ga0207664_10890924 Ga0207664_108909241 208
381 3300025931 Ga0207644_10187891 Ga0207644_101878912 208
382 3300025934 Ga0207686_10041472 Ga0207686_100414722 208
383 3300025934 Ga0207686_10107284 Ga0207686_101072842 208
384 3300025935 Ga0207709_10012253 Ga0207709_100122535 208
385 3300025937 Ga0207669_10095672 Ga0207669_100956723 208
386 3300025938 Ga0207704_10112825 Ga0207704_101128252 208
387 3300025940 Ga0207691_10437015 Ga0207691_104370152 208
388 3300025941 Ga0207711_10000002 Ga0207711_100000021169 208
389 3300025941 Ga0207711_10586549 Ga0207711_105865492 208
390 3300025942 Ga0207689_10058700 Ga0207689_100587005 208
391 3300025942 Ga0207689_10318436 Ga0207689_103184362 208
392 3300025944 Ga0207661_10176429 Ga0207661_101764292 208
393 3300025949 Ga0207667_10000093 Ga0207667_1000009362 208
394 3300025949 Ga0207667_10005157 Ga0207667_100051573 208
395 3300025949 Ga0207667_10009417 Ga0207667_100094172 208
396 3300025949 Ga0207667_10547806 Ga0207667_105478061 208
397 3300025949 Ga0207667_10872230 Ga0207667_108722301 208
398 3300025960 Ga0207651_10024088 Ga0207651_100240882 208
399 3300025960 Ga0207651_10025715 Ga0207651_100257155 208
400 3300025981 Ga0207640_10298470 Ga0207640_102984702 208
401 3300026023 Ga0207677_10001820 Ga0207677_100018204 208
402 3300026023 Ga0207677_10215007 Ga0207677_102150072 208
403 3300026035 Ga0207703_10034272 Ga0207703_100342724 208
404 3300026035 Ga0207703_10056025 Ga0207703_100560254 208
405 3300026035 Ga0207703_10134458 Ga0207703_101344582 208
406 3300026035 Ga0207703_10175283 Ga0207703_101752832 208
407 3300026041 Ga0207639_10015953 Ga0207639_100159539 208
408 3300026041 Ga0207639_10022994 Ga0207639_100229945 208
409 3300026041 Ga0207639_10158078 Ga0207639_101580782 208
410 3300026041 Ga0207639_10752289 Ga0207639_107522891 208
411 3300026067 Ga0207678_10127546 Ga0207678_101275462 208
412 3300026078 Ga0207702_10000011 Ga0207702_1000001146 208
413 3300026078 Ga0207702_10027197 Ga0207702_100271977 208
414 3300026078 Ga0207702_10056719 Ga0207702_100567193 208
415 3300026078 Ga0207702_10264537 Ga0207702_102645371 208
416 3300026089 Ga0207648_10034577 Ga0207648_100345775 208
417 3300026095 Ga0207676_10355372 Ga0207676_103553722 208
418 3300026116 Ga0207674_10000002 Ga0207674_1000000247 208
419 3300026116 Ga0207674_10038487 Ga0207674_100384875 208
420 3300026116 Ga0207674_10149132 Ga0207674_101491323 208
421 3300026116 Ga0207674_10180895 Ga0207674_101808952 208
422 3300026116 Ga0207674_10322894 Ga0207674_103228942 208
423 3300026121 Ga0207683_10058388 Ga0207683_100583882 208
424 3300026121 Ga0207683_10326151 Ga0207683_103261512 208
425 3300026142 Ga0207698_10012802 Ga0207698_100128025 208
426 3300026142 Ga0207698_10220004 Ga0207698_102200042 208
427 3300026142 Ga0207698_10254058 Ga0207698_102540582 208
428 3300026142 Ga0207698_10358391 Ga0207698_103583912 208
429 3300026142 Ga0207698_10412552 Ga0207698_104125522 208
430 3300028379 Ga0268266_10001112 Ga0268266_1000111224 208
431 3300028379 Ga0268266_10019570 Ga0268266_100195704 208
432 3300028379 Ga0268266_10024113 Ga0268266_100241132 208
433 3300028379 Ga0268266_10031961 Ga0268266_100319612 208
434 3300028379 Ga0268266_10242408 Ga0268266_102424082 208
435 3300028379 Ga0268266_10268729 Ga0268266_102687292 208
436 3300028379 Ga0268266_10418758 Ga0268266_104187582 208
437 3300028381 Ga0268264_10550739 Ga0268264_105507391 208
438 3300028573 Ga0265334_10016634 Ga0265334_100166342 208
439 3300028573 Ga0265334_10084099 Ga0265334_100840992 208
440 3300028577 Ga0265318_10000703 Ga0265318_1000070312 208
441 3300028800 Ga0265338_10000006 Ga0265338_1000000662 208
442 3300028800 Ga0265338_10004162 Ga0265338_1000416220 208
443 3300028800 Ga0265338_10006785 Ga0265338_1000678511 208
444 3300028800 Ga0265338_10065540 Ga0265338_100655402 208
445 3300028800 Ga0265338_10209249 Ga0265338_102092492 208
446 3300031235 Ga0265330_10048674 Ga0265330_100486741 208
447 3300031235 Ga0265330_10097431 Ga0265330_100974312 208
448 3300031238 Ga0265332_10014628 Ga0265332_100146283 208
449 3300031239 Ga0265328_10051349 Ga0265328_100513492 208
450 3300031241 Ga0265325_10000007 Ga0265325_1000000762 208
451 3300031241 Ga0265325_10000284 Ga0265325_1000028432 208
452 3300031241 Ga0265325_10001302 Ga0265325_1000130211 208
453 3300031241 Ga0265325_10060372 Ga0265325_100603722 208
454 3300031241 Ga0265325_10242265 Ga0265325_102422651 208
455 3300031242 Ga0265329_10010602 Ga0265329_100106022 208
456 3300031242 Ga0265329_10028519 Ga0265329_100285193 208
457 3300031247 Ga0265340_10006025 Ga0265340_100060254 208
458 3300031247 Ga0265340_10106602 Ga0265340_101066022 208
459 3300031249 Ga0265339_10000547 Ga0265339_100005478 208
460 3300031249 Ga0265339_10003368 Ga0265339_100033687 208
461 3300031249 Ga0265339_10028241 Ga0265339_100282411 208
462 3300031250 Ga0265331_10019776 Ga0265331_100197762 208
463 3300031250 Ga0265331_10067556 Ga0265331_100675562 208
464 3300031344 Ga0265316_10013364 Ga0265316_100133645 208
465 3300031344 Ga0265316_10115653 Ga0265316_101156532 208
466 3300031344 Ga0265316_10247333 Ga0265316_102473332 208
467 3300031595 Ga0265313_10001228 Ga0265313_100012282 208
468 3300031595 Ga0265313_10001568 Ga0265313_100015684 208
469 3300031595 Ga0265313_10009447 Ga0265313_100094477 208
470 3300031711 Ga0265314_10001380 Ga0265314_1000138024 208
471 3300031711 Ga0265314_10001388 Ga0265314_1000138829 208
472 3300031711 Ga0265314_10006012 Ga0265314_100060123 208
473 3300031711 Ga0265314_10010013 Ga0265314_100100135 208
474 3300031711 Ga0265314_10045634 Ga0265314_100456344 208
475 3300031711 Ga0265314_10046833 Ga0265314_100468332 208
476 3300031711 Ga0265314_10059634 Ga0265314_100596343 208
477 3300031711 Ga0265314_10085487 Ga0265314_100854872 208
478 3300031711 Ga0265314_10085615 Ga0265314_100856152 208
479 3300031712 Ga0265342_10007148 Ga0265342_100071485 208
480 3300031712 Ga0265342_10047223 Ga0265342_100472232 208
481 3300031712 Ga0265342_10117670 Ga0265342_101176702 208
482 3300031712 Ga0265342_10254382 Ga0265342_102543822 208
483 3300031730 Ga0307516_10043047 Ga0307516_100430476 208
484 3300035083 Ga0373926_0076790 Ga0373926_0076790_501_1217 208
485 3300035113 Ga0373936_0116933 Ga0373936_0116933_212_928 208
486 3300035170 Ga0373943_0005973 Ga0373943_0005973_4270_4986 208
487 3300035692 Ga0373935_0006457 Ga0373935_0006457_4287_5003 208
488 3300035692 Ga0373935_0143849 Ga0373935_0143849_310_1026 208
489 3300035695 Ga0373927_0321294 Ga0373927_0321294_37_753 208
490 3300035695 Ga0373927_0348637 Ga0373927_0348637_108_863 208
491 3300035724 Ga0373933_0114395 Ga0373933_0114395_220_936 208
492 3300035724 Ga0373933_0436235 Ga0373933_0436235_72_791 208
493 3300035725 Ga0373947_0032046 Ga0373947_0032046_706_1422 208
494 3300036401 Ga0373937_0071714 Ga0373937_0071714_2140_2856 208
495 3300036401 Ga0373937_0210195 Ga0373937_0210195_561_1280 208
496 3300036401 Ga0373937_0226347 Ga0373937_0226347_981_1697 208
497 3300036401 Ga0373937_0409279 Ga0373937_0409279_319_1035 208
498 3300037068 Ga0373925_0001183 Ga0373925_0001183_18763_19479 208
499 3300037068 Ga0373925_0029166 Ga0373925_0029166_1335_2051 208
500 3300038443 Ga0395901_0855514 Ga0395901_0855514_56_775 208
501 3300039437 Ga0436365_0269340 Ga0436365_0269340_6650_7366 208
502 3300039437 Ga0436365_0543489 Ga0436365_0543489_468_1184 208
503 3300039450 Ga0436363_0055150 Ga0436363_0055150_127_843 208
504 3300039450 Ga0436363_1205068 Ga0436363_1205068_1948_2664 208
505 3300045976 Ga0466967_0609241 Ga0466967_0609241_32_748 208
506 3300046471 Ga0495650_0114363 Ga0495650_0114363_127_843 208
507 3300046472 Ga0495580_0011364 Ga0495580_0011364_5343_6065 208
508 3300046473 Ga0495582_0007506 Ga0495582_0007506_977_1699 208
509 3300046477 Ga0495664_0070693 Ga0495664_0070693_470_1186 208
510 3300046507 Ga0495606_0165709 Ga0495606_0165709_98_814 208
511 3300046529 Ga0495652_0094582 Ga0495652_0094582_314_1030 208
512 3300046529 Ga0495652_0230715 Ga0495652_0230715_576_1292 208
513 3300046531 Ga0495665_0293703 Ga0495665_0293703_95_817 208
514 3300046557 Ga0495622_0003987 Ga0495622_0003987_1340_2080 208
515 3300046648 Ga0495611_0048576 Ga0495611_0048576_390_1130 208
516 3300046679 Ga0495623_0041213 Ga0495623_0041213_2198_2914 208
517 3300046679 Ga0495623_0229917 Ga0495623_0229917_285_1001 208
518 3300046683 Ga0495658_0004835 Ga0495658_0004835_1982_2704 208
519 3300046684 Ga0495669_0222907 Ga0495669_0222907_54_770 208
520 3300046692 Ga0495671_0128538 Ga0495671_0128538_177_896 208
521 3300046794 Ga0495589_0215668 Ga0495589_0215668_101_817 208
522 3300046809 Ga0495600_0062163 Ga0495600_0062163_135_851 208
523 3300047315 Ga0495581_0323155 Ga0495581_0323155_126_848 208
524 3300047444 Ga0495675_0139192 Ga0495675_0139192_281_997 208
525 3300048088 Ga0495602_0105433 Ga0495602_0105433_1280_1996 208
526 3300048910 Ga0496107_0047226 Ga0496107_0047226_566_1294 208
527 3300048910 Ga0496107_0433424 Ga0496107_0433424_166_882 208
528 3300048918 Ga0496115_0277936 Ga0496115_0277936_330_1046 208
529 3300048924 Ga0496121_0050256 Ga0496121_0050256_2099_2824 208
530 3300049460 Ga0495682_0002577 Ga0495682_0002577_5453_6169 208
531 3300049569 Ga0501032_0066193 Ga0501032_0066193_1590_2306 208
532 3300049569 Ga0501032_0090270 Ga0501032_0090270_1176_1934 208
533 3300049569 Ga0501032_0408574 Ga0501032_0408574_59_820 208
534 3300049570 Ga0501033_0013154 Ga0501033_0013154_3496_4254 208
535 3300049570 Ga0501033_0027909 Ga0501033_0027909_502_1233 208
536 3300049571 Ga0501034_0036875 Ga0501034_0036875_2063_2788 208
537 3300049571 Ga0501034_0038869 Ga0501034_0038869_10_726 208
538 3300049571 Ga0501034_0040638 Ga0501034_0040638_3431_4147 208
539 3300049571 Ga0501034_0226337 Ga0501034_0226337_1019_1735 208
540 3300049571 Ga0501034_0329710 Ga0501034_0329710_698_1429 208
541 3300049572 Ga0501036_0103872 Ga0501036_0103872_1057_1773 208
542 3300049572 Ga0501036_0139796 Ga0501036_0139796_969_1727 208
543 3300049573 Ga0501037_0030060 Ga0501037_0030060_3195_3953 208
544 3300049573 Ga0501037_0409381 Ga0501037_0409381_156_914 208
545 3300049574 Ga0501038_0035407 Ga0501038_0035407_873_1631 208
546 3300049574 Ga0501038_0210383 Ga0501038_0210383_705_1466 208
547 3300049579 Ga0501043_0161192 Ga0501043_0161192_504_1262 208
548 3300049579 Ga0501043_0180416 Ga0501043_0180416_450_1169 208
549 3300049580 Ga0501046_0002062 Ga0501046_0002062_1487_2206 208
550 3300049580 Ga0501046_0281438 Ga0501046_0281438_476_1192 208
551 3300049581 Ga0501047_0021289 Ga0501047_0021289_3960_4676 208
552 3300049581 Ga0501047_0023641 Ga0501047_0023641_3726_4442 208
553 3300049581 Ga0501047_0045279 Ga0501047_0045279_808_1554 208
554 3300049581 Ga0501047_0047802 Ga0501047_0047802_2214_2930 208
555 3300049581 Ga0501047_0089770 Ga0501047_0089770_575_1306 208
556 3300049581 Ga0501047_0090675 Ga0501047_0090675_1488_2249 208
557 3300049581 Ga0501047_0281373 Ga0501047_0281373_268_1005 208
558 3300049581 Ga0501047_0345584 Ga0501047_0345584_375_1106 208
559 3300049581 Ga0501047_0446343 Ga0501047_0446343_28_765 208
560 3300049581 Ga0501047_0474908 Ga0501047_0474908_103_840 208
561 3300049582 Ga0501048_0313155 Ga0501048_0313155_180_899 208
562 3300049583 Ga0501067_0013966 Ga0501067_0013966_1235_1951 208
563 3300049583 Ga0501067_0041239 Ga0501067_0041239_712_1428 208
564 3300049585 Ga0501069_0043540 Ga0501069_0043540_1665_2423 208
565 3300049586 Ga0501070_0000031 Ga0501070_0000031_122213_122971 208
566 3300049586 Ga0501070_0007183 Ga0501070_0007183_5356_6072 208
567 3300049588 Ga0501072_0040560 Ga0501072_0040560_1621_2337 208
568 3300049589 Ga0501073_0019003 Ga0501073_0019003_2007_2723 208
569 3300049589 Ga0501073_0133686 Ga0501073_0133686_983_1702 208
570 3300049589 Ga0501073_0261816 Ga0501073_0261816_230_961 208
571 3300049590 Ga0501074_0077256 Ga0501074_0077256_1137_1853 208
572 3300049741 Ga0501079_0026535 Ga0501079_0026535_1465_2181 208
573 3300049742 Ga0501080_0004780 Ga0501080_0004780_5584_6321 208
574 3300049742 Ga0501080_0005230 Ga0501080_0005230_5228_5986 208
575 3300049742 Ga0501080_0023461 Ga0501080_0023461_1158_1874 208
576 3300049742 Ga0501080_0107239 Ga0501080_0107239_1847_2566 208
577 3300049742 Ga0501080_0153321 Ga0501080_0153321_1084_1830 208
578 3300049744 Ga0501083_0056414 Ga0501083_0056414_711_1427 208
579 3300049822 Ga0501035_0000593 Ga0501035_0000593_38450_39208 208
580 3300049822 Ga0501035_0039200 Ga0501035_0039200_838_1584 208
581 3300049822 Ga0501035_0084505 Ga0501035_0084505_946_1707 208
582 3300049822 Ga0501035_0092111 Ga0501035_0092111_1200_1916 208
583 3300049822 Ga0501035_0277493 Ga0501035_0277493_542_1303 208
584 3300049822 Ga0501035_0402665 Ga0501035_0402665_316_1047 208
585 3300049823 Ga0501044_0006216 Ga0501044_0006216_6644_7360 208
586 3300049823 Ga0501044_0013488 Ga0501044_0013488_7218_7934 208
587 3300049823 Ga0501044_0015989 Ga0501044_0015989_6641_7399 208
588 3300049823 Ga0501044_0017846 Ga0501044_0017846_1284_2042 208
589 3300049823 Ga0501044_0018107 Ga0501044_0018107_3314_4060 208
590 3300049823 Ga0501044_0018950 Ga0501044_0018950_74_832 208
591 3300049823 Ga0501044_0051119 Ga0501044_0051119_1686_2417 208
592 3300049823 Ga0501044_0069415 Ga0501044_0069415_2852_3571 208
593 3300049823 Ga0501044_0111989 Ga0501044_0111989_1493_2251 208
594 3300049823 Ga0501044_0190277 Ga0501044_0190277_230_946 208
595 3300050512 nmdc:mga0n895_276223_c1 nmdc:mga0n895_276223_c1_105_836 208
596 3300050514 nmdc:mga08x19_1603_c1 nmdc:mga08x19_1603_c1_4364_5092 208
597 3300050514 nmdc:mga08x19_31641_c1 nmdc:mga08x19_31641_c1_765_1493 208
598 3300053080 Ga0500635_0008892 Ga0500635_0008892_1894_2613 208
599 3300053103 Ga0500555_010279 Ga0500555_010279_838_1599 208
600 3300053119 Ga0500595_001100 Ga0500595_001100_9129_9845 208
601 3300053119 Ga0500595_026733 Ga0500595_026733_1078_1794 208
602 3300053119 Ga0500595_034452 Ga0500595_034452_837_1577 208
603 3300053136 Ga0500559_0027171 Ga0500559_0027171_308_1024 208
604 3300053154 Ga0500619_084991 Ga0500619_084991_86_823 208
605 3300054114 Ga0501084_0000472 Ga0501084_0000472_5008_5745 208
606 3300054114 Ga0501084_0008411 Ga0501084_0008411_6986_7702 208
607 3300054114 Ga0501084_0212278 Ga0501084_0212278_74_790 208
608 3300060353 Ga0501082_0163186 Ga0501082_0163186_1092_1808 208
609 3300060353 Ga0501082_0278133 Ga0501082_0278133_201_917 208

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01895

PhoU

PhoU domain

33

121

0.98

PF01895

PhoU

PhoU domain

136

221

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2bkp-assembly1.cif.gz_A structure analysis of unknown function protein 0.838 85 188
8fih-assembly1.cif.gz_C multi-state design of two-state switchable hinge proteins 0.721 88 182
8fih-assembly1.cif.gz_C multi-state design of two-state switchable hinge proteins 0.6617 88 182
4q25-assembly1.cif.gz_B crystal structure of phou from pseudomonas aeruginosa 0.5363 9 184
1sum-assembly1.cif.gz_B crystal structure of a hypothetical protein at 2.0 a resolution 0.5183 7 184
ID Description Score Start End Superfamily
4q25A02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.9684 91 184 1.20.58.220
af_Q58415_114_232_1.20.58.220 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.9619 91 187 1.20.58.220
4q25B02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.9532 91 184 1.20.58.220
1t8bB02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.948 92 181 1.20.58.220
4q25A02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.9208 91 184 1.20.58.220
ID Description Score Start End GO Terms
AF-A0A7Y2EBL4-F1-model_v4 PhoU domain-containing protein 0.9632 98 184 GO:0030643
GO:0045936
AF-A0A645IP07-F1-model_v4 Phosphate-specific transport system accessory protein PhoU 0.9543 97 186 GO:0030643
GO:0045936
AF-A0A496K1F6-F1-model_v4 deleted 0.9534 89 181
AF-A0A2V9ZAU9-F1-model_v4 Phosphate transport system regulatory protein PhoU 0.9462 93 184 GO:0030643
GO:0045936
AF-A0A833ATC7-F1-model_v4 Phosphate transport system regulatory protein PhoU 0.946 94 188 GO:0030643
GO:0045936

Feature Viewer

pLDDT pTM Quality
82.38 0.54 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map