F468813
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 608 | 246 | 1216 | 116 |
Family's Representative Sequence
| Representative Sequence | 3300046476|Ga0495662_0056545|Ga0495662_0056545_21_401 |
| Length | 126 |
| Sequence | LVRRPGQDSNRVITVEVRDLRVFGHHGVHEEERERGQDFVFDVELEVGERGTSDRLEDAVDYVEVARAVQEVSDARQYALLEALASAIADELERRFSPDGVRVRVRKPEVRPAGLEGTVAATVTRP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 30 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 31 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 32 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 33 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 34 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 35 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 36 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 37 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 42 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 43 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 44 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 46 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 61 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 65 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 66 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 67 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 68 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 69 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 70 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 100 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 101 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 102 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 103 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 104 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 105 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 106 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 107 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 108 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 109 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 110 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 111 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 112 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 113 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 114 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 115 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 116 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 117 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 118 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 119 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 120 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 121 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 122 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 123 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 124 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 125 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 126 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 127 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 128 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 129 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 130 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 131 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 132 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 133 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 134 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 135 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 136 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 137 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 138 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 139 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 140 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 141 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 142 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 199 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 200 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 201 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 202 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 203 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 204 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 205 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 206 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 208 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 209 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 210 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 211 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 212 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 213 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 214 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 244 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.34 |
| Metatranscriptomes | 0.66 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.16 |
| Nodule | 0 |
| Rhizoplane | 10.2 |
| Rhizosphere | 89.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.74 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495662_0056545 | 3300046476 | Bacteria | 1895 |
| 2 | Ga0070658_10226672 | 3300005327 | Bacteria | 1581 |
| 3 | Ga0070683_100185937 | 3300005329 | Bacteria | 1972 |
| 4 | Ga0070680_100036657 | 3300005336 | Bacteria | 3962 |
| 5 | Ga0070680_100255729 | 3300005336 | Bacteria | 1481 |
| 6 | Ga0070682_100016719 | 3300005337 | Bacteria | 4269 |
| 7 | Ga0070682_100293235 | 3300005337 | Bacteria | 1190 |
| 8 | Ga0070660_100706503 | 3300005339 | Bacteria | 845 |
| 9 | Ga0070691_10110509 | 3300005341 | Bacteria | 1374 |
| 10 | Ga0070661_100592527 | 3300005344 | Bacteria | 895 |
| 11 | Ga0070661_101136510 | 3300005344 | Unclassified | 652 |
| 12 | Ga0070671_100543125 | 3300005355 | Bacteria | 1002 |
| 13 | Ga0070659_100088836 | 3300005366 | Bacteria | 2475 |
| 14 | Ga0070709_10171480 | 3300005434 | Bacteria | 1516 |
| 15 | Ga0070714_100015594 | 3300005435 | Bacteria | 6113 |
| 16 | Ga0070714_100022753 | 3300005435 | Bacteria | 5142 |
| 17 | Ga0070714_100028829 | 3300005435 | Bacteria | 4609 |
| 18 | Ga0070714_100100341 | 3300005435 | Bacteria | 2549 |
| 19 | Ga0070714_100322597 | 3300005435 | Bacteria | 1445 |
| 20 | Ga0070714_100324977 | 3300005435 | Bacteria | 1439 |
| 21 | Ga0070714_100398499 | 3300005435 | Bacteria | 1300 |
| 22 | Ga0070714_100870916 | 3300005435 | Bacteria | 874 |
| 23 | Ga0070714_100997405 | 3300005435 | Bacteria | 815 |
| 24 | Ga0070713_100284681 | 3300005436 | Bacteria | 1517 |
| 25 | Ga0070713_100483460 | 3300005436 | Bacteria | 1167 |
| 26 | Ga0070710_10009907 | 3300005437 | Bacteria | 4671 |
| 27 | Ga0070710_10033394 | 3300005437 | Bacteria | 2794 |
| 28 | Ga0070710_10444311 | 3300005437 | Bacteria | 878 |
| 29 | Ga0070710_10764645 | 3300005437 | Bacteria | 687 |
| 30 | Ga0070711_100055015 | 3300005439 | Bacteria | 2747 |
| 31 | Ga0070711_100629628 | 3300005439 | Bacteria | 897 |
| 32 | Ga0070711_101599438 | 3300005439 | Bacteria | 570 |
| 33 | Ga0070694_100132187 | 3300005444 | Bacteria | 1804 |
| 34 | Ga0070708_100697233 | 3300005445 | Bacteria | 956 |
| 35 | Ga0070678_102031008 | 3300005456 | Unclassified | 544 |
| 36 | Ga0070681_10030451 | 3300005458 | Bacteria | 5414 |
| 37 | Ga0070681_10046021 | 3300005458 | Bacteria | 4363 |
| 38 | Ga0070681_10163151 | 3300005458 | Bacteria | 2152 |
| 39 | Ga0070707_100001944 | 3300005468 | Bacteria | 19823 |
| 40 | Ga0070698_100000947 | 3300005471 | Bacteria | 31720 |
| 41 | Ga0070698_100251231 | 3300005471 | Bacteria | 1701 |
| 42 | Ga0070699_100034369 | 3300005518 | Bacteria | 4382 |
| 43 | Ga0070679_100050974 | 3300005530 | Bacteria | 4123 |
| 44 | Ga0070684_100036290 | 3300005535 | Bacteria | 4224 |
| 45 | Ga0070684_100744828 | 3300005535 | Bacteria | 914 |
| 46 | Ga0070684_100874339 | 3300005535 | Bacteria | 842 |
| 47 | Ga0070695_100001116 | 3300005545 | Bacteria | 14717 |
| 48 | Ga0070695_101874581 | 3300005545 | Bacteria | 504 |
| 49 | Ga0070696_100410804 | 3300005546 | Bacteria | 1061 |
| 50 | Ga0070696_101302429 | 3300005546 | Bacteria | 617 |
| 51 | Ga0070693_100421879 | 3300005547 | Unclassified | 930 |
| 52 | Ga0070693_100631168 | 3300005547 | Unclassified | 777 |
| 53 | Ga0068855_100067410 | 3300005563 | Bacteria | 4169 |
| 54 | Ga0068855_100722040 | 3300005563 | Bacteria | 1065 |
| 55 | Ga0068855_101152400 | 3300005563 | Unclassified | 808 |
| 56 | Ga0068855_101853275 | 3300005563 | Unclassified | 612 |
| 57 | Ga0068856_100056227 | 3300005614 | Bacteria | 3882 |
| 58 | Ga0068856_101622575 | 3300005614 | Bacteria | 660 |
| 59 | Ga0068856_102333906 | 3300005614 | Unclassified | 543 |
| 60 | Ga0068852_100438085 | 3300005616 | Unclassified | 1292 |
| 61 | Ga0068859_100811175 | 3300005617 | Bacteria | 1023 |
| 62 | Ga0068864_100510811 | 3300005618 | Bacteria | 1157 |
| 63 | Ga0068851_10222354 | 3300005834 | Bacteria | 1061 |
| 64 | Ga0068863_100346938 | 3300005841 | Bacteria | 1445 |
| 65 | Ga0081455_10125453 | 3300005937 | Bacteria | 2015 |
| 66 | Ga0081539_10095573 | 3300005985 | Bacteria | 1526 |
| 67 | Ga0070717_10009944 | 3300006028 | Bacteria | 7158 |
| 68 | Ga0070717_10012990 | 3300006028 | Bacteria | 6361 |
| 69 | Ga0070717_10231332 | 3300006028 | Bacteria | 1628 |
| 70 | Ga0070717_10256137 | 3300006028 | Bacteria | 1547 |
| 71 | Ga0070717_10609555 | 3300006028 | Bacteria | 990 |
| 72 | Ga0070717_11331049 | 3300006028 | Unclassified | 653 |
| 73 | Ga0070715_10001064 | 3300006163 | Bacteria | 7781 |
| 74 | Ga0070715_10941165 | 3300006163 | Bacteria | 534 |
| 75 | Ga0070716_100017223 | 3300006173 | Bacteria | 3742 |
| 76 | Ga0070712_100278646 | 3300006175 | Bacteria | 1346 |
| 77 | Ga0070712_100639832 | 3300006175 | Bacteria | 903 |
| 78 | Ga0068871_101201857 | 3300006358 | Bacteria | 711 |
| 79 | Ga0075431_100779720 | 3300006847 | Unclassified | 930 |
| 80 | Ga0075434_100035225 | 3300006871 | Bacteria | 4947 |
| 81 | Ga0097620_100811263 | 3300006931 | Bacteria | 1023 |
| 82 | Ga0075435_100247832 | 3300007076 | Bacteria | 1516 |
| 83 | Ga0075435_100941170 | 3300007076 | Bacteria | 754 |
| 84 | Ga0105240_10042640 | 3300009093 | Bacteria | 5781 |
| 85 | Ga0105240_11390498 | 3300009093 | Unclassified | 738 |
| 86 | Ga0111539_10071104 | 3300009094 | Bacteria | 4106 |
| 87 | Ga0105245_10262572 | 3300009098 | Bacteria | 1681 |
| 88 | Ga0105245_10391009 | 3300009098 | Bacteria | 1387 |
| 89 | Ga0114129_11569476 | 3300009147 | Bacteria | 807 |
| 90 | Ga0105242_10641353 | 3300009176 | Bacteria | 1032 |
| 91 | Ga0105242_11343616 | 3300009176 | Bacteria | 740 |
| 92 | Ga0105237_10085979 | 3300009545 | Bacteria | 3135 |
| 93 | Ga0105237_10985714 | 3300009545 | Bacteria | 850 |
| 94 | Ga0105238_10291918 | 3300009551 | Bacteria | 1613 |
| 95 | Ga0105238_11886329 | 3300009551 | Bacteria | 630 |
| 96 | Ga0105249_12526965 | 3300009553 | Bacteria | 586 |
| 97 | Ga0157370_10514841 | 3300013104 | Bacteria | 1098 |
| 98 | Ga0157369_10051784 | 3300013105 | Bacteria | 4442 |
| 99 | Ga0157369_10332569 | 3300013105 | Bacteria | 1578 |
| 100 | Ga0157369_11929223 | 3300013105 | Bacteria | 599 |
| 101 | Ga0157374_10069633 | 3300013296 | Bacteria | 3313 |
| 102 | Ga0157374_10506761 | 3300013296 | Bacteria | 1212 |
| 103 | Ga0163162_10288659 | 3300013306 | Bacteria | 1772 |
| 104 | Ga0157372_10030767 | 3300013307 | Bacteria | 5874 |
| 105 | Ga0157372_10074121 | 3300013307 | Bacteria | 3837 |
| 106 | Ga0157372_10966989 | 3300013307 | Bacteria | 987 |
| 107 | Ga0157375_10153417 | 3300013308 | Bacteria | 2440 |
| 108 | Ga0182008_10002224 | 3300014497 | Bacteria | 12297 |
| 109 | Ga0182008_10149810 | 3300014497 | Bacteria | 1170 |
| 110 | Ga0182008_10545916 | 3300014497 | Bacteria | 643 |
| 111 | Ga0157377_10597982 | 3300014745 | Bacteria | 786 |
| 112 | Ga0157379_10433356 | 3300014968 | Bacteria | 1212 |
| 113 | Ga0157376_10025246 | 3300014969 | Bacteria | 4679 |
| 114 | Ga0182006_1256910 | 3300015261 | Bacteria | 573 |
| 115 | Ga0182007_10018676 | 3300015262 | Bacteria | 2508 |
| 116 | Ga0197907_11288412 | 3300020069 | Unclassified | 688 |
| 117 | Ga0206356_10915091 | 3300020070 | Bacteria | 1327 |
| 118 | Ga0206356_11446283 | 3300020070 | Unclassified | 644 |
| 119 | Ga0206354_11252769 | 3300020081 | Bacteria | 2541 |
| 120 | Ga0213871_10151520 | 3300021441 | Bacteria | 706 |
| 121 | Ga0207692_10007527 | 3300025898 | Bacteria | 4463 |
| 122 | Ga0207692_10037938 | 3300025898 | Bacteria | 2360 |
| 123 | Ga0207692_10980299 | 3300025898 | Bacteria | 558 |
| 124 | Ga0207685_10711936 | 3300025905 | Bacteria | 547 |
| 125 | Ga0207699_10210444 | 3300025906 | Bacteria | 1322 |
| 126 | Ga0207699_10838066 | 3300025906 | Unclassified | 677 |
| 127 | Ga0207699_11247887 | 3300025906 | Bacteria | 550 |
| 128 | Ga0207684_10484474 | 3300025910 | Bacteria | 1061 |
| 129 | Ga0207707_10040068 | 3300025912 | Bacteria | 4093 |
| 130 | Ga0207707_10105817 | 3300025912 | Bacteria | 2459 |
| 131 | Ga0207707_10182237 | 3300025912 | Bacteria | 1833 |
| 132 | Ga0207695_10163718 | 3300025913 | Bacteria | 2154 |
| 133 | Ga0207695_10332811 | 3300025913 | Unclassified | 1407 |
| 134 | Ga0207671_10076949 | 3300025914 | Bacteria | 2497 |
| 135 | Ga0207671_10354805 | 3300025914 | Bacteria | 1163 |
| 136 | Ga0207693_10005483 | 3300025915 | Bacteria | 10577 |
| 137 | Ga0207693_10012161 | 3300025915 | Bacteria | 6953 |
| 138 | Ga0207693_10389610 | 3300025915 | Bacteria | 1089 |
| 139 | Ga0207663_10014250 | 3300025916 | Bacteria | 4346 |
| 140 | Ga0207663_10122812 | 3300025916 | Bacteria | 1781 |
| 141 | Ga0207663_10287221 | 3300025916 | Bacteria | 1224 |
| 142 | Ga0207660_10414620 | 3300025917 | Bacteria | 1086 |
| 143 | Ga0207657_10004793 | 3300025919 | Bacteria | 14276 |
| 144 | Ga0207649_10053418 | 3300025920 | Bacteria | 2511 |
| 145 | Ga0207652_10225823 | 3300025921 | Bacteria | 1687 |
| 146 | Ga0207646_10007075 | 3300025922 | Bacteria | 11476 |
| 147 | Ga0207646_10065462 | 3300025922 | Bacteria | 3245 |
| 148 | Ga0207694_10306703 | 3300025924 | Bacteria | 1308 |
| 149 | Ga0207687_11032372 | 3300025927 | Bacteria | 705 |
| 150 | Ga0207700_10083519 | 3300025928 | Bacteria | 2500 |
| 151 | Ga0207700_10671565 | 3300025928 | Bacteria | 924 |
| 152 | Ga0207700_11243047 | 3300025928 | Bacteria | 664 |
| 153 | Ga0207664_10014835 | 3300025929 | Bacteria | 5641 |
| 154 | Ga0207664_10090418 | 3300025929 | Bacteria | 2508 |
| 155 | Ga0207664_10264110 | 3300025929 | Bacteria | 1506 |
| 156 | Ga0207664_10390043 | 3300025929 | Bacteria | 1237 |
| 157 | Ga0207664_10749430 | 3300025929 | Bacteria | 878 |
| 158 | Ga0207664_11121681 | 3300025929 | Bacteria | 703 |
| 159 | Ga0207664_11224389 | 3300025929 | Bacteria | 669 |
| 160 | Ga0207690_11220336 | 3300025932 | Unclassified | 628 |
| 161 | Ga0207665_10007853 | 3300025939 | Bacteria | 7046 |
| 162 | Ga0207665_10563669 | 3300025939 | Bacteria | 886 |
| 163 | Ga0207661_10037822 | 3300025944 | Bacteria | 3777 |
| 164 | Ga0207661_10394190 | 3300025944 | Bacteria | 1255 |
| 165 | Ga0207679_10959841 | 3300025945 | Unclassified | 783 |
| 166 | Ga0207667_11273834 | 3300025949 | Unclassified | 712 |
| 167 | Ga0207667_11301535 | 3300025949 | Unclassified | 703 |
| 168 | Ga0207677_10375843 | 3300026023 | Bacteria | 1198 |
| 169 | Ga0207702_10347516 | 3300026078 | Bacteria | 1418 |
| 170 | Ga0207702_11177355 | 3300026078 | Bacteria | 761 |
| 171 | Ga0207702_11939172 | 3300026078 | Unclassified | 580 |
| 172 | Ga0207641_10153875 | 3300026088 | Bacteria | 2085 |
| 173 | Ga0207674_10535831 | 3300026116 | Bacteria | 1131 |
| 174 | Ga0207683_10244141 | 3300026121 | Bacteria | 1638 |
| 175 | Ga0207683_11421484 | 3300026121 | Unclassified | 641 |
| 176 | Ga0207698_10287296 | 3300026142 | Bacteria | 1524 |
| 177 | Ga0207698_11482150 | 3300026142 | Unclassified | 694 |
| 178 | Ga0265338_10005798 | 3300028800 | Bacteria | 15945 |
| 179 | Ga0265338_10011492 | 3300028800 | Bacteria | 10221 |
| 180 | Ga0265324_10038788 | 3300029957 | Bacteria | 1652 |
| 181 | Ga0307405_10369386 | 3300031731 | Bacteria | 1113 |
| 182 | Ga0307406_10222133 | 3300031901 | Bacteria | 1405 |
| 183 | Ga0307409_100180481 | 3300031995 | Bacteria | 1868 |
| 184 | Ga0307416_100332877 | 3300032002 | Bacteria | 1527 |
| 185 | Ga0307414_10071615 | 3300032004 | Bacteria | 2501 |
| 186 | Ga0373926_0003671 | 3300035083 | Bacteria | 4988 |
| 187 | Ga0373944_0120612 | 3300035089 | Bacteria | 903 |
| 188 | Ga0373932_0352663 | 3300035112 | Bacteria | 560 |
| 189 | Ga0373945_0060642 | 3300035116 | Bacteria | 1411 |
| 190 | Ga0373953_0420775 | 3300035117 | Bacteria | 589 |
| 191 | Ga0373960_0156556 | 3300035121 | Bacteria | 782 |
| 192 | Ga0373943_0001785 | 3300035170 | Bacteria | 9742 |
| 193 | Ga0373943_0199575 | 3300035170 | Bacteria | 1107 |
| 194 | Ga0373946_0111823 | 3300035171 | Bacteria | 1237 |
| 195 | Ga0373955_0199163 | 3300035172 | Bacteria | 1192 |
| 196 | Ga0373955_0514905 | 3300035172 | Bacteria | 731 |
| 197 | Ga0373955_0817084 | 3300035172 | Bacteria | 573 |
| 198 | Ga0373924_0037414 | 3300035410 | Bacteria | 1976 |
| 199 | Ga0373924_0492786 | 3300035410 | Bacteria | 550 |
| 200 | Ga0373931_0024447 | 3300035691 | Bacteria | 3061 |
| 201 | Ga0373931_1115250 | 3300035691 | Bacteria | 538 |
| 202 | Ga0373935_0081553 | 3300035692 | Bacteria | 2103 |
| 203 | Ga0373935_0566979 | 3300035692 | Bacteria | 828 |
| 204 | Ga0373935_1287037 | 3300035692 | Bacteria | 546 |
| 205 | Ga0373927_0049069 | 3300035695 | Bacteria | 2730 |
| 206 | Ga0373933_0101264 | 3300035724 | Bacteria | 1788 |
| 207 | Ga0373947_0099155 | 3300035725 | Bacteria | 1828 |
| 208 | Ga0373947_0339964 | 3300035725 | Bacteria | 1006 |
| 209 | Ga0373947_0741350 | 3300035725 | Bacteria | 670 |
| 210 | Ga0373937_0004317 | 3300036401 | Bacteria | 12058 |
| 211 | Ga0373937_0269640 | 3300036401 | Bacteria | 1606 |
| 212 | Ga0373937_0619115 | 3300036401 | Bacteria | 1027 |
| 213 | Ga0373937_0682670 | 3300036401 | Bacteria | 973 |
| 214 | Ga0373925_0460915 | 3300037068 | Bacteria | 1041 |
| 215 | Ga0395899_0533583 | 3300037312 | Bacteria | 757 |
| 216 | Ga0395899_1007592 | 3300037312 | Bacteria | 502 |
| 217 | Ga0395900_0924403 | 3300037418 | Bacteria | 795 |
| 218 | Ga0395900_1088475 | 3300037418 | Unclassified | 717 |
| 219 | Ga0395900_1091653 | 3300037418 | Bacteria | 715 |
| 220 | Ga0395900_1273945 | 3300037418 | Unclassified | 649 |
| 221 | Ga0436365_0353990 | 3300039437 | Unclassified | 799 |
| 222 | Ga0436360_1371984 | 3300039438 | Bacteria | 9885 |
| 223 | Ga0439458_0032806 | 3300042157 | Bacteria | 1243 |
| 224 | Ga0466969_0000408 | 3300044656 | Bacteria | 23689 |
| 225 | Ga0466969_0400188 | 3300044656 | Bacteria | 623 |
| 226 | Ga0466965_0018886 | 3300044683 | Bacteria | 3308 |
| 227 | Ga0466965_0035959 | 3300044683 | Bacteria | 2428 |
| 228 | Ga0466965_0591162 | 3300044683 | Bacteria | 630 |
| 229 | Ga0466966_0004699 | 3300044684 | Bacteria | 8986 |
| 230 | Ga0466966_0082311 | 3300044684 | Bacteria | 2003 |
| 231 | Ga0466966_0444275 | 3300044684 | Bacteria | 779 |
| 232 | Ga0466961_0010507 | 3300044693 | Bacteria | 5906 |
| 233 | Ga0466961_0011429 | 3300044693 | Bacteria | 5678 |
| 234 | Ga0466961_0019503 | 3300044693 | Bacteria | 4361 |
| 235 | Ga0466961_0025516 | 3300044693 | Bacteria | 3801 |
| 236 | Ga0466961_0154836 | 3300044693 | Bacteria | 1430 |
| 237 | Ga0466961_0338941 | 3300044693 | Bacteria | 916 |
| 238 | Ga0466961_0361537 | 3300044693 | Bacteria | 883 |
| 239 | Ga0466961_0422047 | 3300044693 | Bacteria | 808 |
| 240 | Ga0466963_0000851 | 3300044694 | Bacteria | 15387 |
| 241 | Ga0466963_0004118 | 3300044694 | Bacteria | 8411 |
| 242 | Ga0466963_0008142 | 3300044694 | Bacteria | 6277 |
| 243 | Ga0466963_0014050 | 3300044694 | Bacteria | 4932 |
| 244 | Ga0466963_0016027 | 3300044694 | Bacteria | 4653 |
| 245 | Ga0466963_0018129 | 3300044694 | Bacteria | 4396 |
| 246 | Ga0466963_0025420 | 3300044694 | Bacteria | 3776 |
| 247 | Ga0466963_0038028 | 3300044694 | Bacteria | 3145 |
| 248 | Ga0466963_0040773 | 3300044694 | Bacteria | 3043 |
| 249 | Ga0466963_0041044 | 3300044694 | Bacteria | 3033 |
| 250 | Ga0466963_0057717 | 3300044694 | Bacteria | 2585 |
| 251 | Ga0466963_0115947 | 3300044694 | Bacteria | 1841 |
| 252 | Ga0466963_0139502 | 3300044694 | Bacteria | 1679 |
| 253 | Ga0466963_0139697 | 3300044694 | Bacteria | 1677 |
| 254 | Ga0466963_0251004 | 3300044694 | Bacteria | 1241 |
| 255 | Ga0466963_0424624 | 3300044694 | Bacteria | 937 |
| 256 | Ga0466963_0695694 | 3300044694 | Bacteria | 717 |
| 257 | Ga0466964_0001364 | 3300044706 | Bacteria | 8336 |
| 258 | Ga0466964_0002900 | 3300044706 | Bacteria | 6192 |
| 259 | Ga0466964_0003348 | 3300044706 | Bacteria | 5841 |
| 260 | Ga0466964_0047415 | 3300044706 | Bacteria | 1754 |
| 261 | Ga0466964_0052347 | 3300044706 | Bacteria | 1678 |
| 262 | Ga0466964_0059058 | 3300044706 | Unclassified | 1592 |
| 263 | Ga0466964_0114207 | 3300044706 | Bacteria | 1208 |
| 264 | Ga0466964_0131060 | 3300044706 | Bacteria | 1142 |
| 265 | Ga0466964_0158666 | 3300044706 | Bacteria | 1055 |
| 266 | Ga0466964_0176119 | 3300044706 | Bacteria | 1011 |
| 267 | Ga0466964_0185558 | 3300044706 | Bacteria | 989 |
| 268 | Ga0466964_0480614 | 3300044706 | Bacteria | 664 |
| 269 | Ga0466964_0838769 | 3300044706 | Bacteria | 522 |
| 270 | Ga0466971_0002948 | 3300044719 | Bacteria | 7221 |
| 271 | Ga0466971_0004955 | 3300044719 | Bacteria | 5757 |
| 272 | Ga0466971_0005803 | 3300044719 | Bacteria | 5372 |
| 273 | Ga0466971_0095726 | 3300044719 | Bacteria | 1361 |
| 274 | Ga0466971_0172425 | 3300044719 | Bacteria | 1015 |
| 275 | Ga0466968_0017149 | 3300044735 | Bacteria | 2891 |
| 276 | Ga0466968_0024090 | 3300044735 | Bacteria | 2485 |
| 277 | Ga0466968_0029739 | 3300044735 | Bacteria | 2260 |
| 278 | Ga0466968_0065002 | 3300044735 | Bacteria | 1579 |
| 279 | Ga0466968_0078112 | 3300044735 | Bacteria | 1450 |
| 280 | Ga0466968_0127959 | 3300044735 | Bacteria | 1154 |
| 281 | Ga0466968_0147578 | 3300044735 | Bacteria | 1079 |
| 282 | Ga0466968_0161258 | 3300044735 | Bacteria | 1035 |
| 283 | Ga0466968_0526989 | 3300044735 | Bacteria | 591 |
| 284 | Ga0466970_0004734 | 3300044765 | Bacteria | 6722 |
| 285 | Ga0466970_0066840 | 3300044765 | Bacteria | 1930 |
| 286 | Ga0466970_0170812 | 3300044765 | Bacteria | 1205 |
| 287 | Ga0466970_0315877 | 3300044765 | Bacteria | 883 |
| 288 | Ga0466970_0483555 | 3300044765 | Bacteria | 712 |
| 289 | Ga0466957_0002697 | 3300044842 | Bacteria | 9597 |
| 290 | Ga0466957_0008604 | 3300044842 | Bacteria | 5808 |
| 291 | Ga0466957_0011045 | 3300044842 | Bacteria | 5196 |
| 292 | Ga0466957_0027087 | 3300044842 | Bacteria | 3404 |
| 293 | Ga0466957_0034668 | 3300044842 | Bacteria | 3027 |
| 294 | Ga0466957_0078128 | 3300044842 | Bacteria | 2057 |
| 295 | Ga0466957_0298737 | 3300044842 | Bacteria | 1081 |
| 296 | Ga0466957_0472738 | 3300044842 | Unclassified | 866 |
| 297 | Ga0466957_0599923 | 3300044842 | Bacteria | 771 |
| 298 | Ga0466960_0009082 | 3300044901 | Bacteria | 4088 |
| 299 | Ga0466960_0149314 | 3300044901 | Bacteria | 1247 |
| 300 | Ga0466960_0581558 | 3300044901 | Unclassified | 663 |
| 301 | Ga0466959_0007658 | 3300045049 | Bacteria | 7591 |
| 302 | Ga0466959_0046544 | 3300045049 | Bacteria | 3191 |
| 303 | Ga0466959_0124040 | 3300045049 | Bacteria | 1834 |
| 304 | Ga0466959_0172259 | 3300045049 | Unclassified | 1518 |
| 305 | Ga0466959_0175581 | 3300045049 | Bacteria | 1501 |
| 306 | Ga0466959_0211680 | 3300045049 | Bacteria | 1347 |
| 307 | Ga0466958_0001637 | 3300045836 | Bacteria | 10783 |
| 308 | Ga0466958_0003114 | 3300045836 | Bacteria | 8523 |
| 309 | Ga0466958_0018707 | 3300045836 | Bacteria | 4025 |
| 310 | Ga0466958_0024203 | 3300045836 | Bacteria | 3572 |
| 311 | Ga0466958_0047713 | 3300045836 | Bacteria | 2585 |
| 312 | Ga0466958_0061114 | 3300045836 | Bacteria | 2294 |
| 313 | Ga0466958_0121689 | 3300045836 | Bacteria | 1634 |
| 314 | Ga0466958_0138857 | 3300045836 | Bacteria | 1529 |
| 315 | Ga0466958_0181826 | 3300045836 | Bacteria | 1334 |
| 316 | Ga0466958_0300395 | 3300045836 | Bacteria | 1031 |
| 317 | Ga0466958_0332851 | 3300045836 | Bacteria | 976 |
| 318 | Ga0466958_0629749 | 3300045836 | Bacteria | 698 |
| 319 | Ga0466958_0902436 | 3300045836 | Bacteria | 576 |
| 320 | Ga0466958_1043815 | 3300045836 | Unclassified | 533 |
| 321 | Ga0466967_0000857 | 3300045976 | Bacteria | 16157 |
| 322 | Ga0466967_0003101 | 3300045976 | Bacteria | 10687 |
| 323 | Ga0466967_0007502 | 3300045976 | Bacteria | 7875 |
| 324 | Ga0466967_0015023 | 3300045976 | Bacteria | 6056 |
| 325 | Ga0466967_0019365 | 3300045976 | Bacteria | 5471 |
| 326 | Ga0466967_0032145 | 3300045976 | Bacteria | 4427 |
| 327 | Ga0466967_0033158 | 3300045976 | Bacteria | 4369 |
| 328 | Ga0466967_0034599 | 3300045976 | Bacteria | 4290 |
| 329 | Ga0466967_0054438 | 3300045976 | Bacteria | 3521 |
| 330 | Ga0466967_0069415 | 3300045976 | Bacteria | 3149 |
| 331 | Ga0466967_0069942 | 3300045976 | Bacteria | 3139 |
| 332 | Ga0466967_0111998 | 3300045976 | Bacteria | 2508 |
| 333 | Ga0466967_0112554 | 3300045976 | Bacteria | 2502 |
| 334 | Ga0466967_0119653 | 3300045976 | Bacteria | 2431 |
| 335 | Ga0466967_0148071 | 3300045976 | Bacteria | 2191 |
| 336 | Ga0466967_0168849 | 3300045976 | Bacteria | 2057 |
| 337 | Ga0466967_0226917 | 3300045976 | Bacteria | 1777 |
| 338 | Ga0466967_0227304 | 3300045976 | Bacteria | 1775 |
| 339 | Ga0466967_0238456 | 3300045976 | Bacteria | 1734 |
| 340 | Ga0466967_0238934 | 3300045976 | Bacteria | 1732 |
| 341 | Ga0466967_0286479 | 3300045976 | Bacteria | 1581 |
| 342 | Ga0466967_1529683 | 3300045976 | Bacteria | 664 |
| 343 | Ga0466967_2292557 | 3300045976 | Unclassified | 535 |
| 344 | Ga0466967_2350765 | 3300045976 | Unclassified | 528 |
| 345 | Ga0495617_265791 | 3300046452 | Bacteria | 527 |
| 346 | Ga0495592_0000048 | 3300046454 | Bacteria | 114599 |
| 347 | Ga0495592_0011699 | 3300046454 | Bacteria | 6647 |
| 348 | Ga0495592_0022364 | 3300046454 | Bacteria | 4811 |
| 349 | Ga0495592_0098006 | 3300046454 | Bacteria | 2093 |
| 350 | Ga0495603_0018778 | 3300046455 | Bacteria | 4185 |
| 351 | Ga0495603_0178725 | 3300046455 | Bacteria | 1228 |
| 352 | Ga0495603_0230141 | 3300046455 | Bacteria | 1069 |
| 353 | Ga0495629_0009637 | 3300046459 | Bacteria | 7054 |
| 354 | Ga0495629_0024290 | 3300046459 | Bacteria | 4315 |
| 355 | Ga0495629_0143717 | 3300046459 | Bacteria | 1659 |
| 356 | Ga0495629_0229901 | 3300046459 | Bacteria | 1278 |
| 357 | Ga0495629_0399979 | 3300046459 | Bacteria | 933 |
| 358 | Ga0495641_0001416 | 3300046461 | Bacteria | 20387 |
| 359 | Ga0495641_0050104 | 3300046461 | Bacteria | 1910 |
| 360 | Ga0495641_0404619 | 3300046461 | Bacteria | 619 |
| 361 | Ga0495651_0000049 | 3300046462 | Bacteria | 88249 |
| 362 | Ga0495651_0074588 | 3300046462 | Bacteria | 2573 |
| 363 | Ga0495651_0160038 | 3300046462 | Bacteria | 1614 |
| 364 | Ga0495651_0191519 | 3300046462 | Bacteria | 1439 |
| 365 | Ga0495653_0011777 | 3300046463 | Bacteria | 7143 |
| 366 | Ga0495653_0157789 | 3300046463 | Bacteria | 1578 |
| 367 | Ga0495653_0161821 | 3300046463 | Bacteria | 1553 |
| 368 | Ga0495653_0193588 | 3300046463 | Bacteria | 1385 |
| 369 | Ga0495580_0138957 | 3300046472 | Bacteria | 1684 |
| 370 | Ga0495582_0008083 | 3300046473 | Bacteria | 5806 |
| 371 | Ga0495582_0242190 | 3300046473 | Bacteria | 1034 |
| 372 | Ga0495582_0462027 | 3300046473 | Bacteria | 733 |
| 373 | Ga0495639_0000180 | 3300046475 | Bacteria | 33280 |
| 374 | Ga0495662_0109598 | 3300046476 | Bacteria | 1352 |
| 375 | Ga0495664_0006830 | 3300046477 | Bacteria | 6317 |
| 376 | Ga0495664_0213635 | 3300046477 | Bacteria | 1168 |
| 377 | Ga0495664_0234385 | 3300046477 | Bacteria | 1110 |
| 378 | Ga0495584_0013077 | 3300046491 | Bacteria | 4233 |
| 379 | Ga0495594_0128978 | 3300046499 | Bacteria | 1432 |
| 380 | Ga0495594_0848156 | 3300046499 | Unclassified | 514 |
| 381 | Ga0495608_0003399 | 3300046511 | Bacteria | 11397 |
| 382 | Ga0495608_0039723 | 3300046511 | Bacteria | 3153 |
| 383 | Ga0495608_0654995 | 3300046511 | Bacteria | 627 |
| 384 | Ga0495618_0001916 | 3300046514 | Bacteria | 13671 |
| 385 | Ga0495618_0050608 | 3300046514 | Bacteria | 2624 |
| 386 | Ga0495618_0396034 | 3300046514 | Bacteria | 845 |
| 387 | Ga0495618_0410199 | 3300046514 | Bacteria | 827 |
| 388 | Ga0495628_0000026 | 3300046516 | Bacteria | 127398 |
| 389 | Ga0495628_0027227 | 3300046516 | Bacteria | 4654 |
| 390 | Ga0495628_0038864 | 3300046516 | Bacteria | 3807 |
| 391 | Ga0495628_0129695 | 3300046516 | Bacteria | 1929 |
| 392 | Ga0495628_0632550 | 3300046516 | Bacteria | 761 |
| 393 | Ga0495630_0102675 | 3300046517 | Bacteria | 2163 |
| 394 | Ga0495630_0358848 | 3300046517 | Bacteria | 1115 |
| 395 | Ga0495630_0508301 | 3300046517 | Bacteria | 924 |
| 396 | Ga0495630_0885787 | 3300046517 | Bacteria | 680 |
| 397 | Ga0495637_0251139 | 3300046520 | Bacteria | 636 |
| 398 | Ga0495644_0003843 | 3300046523 | Bacteria | 5912 |
| 399 | Ga0495666_0024265 | 3300046526 | Bacteria | 2996 |
| 400 | Ga0495642_0165392 | 3300046528 | Bacteria | 960 |
| 401 | Ga0495652_0000172 | 3300046529 | Bacteria | 74042 |
| 402 | Ga0495652_0012745 | 3300046529 | Bacteria | 7573 |
| 403 | Ga0495652_0034510 | 3300046529 | Bacteria | 4408 |
| 404 | Ga0495652_0133818 | 3300046529 | Bacteria | 1958 |
| 405 | Ga0495652_0620502 | 3300046529 | Bacteria | 735 |
| 406 | Ga0495665_0004638 | 3300046531 | Bacteria | 7416 |
| 407 | Ga0495640_0070977 | 3300046533 | Bacteria | 2338 |
| 408 | Ga0495640_0122102 | 3300046533 | Bacteria | 1692 |
| 409 | Ga0495640_0288182 | 3300046533 | Bacteria | 1021 |
| 410 | Ga0495640_0364047 | 3300046533 | Bacteria | 891 |
| 411 | Ga0495640_0698476 | 3300046533 | Bacteria | 609 |
| 412 | Ga0495586_0296813 | 3300046535 | Bacteria | 925 |
| 413 | Ga0495587_0000362 | 3300046536 | Bacteria | 32677 |
| 414 | Ga0495609_0045030 | 3300046538 | Bacteria | 1978 |
| 415 | Ga0495645_0000016 | 3300046543 | Bacteria | 158415 |
| 416 | Ga0495645_0048372 | 3300046543 | Bacteria | 3097 |
| 417 | Ga0495645_0150074 | 3300046543 | Bacteria | 1620 |
| 418 | Ga0495645_0316088 | 3300046543 | Bacteria | 1015 |
| 419 | Ga0495645_0787119 | 3300046543 | Bacteria | 571 |
| 420 | Ga0495622_0272176 | 3300046557 | Bacteria | 742 |
| 421 | Ga0495667_0003656 | 3300046559 | Bacteria | 10350 |
| 422 | Ga0495667_0040067 | 3300046559 | Bacteria | 3112 |
| 423 | Ga0495667_0084957 | 3300046559 | Bacteria | 2054 |
| 424 | Ga0495667_0256516 | 3300046559 | Bacteria | 1112 |
| 425 | Ga0495667_0749380 | 3300046559 | Bacteria | 604 |
| 426 | Ga0495656_0028018 | 3300046615 | Bacteria | 2256 |
| 427 | Ga0495634_0137804 | 3300046642 | Bacteria | 1551 |
| 428 | Ga0495634_0142637 | 3300046642 | Bacteria | 1520 |
| 429 | Ga0495634_0340710 | 3300046642 | Bacteria | 899 |
| 430 | Ga0495611_0032920 | 3300046648 | Bacteria | 2286 |
| 431 | Ga0495635_0012666 | 3300046663 | Bacteria | 5915 |
| 432 | Ga0495635_0096507 | 3300046663 | Bacteria | 2020 |
| 433 | Ga0495635_0481479 | 3300046663 | Bacteria | 818 |
| 434 | Ga0495659_0109325 | 3300046664 | Bacteria | 1078 |
| 435 | Ga0495661_0047956 | 3300046665 | Bacteria | 2598 |
| 436 | Ga0495657_0017477 | 3300046675 | Bacteria | 5206 |
| 437 | Ga0495657_0109546 | 3300046675 | Bacteria | 1751 |
| 438 | Ga0495657_0312932 | 3300046675 | Bacteria | 934 |
| 439 | Ga0495657_0329042 | 3300046675 | Bacteria | 907 |
| 440 | Ga0495599_0000016 | 3300046678 | Bacteria | 169605 |
| 441 | Ga0495599_0015943 | 3300046678 | Bacteria | 4664 |
| 442 | Ga0495599_0028174 | 3300046678 | Bacteria | 3520 |
| 443 | Ga0495599_0048424 | 3300046678 | Bacteria | 2664 |
| 444 | Ga0495623_0000046 | 3300046679 | Bacteria | 74571 |
| 445 | Ga0495623_0179067 | 3300046679 | Bacteria | 1233 |
| 446 | Ga0495646_0002059 | 3300046680 | Bacteria | 12196 |
| 447 | Ga0495646_0221319 | 3300046680 | Bacteria | 1023 |
| 448 | Ga0495646_0524601 | 3300046680 | Bacteria | 607 |
| 449 | Ga0495647_0001095 | 3300046681 | Bacteria | 8264 |
| 450 | Ga0495647_0007693 | 3300046681 | Bacteria | 3618 |
| 451 | Ga0495647_0360150 | 3300046681 | Bacteria | 663 |
| 452 | Ga0495658_0005661 | 3300046683 | Bacteria | 6141 |
| 453 | Ga0495658_0214183 | 3300046683 | Unclassified | 1204 |
| 454 | Ga0495658_0241078 | 3300046683 | Bacteria | 1135 |
| 455 | Ga0495613_0013505 | 3300046689 | Bacteria | 6065 |
| 456 | Ga0495613_0456212 | 3300046689 | Bacteria | 865 |
| 457 | Ga0495613_0473395 | 3300046689 | Bacteria | 846 |
| 458 | Ga0495624_0010787 | 3300046690 | Bacteria | 6298 |
| 459 | Ga0495600_0088660 | 3300046809 | Bacteria | 2018 |
| 460 | Ga0495600_0159510 | 3300046809 | Bacteria | 1458 |
| 461 | Ga0495600_0184140 | 3300046809 | Bacteria | 1345 |
| 462 | Ga0495581_0022524 | 3300047315 | Bacteria | 3650 |
| 463 | Ga0495581_0815763 | 3300047315 | Unclassified | 535 |
| 464 | Ga0495604_0000004 | 3300047317 | Bacteria | 456385 |
| 465 | Ga0495604_0078930 | 3300047317 | Bacteria | 2469 |
| 466 | Ga0495636_0136255 | 3300047318 | Bacteria | 1094 |
| 467 | Ga0495674_0137073 | 3300047319 | Bacteria | 2058 |
| 468 | Ga0495674_0149643 | 3300047319 | Bacteria | 1958 |
| 469 | Ga0495674_0287747 | 3300047319 | Bacteria | 1345 |
| 470 | Ga0495674_0351163 | 3300047319 | Bacteria | 1197 |
| 471 | Ga0495674_0794285 | 3300047319 | Bacteria | 736 |
| 472 | Ga0495676_0000766 | 3300047321 | Bacteria | 26783 |
| 473 | Ga0495676_0188593 | 3300047321 | Bacteria | 1440 |
| 474 | Ga0495680_0013308 | 3300047322 | Bacteria | 7184 |
| 475 | Ga0495680_0030539 | 3300047322 | Bacteria | 4399 |
| 476 | Ga0495680_0053917 | 3300047322 | Bacteria | 3125 |
| 477 | Ga0495680_0116166 | 3300047322 | Bacteria | 1979 |
| 478 | Ga0495680_0188116 | 3300047322 | Bacteria | 1486 |
| 479 | Ga0495680_0247483 | 3300047322 | Bacteria | 1264 |
| 480 | Ga0495680_0375610 | 3300047322 | Unclassified | 985 |
| 481 | Ga0495675_0000079 | 3300047444 | Bacteria | 68947 |
| 482 | Ga0495675_0228379 | 3300047444 | Bacteria | 1124 |
| 483 | Ga0495675_0625183 | 3300047444 | Bacteria | 609 |
| 484 | Ga0495679_036931 | 3300047446 | Bacteria | 1540 |
| 485 | Ga0495684_0003487 | 3300047471 | Bacteria | 12313 |
| 486 | Ga0495684_0026751 | 3300047471 | Bacteria | 4432 |
| 487 | Ga0495684_0066179 | 3300047471 | Bacteria | 2747 |
| 488 | Ga0495684_0098211 | 3300047471 | Bacteria | 2214 |
| 489 | Ga0495602_0003737 | 3300048088 | Bacteria | 15807 |
| 490 | Ga0495602_0011503 | 3300048088 | Bacteria | 9143 |
| 491 | Ga0495602_0175354 | 3300048088 | Bacteria | 1659 |
| 492 | Ga0495614_0000786 | 3300048089 | Bacteria | 13431 |
| 493 | Ga0496100_0174513 | 3300048903 | Bacteria | 1551 |
| 494 | Ga0496100_0421288 | 3300048903 | Bacteria | 1020 |
| 495 | Ga0496101_0232046 | 3300048904 | Bacteria | 1435 |
| 496 | Ga0496101_0695834 | 3300048904 | Bacteria | 803 |
| 497 | Ga0496102_0011255 | 3300048905 | Bacteria | 7708 |
| 498 | Ga0496102_0245691 | 3300048905 | Bacteria | 1687 |
| 499 | Ga0496103_0110244 | 3300048906 | Bacteria | 1748 |
| 500 | Ga0496103_0179179 | 3300048906 | Bacteria | 1362 |
| 501 | Ga0496104_0012667 | 3300048907 | Bacteria | 7593 |
| 502 | Ga0496104_0027463 | 3300048907 | Bacteria | 5266 |
| 503 | Ga0496104_0142234 | 3300048907 | Bacteria | 2305 |
| 504 | Ga0496104_0551830 | 3300048907 | Bacteria | 1063 |
| 505 | Ga0496104_0927485 | 3300048907 | Bacteria | 775 |
| 506 | Ga0496105_0004484 | 3300048908 | Bacteria | 10513 |
| 507 | Ga0496105_0010012 | 3300048908 | Bacteria | 7438 |
| 508 | Ga0496105_0071613 | 3300048908 | Bacteria | 2864 |
| 509 | Ga0496105_0133102 | 3300048908 | Bacteria | 2049 |
| 510 | Ga0496105_0308081 | 3300048908 | Bacteria | 1272 |
| 511 | Ga0496105_0409373 | 3300048908 | Bacteria | 1075 |
| 512 | Ga0496106_0097806 | 3300048909 | Bacteria | 2273 |
| 513 | Ga0496106_0514281 | 3300048909 | Bacteria | 961 |
| 514 | Ga0496106_0808907 | 3300048909 | Bacteria | 743 |
| 515 | Ga0496106_1077928 | 3300048909 | Unclassified | 630 |
| 516 | Ga0496107_0133269 | 3300048910 | Bacteria | 1835 |
| 517 | Ga0496107_0207526 | 3300048910 | Bacteria | 1456 |
| 518 | Ga0496107_0375338 | 3300048910 | Bacteria | 1058 |
| 519 | Ga0496107_0423895 | 3300048910 | Bacteria | 989 |
| 520 | Ga0496107_0936038 | 3300048910 | Unclassified | 631 |
| 521 | Ga0496107_1127330 | 3300048910 | Bacteria | 566 |
| 522 | Ga0496108_0003668 | 3300048911 | Bacteria | 12319 |
| 523 | Ga0496108_0040200 | 3300048911 | Bacteria | 3897 |
| 524 | Ga0496108_0225618 | 3300048911 | Bacteria | 1628 |
| 525 | Ga0496108_0740722 | 3300048911 | Bacteria | 850 |
| 526 | Ga0496108_1128638 | 3300048911 | Bacteria | 665 |
| 527 | Ga0496109_0003288 | 3300048912 | Bacteria | 13492 |
| 528 | Ga0496109_0015721 | 3300048912 | Bacteria | 6603 |
| 529 | Ga0496109_0206402 | 3300048912 | Bacteria | 1847 |
| 530 | Ga0496109_0316584 | 3300048912 | Bacteria | 1472 |
| 531 | Ga0496109_0326278 | 3300048912 | Bacteria | 1449 |
| 532 | Ga0496110_0061924 | 3300048913 | Bacteria | 3304 |
| 533 | Ga0496110_0198224 | 3300048913 | Bacteria | 1824 |
| 534 | Ga0496111_0011389 | 3300048914 | Bacteria | 5989 |
| 535 | Ga0496111_0291177 | 3300048914 | Bacteria | 1211 |
| 536 | Ga0496111_0310637 | 3300048914 | Unclassified | 1168 |
| 537 | Ga0496111_0515640 | 3300048914 | Bacteria | 879 |
| 538 | Ga0496111_1205111 | 3300048914 | Unclassified | 536 |
| 539 | Ga0496112_0023281 | 3300048915 | Bacteria | 5915 |
| 540 | Ga0496112_0033644 | 3300048915 | Bacteria | 4983 |
| 541 | Ga0496112_0145477 | 3300048915 | Bacteria | 2339 |
| 542 | Ga0496112_0193617 | 3300048915 | Bacteria | 1994 |
| 543 | Ga0496112_0442214 | 3300048915 | Bacteria | 1238 |
| 544 | Ga0496112_0725179 | 3300048915 | Bacteria | 921 |
| 545 | Ga0496112_0831915 | 3300048915 | Bacteria | 847 |
| 546 | Ga0496113_0130240 | 3300048916 | Bacteria | 1973 |
| 547 | Ga0496113_0134813 | 3300048916 | Bacteria | 1939 |
| 548 | Ga0496113_0291199 | 3300048916 | Bacteria | 1306 |
| 549 | Ga0496114_0016870 | 3300048917 | Bacteria | 5888 |
| 550 | Ga0496115_0032746 | 3300048918 | Bacteria | 4102 |
| 551 | Ga0496115_0045173 | 3300048918 | Bacteria | 3516 |
| 552 | Ga0496115_0209401 | 3300048918 | Bacteria | 1610 |
| 553 | Ga0496115_0249527 | 3300048918 | Bacteria | 1461 |
| 554 | Ga0496115_0756317 | 3300048918 | Bacteria | 759 |
| 555 | Ga0501031_0038723 | 3300049568 | Bacteria | 3111 |
| 556 | Ga0501032_0175082 | 3300049569 | Bacteria | 1406 |
| 557 | Ga0501033_0452429 | 3300049570 | Bacteria | 892 |
| 558 | Ga0501036_0021823 | 3300049572 | Bacteria | 5383 |
| 559 | Ga0501038_0007250 | 3300049574 | Bacteria | 10236 |
| 560 | Ga0501039_0103648 | 3300049575 | Bacteria | 2221 |
| 561 | Ga0501040_0021682 | 3300049576 | Bacteria | 4293 |
| 562 | Ga0501040_0270426 | 3300049576 | Bacteria | 1213 |
| 563 | Ga0501041_0012588 | 3300049577 | Bacteria | 5011 |
| 564 | Ga0501042_0060176 | 3300049578 | Bacteria | 2712 |
| 565 | Ga0501043_0065478 | 3300049579 | Bacteria | 2854 |
| 566 | Ga0501046_0121139 | 3300049580 | Bacteria | 1990 |
| 567 | Ga0501048_0159872 | 3300049582 | Bacteria | 1594 |
| 568 | Ga0501067_0017072 | 3300049583 | Bacteria | 4011 |
| 569 | Ga0501069_0256060 | 3300049585 | Bacteria | 1021 |
| 570 | Ga0501071_0064503 | 3300049587 | Bacteria | 2657 |
| 571 | Ga0501072_0140919 | 3300049588 | Bacteria | 1922 |
| 572 | Ga0501074_0001407 | 3300049590 | Bacteria | 16027 |
| 573 | Ga0501076_0256774 | 3300049592 | Bacteria | 1430 |
| 574 | Ga0501077_0482014 | 3300049593 | Bacteria | 795 |
| 575 | Ga0501079_0016167 | 3300049741 | Bacteria | 5703 |
| 576 | Ga0501081_0008631 | 3300049743 | Bacteria | 6622 |
| 577 | Ga0501083_0042367 | 3300049744 | Bacteria | 3087 |
| 578 | Ga0501045_0000516 | 3300049824 | Bacteria | 24090 |
| 579 | Ga0501045_0301999 | 3300049824 | Bacteria | 1191 |
| 580 | nmdc:mga08y16_2126682_c1 | 3300050511 | Unclassified | 509 |
| 581 | nmdc:mga0rr50_74384_c1 | 3300050513 | Bacteria | 2600 |
| 582 | Ga0495601_0001391 | 3300053077 | Bacteria | 13315 |
| 583 | Ga0495601_0010171 | 3300053077 | Bacteria | 5591 |
| 584 | Ga0495601_0104890 | 3300053077 | Bacteria | 1827 |
| 585 | Ga0495601_0203653 | 3300053077 | Bacteria | 1293 |
| 586 | Ga0495601_0238084 | 3300053077 | Bacteria | 1188 |
| 587 | Ga0495601_0461560 | 3300053077 | Bacteria | 821 |
| 588 | Ga0495612_0005820 | 3300053078 | Bacteria | 5090 |
| 589 | Ga0495612_0042105 | 3300053078 | Bacteria | 1863 |
| 590 | Ga0495612_0148781 | 3300053078 | Bacteria | 1018 |
| 591 | Ga0495612_0305203 | 3300053078 | Bacteria | 714 |
| 592 | Ga0495595_0016850 | 3300053084 | Bacteria | 3134 |
| 593 | Ga0495595_0095259 | 3300053084 | Bacteria | 1432 |
| 594 | Ga0495595_0106885 | 3300053084 | Bacteria | 1354 |
| 595 | Ga0495595_0156638 | 3300053084 | Bacteria | 1122 |
| 596 | Ga0495595_0194656 | 3300053084 | Bacteria | 1008 |
| 597 | Ga0495619_0002372 | 3300053085 | Bacteria | 12385 |
| 598 | Ga0495619_0223791 | 3300053085 | Bacteria | 1303 |
| 599 | Ga0495619_0602618 | 3300053085 | Bacteria | 751 |
| 600 | Ga0500566_0209922 | 3300053094 | Bacteria | 976 |
| 601 | Ga0501084_0001482 | 3300054114 | Bacteria | 18660 |
| 602 | Ga0501084_0839055 | 3300054114 | Bacteria | 773 |
| 603 | Ga0501082_0014026 | 3300060353 | Bacteria | 6893 |
| 604 | Ga0466962_0000230 | 3300061719 | Bacteria | 23282 |
| 605 | Ga0466962_0006516 | 3300061719 | Bacteria | 5604 |
| 606 | Ga0466962_0173653 | 3300061719 | Bacteria | 1050 |
| 607 | Ga0466962_0211946 | 3300061719 | Bacteria | 948 |
| 608 | Ga0466962_0266599 | 3300061719 | Bacteria | 844 |
| 609 | Ga0495662_0056545 | |||
| 610 | Ga0070658_10226672 | |||
| 611 | Ga0070683_100185937 | |||
| 612 | Ga0070680_100036657 | |||
| 613 | Ga0070680_100255729 | |||
| 614 | Ga0070682_100016719 | |||
| 615 | Ga0070682_100293235 | |||
| 616 | Ga0070660_100706503 | |||
| 617 | Ga0070691_10110509 | |||
| 618 | Ga0070661_100592527 | |||
| 619 | Ga0070661_101136510 | |||
| 620 | Ga0070671_100543125 | |||
| 621 | Ga0070659_100088836 | |||
| 622 | Ga0070709_10171480 | |||
| 623 | Ga0070714_100015594 | |||
| 624 | Ga0070714_100022753 | |||
| 625 | Ga0070714_100028829 | |||
| 626 | Ga0070714_100100341 | |||
| 627 | Ga0070714_100322597 | |||
| 628 | Ga0070714_100324977 | |||
| 629 | Ga0070714_100398499 | |||
| 630 | Ga0070714_100870916 | |||
| 631 | Ga0070714_100997405 | |||
| 632 | Ga0070713_100284681 | |||
| 633 | Ga0070713_100483460 | |||
| 634 | Ga0070710_10009907 | |||
| 635 | Ga0070710_10033394 | |||
| 636 | Ga0070710_10444311 | |||
| 637 | Ga0070710_10764645 | |||
| 638 | Ga0070711_100055015 | |||
| 639 | Ga0070711_100629628 | |||
| 640 | Ga0070711_101599438 | |||
| 641 | Ga0070694_100132187 | |||
| 642 | Ga0070708_100697233 | |||
| 643 | Ga0070678_102031008 | |||
| 644 | Ga0070681_10030451 | |||
| 645 | Ga0070681_10046021 | |||
| 646 | Ga0070681_10163151 | |||
| 647 | Ga0070707_100001944 | |||
| 648 | Ga0070698_100000947 | |||
| 649 | Ga0070698_100251231 | |||
| 650 | Ga0070699_100034369 | |||
| 651 | Ga0070679_100050974 | |||
| 652 | Ga0070684_100036290 | |||
| 653 | Ga0070684_100744828 | |||
| 654 | Ga0070684_100874339 | |||
| 655 | Ga0070695_100001116 | |||
| 656 | Ga0070695_101874581 | |||
| 657 | Ga0070696_100410804 | |||
| 658 | Ga0070696_101302429 | |||
| 659 | Ga0070693_100421879 | |||
| 660 | Ga0070693_100631168 | |||
| 661 | Ga0068855_100067410 | |||
| 662 | Ga0068855_100722040 | |||
| 663 | Ga0068855_101152400 | |||
| 664 | Ga0068855_101853275 | |||
| 665 | Ga0068856_100056227 | |||
| 666 | Ga0068856_101622575 | |||
| 667 | Ga0068856_102333906 | |||
| 668 | Ga0068852_100438085 | |||
| 669 | Ga0068859_100811175 | |||
| 670 | Ga0068864_100510811 | |||
| 671 | Ga0068851_10222354 | |||
| 672 | Ga0068863_100346938 | |||
| 673 | Ga0081455_10125453 | |||
| 674 | Ga0081539_10095573 | |||
| 675 | Ga0070717_10009944 | |||
| 676 | Ga0070717_10012990 | |||
| 677 | Ga0070717_10231332 | |||
| 678 | Ga0070717_10256137 | |||
| 679 | Ga0070717_10609555 | |||
| 680 | Ga0070717_11331049 | |||
| 681 | Ga0070715_10001064 | |||
| 682 | Ga0070715_10941165 | |||
| 683 | Ga0070716_100017223 | |||
| 684 | Ga0070712_100278646 | |||
| 685 | Ga0070712_100639832 | |||
| 686 | Ga0068871_101201857 | |||
| 687 | Ga0075431_100779720 | |||
| 688 | Ga0075434_100035225 | |||
| 689 | Ga0097620_100811263 | |||
| 690 | Ga0075435_100247832 | |||
| 691 | Ga0075435_100941170 | |||
| 692 | Ga0105240_10042640 | |||
| 693 | Ga0105240_11390498 | |||
| 694 | Ga0111539_10071104 | |||
| 695 | Ga0105245_10262572 | |||
| 696 | Ga0105245_10391009 | |||
| 697 | Ga0114129_11569476 | |||
| 698 | Ga0105242_10641353 | |||
| 699 | Ga0105242_11343616 | |||
| 700 | Ga0105237_10085979 | |||
| 701 | Ga0105237_10985714 | |||
| 702 | Ga0105238_10291918 | |||
| 703 | Ga0105238_11886329 | |||
| 704 | Ga0105249_12526965 | |||
| 705 | Ga0157370_10514841 | |||
| 706 | Ga0157369_10051784 | |||
| 707 | Ga0157369_10332569 | |||
| 708 | Ga0157369_11929223 | |||
| 709 | Ga0157374_10069633 | |||
| 710 | Ga0157374_10506761 | |||
| 711 | Ga0163162_10288659 | |||
| 712 | Ga0157372_10030767 | |||
| 713 | Ga0157372_10074121 | |||
| 714 | Ga0157372_10966989 | |||
| 715 | Ga0157375_10153417 | |||
| 716 | Ga0182008_10002224 | |||
| 717 | Ga0182008_10149810 | |||
| 718 | Ga0182008_10545916 | |||
| 719 | Ga0157377_10597982 | |||
| 720 | Ga0157379_10433356 | |||
| 721 | Ga0157376_10025246 | |||
| 722 | Ga0182006_1256910 | |||
| 723 | Ga0182007_10018676 | |||
| 724 | Ga0197907_11288412 | |||
| 725 | Ga0206356_10915091 | |||
| 726 | Ga0206356_11446283 | |||
| 727 | Ga0206354_11252769 | |||
| 728 | Ga0213871_10151520 | |||
| 729 | Ga0207692_10007527 | |||
| 730 | Ga0207692_10037938 | |||
| 731 | Ga0207692_10980299 | |||
| 732 | Ga0207685_10711936 | |||
| 733 | Ga0207699_10210444 | |||
| 734 | Ga0207699_10838066 | |||
| 735 | Ga0207699_11247887 | |||
| 736 | Ga0207684_10484474 | |||
| 737 | Ga0207707_10040068 | |||
| 738 | Ga0207707_10105817 | |||
| 739 | Ga0207707_10182237 | |||
| 740 | Ga0207695_10163718 | |||
| 741 | Ga0207695_10332811 | |||
| 742 | Ga0207671_10076949 | |||
| 743 | Ga0207671_10354805 | |||
| 744 | Ga0207693_10005483 | |||
| 745 | Ga0207693_10012161 | |||
| 746 | Ga0207693_10389610 | |||
| 747 | Ga0207663_10014250 | |||
| 748 | Ga0207663_10122812 | |||
| 749 | Ga0207663_10287221 | |||
| 750 | Ga0207660_10414620 | |||
| 751 | Ga0207657_10004793 | |||
| 752 | Ga0207649_10053418 | |||
| 753 | Ga0207652_10225823 | |||
| 754 | Ga0207646_10007075 | |||
| 755 | Ga0207646_10065462 | |||
| 756 | Ga0207694_10306703 | |||
| 757 | Ga0207687_11032372 | |||
| 758 | Ga0207700_10083519 | |||
| 759 | Ga0207700_10671565 | |||
| 760 | Ga0207700_11243047 | |||
| 761 | Ga0207664_10014835 | |||
| 762 | Ga0207664_10090418 | |||
| 763 | Ga0207664_10264110 | |||
| 764 | Ga0207664_10390043 | |||
| 765 | Ga0207664_10749430 | |||
| 766 | Ga0207664_11121681 | |||
| 767 | Ga0207664_11224389 | |||
| 768 | Ga0207690_11220336 | |||
| 769 | Ga0207665_10007853 | |||
| 770 | Ga0207665_10563669 | |||
| 771 | Ga0207661_10037822 | |||
| 772 | Ga0207661_10394190 | |||
| 773 | Ga0207679_10959841 | |||
| 774 | Ga0207667_11273834 | |||
| 775 | Ga0207667_11301535 | |||
| 776 | Ga0207677_10375843 | |||
| 777 | Ga0207702_10347516 | |||
| 778 | Ga0207702_11177355 | |||
| 779 | Ga0207702_11939172 | |||
| 780 | Ga0207641_10153875 | |||
| 781 | Ga0207674_10535831 | |||
| 782 | Ga0207683_10244141 | |||
| 783 | Ga0207683_11421484 | |||
| 784 | Ga0207698_10287296 | |||
| 785 | Ga0207698_11482150 | |||
| 786 | Ga0265338_10005798 | |||
| 787 | Ga0265338_10011492 | |||
| 788 | Ga0265324_10038788 | |||
| 789 | Ga0307405_10369386 | |||
| 790 | Ga0307406_10222133 | |||
| 791 | Ga0307409_100180481 | |||
| 792 | Ga0307416_100332877 | |||
| 793 | Ga0307414_10071615 | |||
| 794 | Ga0373926_0003671 | |||
| 795 | Ga0373944_0120612 | |||
| 796 | Ga0373932_0352663 | |||
| 797 | Ga0373945_0060642 | |||
| 798 | Ga0373953_0420775 | |||
| 799 | Ga0373960_0156556 | |||
| 800 | Ga0373943_0001785 | |||
| 801 | Ga0373943_0199575 | |||
| 802 | Ga0373946_0111823 | |||
| 803 | Ga0373955_0199163 | |||
| 804 | Ga0373955_0514905 | |||
| 805 | Ga0373955_0817084 | |||
| 806 | Ga0373924_0037414 | |||
| 807 | Ga0373924_0492786 | |||
| 808 | Ga0373931_0024447 | |||
| 809 | Ga0373931_1115250 | |||
| 810 | Ga0373935_0081553 | |||
| 811 | Ga0373935_0566979 | |||
| 812 | Ga0373935_1287037 | |||
| 813 | Ga0373927_0049069 | |||
| 814 | Ga0373933_0101264 | |||
| 815 | Ga0373947_0099155 | |||
| 816 | Ga0373947_0339964 | |||
| 817 | Ga0373947_0741350 | |||
| 818 | Ga0373937_0004317 | |||
| 819 | Ga0373937_0269640 | |||
| 820 | Ga0373937_0619115 | |||
| 821 | Ga0373937_0682670 | |||
| 822 | Ga0373925_0460915 | |||
| 823 | Ga0395899_0533583 | |||
| 824 | Ga0395899_1007592 | |||
| 825 | Ga0395900_0924403 | |||
| 826 | Ga0395900_1088475 | |||
| 827 | Ga0395900_1091653 | |||
| 828 | Ga0395900_1273945 | |||
| 829 | Ga0436365_0353990 | |||
| 830 | Ga0436360_1371984 | |||
| 831 | Ga0439458_0032806 | |||
| 832 | Ga0466969_0000408 | |||
| 833 | Ga0466969_0400188 | |||
| 834 | Ga0466965_0018886 | |||
| 835 | Ga0466965_0035959 | |||
| 836 | Ga0466965_0591162 | |||
| 837 | Ga0466966_0004699 | |||
| 838 | Ga0466966_0082311 | |||
| 839 | Ga0466966_0444275 | |||
| 840 | Ga0466961_0010507 | |||
| 841 | Ga0466961_0011429 | |||
| 842 | Ga0466961_0019503 | |||
| 843 | Ga0466961_0025516 | |||
| 844 | Ga0466961_0154836 | |||
| 845 | Ga0466961_0338941 | |||
| 846 | Ga0466961_0361537 | |||
| 847 | Ga0466961_0422047 | |||
| 848 | Ga0466963_0000851 | |||
| 849 | Ga0466963_0004118 | |||
| 850 | Ga0466963_0008142 | |||
| 851 | Ga0466963_0014050 | |||
| 852 | Ga0466963_0016027 | |||
| 853 | Ga0466963_0018129 | |||
| 854 | Ga0466963_0025420 | |||
| 855 | Ga0466963_0038028 | |||
| 856 | Ga0466963_0040773 | |||
| 857 | Ga0466963_0041044 | |||
| 858 | Ga0466963_0057717 | |||
| 859 | Ga0466963_0115947 | |||
| 860 | Ga0466963_0139502 | |||
| 861 | Ga0466963_0139697 | |||
| 862 | Ga0466963_0251004 | |||
| 863 | Ga0466963_0424624 | |||
| 864 | Ga0466963_0695694 | |||
| 865 | Ga0466964_0001364 | |||
| 866 | Ga0466964_0002900 | |||
| 867 | Ga0466964_0003348 | |||
| 868 | Ga0466964_0047415 | |||
| 869 | Ga0466964_0052347 | |||
| 870 | Ga0466964_0059058 | |||
| 871 | Ga0466964_0114207 | |||
| 872 | Ga0466964_0131060 | |||
| 873 | Ga0466964_0158666 | |||
| 874 | Ga0466964_0176119 | |||
| 875 | Ga0466964_0185558 | |||
| 876 | Ga0466964_0480614 | |||
| 877 | Ga0466964_0838769 | |||
| 878 | Ga0466971_0002948 | |||
| 879 | Ga0466971_0004955 | |||
| 880 | Ga0466971_0005803 | |||
| 881 | Ga0466971_0095726 | |||
| 882 | Ga0466971_0172425 | |||
| 883 | Ga0466968_0017149 | |||
| 884 | Ga0466968_0024090 | |||
| 885 | Ga0466968_0029739 | |||
| 886 | Ga0466968_0065002 | |||
| 887 | Ga0466968_0078112 | |||
| 888 | Ga0466968_0127959 | |||
| 889 | Ga0466968_0147578 | |||
| 890 | Ga0466968_0161258 | |||
| 891 | Ga0466968_0526989 | |||
| 892 | Ga0466970_0004734 | |||
| 893 | Ga0466970_0066840 | |||
| 894 | Ga0466970_0170812 | |||
| 895 | Ga0466970_0315877 | |||
| 896 | Ga0466970_0483555 | |||
| 897 | Ga0466957_0002697 | |||
| 898 | Ga0466957_0008604 | |||
| 899 | Ga0466957_0011045 | |||
| 900 | Ga0466957_0027087 | |||
| 901 | Ga0466957_0034668 | |||
| 902 | Ga0466957_0078128 | |||
| 903 | Ga0466957_0298737 | |||
| 904 | Ga0466957_0472738 | |||
| 905 | Ga0466957_0599923 | |||
| 906 | Ga0466960_0009082 | |||
| 907 | Ga0466960_0149314 | |||
| 908 | Ga0466960_0581558 | |||
| 909 | Ga0466959_0007658 | |||
| 910 | Ga0466959_0046544 | |||
| 911 | Ga0466959_0124040 | |||
| 912 | Ga0466959_0172259 | |||
| 913 | Ga0466959_0175581 | |||
| 914 | Ga0466959_0211680 | |||
| 915 | Ga0466958_0001637 | |||
| 916 | Ga0466958_0003114 | |||
| 917 | Ga0466958_0018707 | |||
| 918 | Ga0466958_0024203 | |||
| 919 | Ga0466958_0047713 | |||
| 920 | Ga0466958_0061114 | |||
| 921 | Ga0466958_0121689 | |||
| 922 | Ga0466958_0138857 | |||
| 923 | Ga0466958_0181826 | |||
| 924 | Ga0466958_0300395 | |||
| 925 | Ga0466958_0332851 | |||
| 926 | Ga0466958_0629749 | |||
| 927 | Ga0466958_0902436 | |||
| 928 | Ga0466958_1043815 | |||
| 929 | Ga0466967_0000857 | |||
| 930 | Ga0466967_0003101 | |||
| 931 | Ga0466967_0007502 | |||
| 932 | Ga0466967_0015023 | |||
| 933 | Ga0466967_0019365 | |||
| 934 | Ga0466967_0032145 | |||
| 935 | Ga0466967_0033158 | |||
| 936 | Ga0466967_0034599 | |||
| 937 | Ga0466967_0054438 | |||
| 938 | Ga0466967_0069415 | |||
| 939 | Ga0466967_0069942 | |||
| 940 | Ga0466967_0111998 | |||
| 941 | Ga0466967_0112554 | |||
| 942 | Ga0466967_0119653 | |||
| 943 | Ga0466967_0148071 | |||
| 944 | Ga0466967_0168849 | |||
| 945 | Ga0466967_0226917 | |||
| 946 | Ga0466967_0227304 | |||
| 947 | Ga0466967_0238456 | |||
| 948 | Ga0466967_0238934 | |||
| 949 | Ga0466967_0286479 | |||
| 950 | Ga0466967_1529683 | |||
| 951 | Ga0466967_2292557 | |||
| 952 | Ga0466967_2350765 | |||
| 953 | Ga0495617_265791 | |||
| 954 | Ga0495592_0000048 | |||
| 955 | Ga0495592_0011699 | |||
| 956 | Ga0495592_0022364 | |||
| 957 | Ga0495592_0098006 | |||
| 958 | Ga0495603_0018778 | |||
| 959 | Ga0495603_0178725 | |||
| 960 | Ga0495603_0230141 | |||
| 961 | Ga0495629_0009637 | |||
| 962 | Ga0495629_0024290 | |||
| 963 | Ga0495629_0143717 | |||
| 964 | Ga0495629_0229901 | |||
| 965 | Ga0495629_0399979 | |||
| 966 | Ga0495641_0001416 | |||
| 967 | Ga0495641_0050104 | |||
| 968 | Ga0495641_0404619 | |||
| 969 | Ga0495651_0000049 | |||
| 970 | Ga0495651_0074588 | |||
| 971 | Ga0495651_0160038 | |||
| 972 | Ga0495651_0191519 | |||
| 973 | Ga0495653_0011777 | |||
| 974 | Ga0495653_0157789 | |||
| 975 | Ga0495653_0161821 | |||
| 976 | Ga0495653_0193588 | |||
| 977 | Ga0495580_0138957 | |||
| 978 | Ga0495582_0008083 | |||
| 979 | Ga0495582_0242190 | |||
| 980 | Ga0495582_0462027 | |||
| 981 | Ga0495639_0000180 | |||
| 982 | Ga0495662_0109598 | |||
| 983 | Ga0495664_0006830 | |||
| 984 | Ga0495664_0213635 | |||
| 985 | Ga0495664_0234385 | |||
| 986 | Ga0495584_0013077 | |||
| 987 | Ga0495594_0128978 | |||
| 988 | Ga0495594_0848156 | |||
| 989 | Ga0495608_0003399 | |||
| 990 | Ga0495608_0039723 | |||
| 991 | Ga0495608_0654995 | |||
| 992 | Ga0495618_0001916 | |||
| 993 | Ga0495618_0050608 | |||
| 994 | Ga0495618_0396034 | |||
| 995 | Ga0495618_0410199 | |||
| 996 | Ga0495628_0000026 | |||
| 997 | Ga0495628_0027227 | |||
| 998 | Ga0495628_0038864 | |||
| 999 | Ga0495628_0129695 | |||
| 1000 | Ga0495628_0632550 | |||
| 1001 | Ga0495630_0102675 | |||
| 1002 | Ga0495630_0358848 | |||
| 1003 | Ga0495630_0508301 | |||
| 1004 | Ga0495630_0885787 | |||
| 1005 | Ga0495637_0251139 | |||
| 1006 | Ga0495644_0003843 | |||
| 1007 | Ga0495666_0024265 | |||
| 1008 | Ga0495642_0165392 | |||
| 1009 | Ga0495652_0000172 | |||
| 1010 | Ga0495652_0012745 | |||
| 1011 | Ga0495652_0034510 | |||
| 1012 | Ga0495652_0133818 | |||
| 1013 | Ga0495652_0620502 | |||
| 1014 | Ga0495665_0004638 | |||
| 1015 | Ga0495640_0070977 | |||
| 1016 | Ga0495640_0122102 | |||
| 1017 | Ga0495640_0288182 | |||
| 1018 | Ga0495640_0364047 | |||
| 1019 | Ga0495640_0698476 | |||
| 1020 | Ga0495586_0296813 | |||
| 1021 | Ga0495587_0000362 | |||
| 1022 | Ga0495609_0045030 | |||
| 1023 | Ga0495645_0000016 | |||
| 1024 | Ga0495645_0048372 | |||
| 1025 | Ga0495645_0150074 | |||
| 1026 | Ga0495645_0316088 | |||
| 1027 | Ga0495645_0787119 | |||
| 1028 | Ga0495622_0272176 | |||
| 1029 | Ga0495667_0003656 | |||
| 1030 | Ga0495667_0040067 | |||
| 1031 | Ga0495667_0084957 | |||
| 1032 | Ga0495667_0256516 | |||
| 1033 | Ga0495667_0749380 | |||
| 1034 | Ga0495656_0028018 | |||
| 1035 | Ga0495634_0137804 | |||
| 1036 | Ga0495634_0142637 | |||
| 1037 | Ga0495634_0340710 | |||
| 1038 | Ga0495611_0032920 | |||
| 1039 | Ga0495635_0012666 | |||
| 1040 | Ga0495635_0096507 | |||
| 1041 | Ga0495635_0481479 | |||
| 1042 | Ga0495659_0109325 | |||
| 1043 | Ga0495661_0047956 | |||
| 1044 | Ga0495657_0017477 | |||
| 1045 | Ga0495657_0109546 | |||
| 1046 | Ga0495657_0312932 | |||
| 1047 | Ga0495657_0329042 | |||
| 1048 | Ga0495599_0000016 | |||
| 1049 | Ga0495599_0015943 | |||
| 1050 | Ga0495599_0028174 | |||
| 1051 | Ga0495599_0048424 | |||
| 1052 | Ga0495623_0000046 | |||
| 1053 | Ga0495623_0179067 | |||
| 1054 | Ga0495646_0002059 | |||
| 1055 | Ga0495646_0221319 | |||
| 1056 | Ga0495646_0524601 | |||
| 1057 | Ga0495647_0001095 | |||
| 1058 | Ga0495647_0007693 | |||
| 1059 | Ga0495647_0360150 | |||
| 1060 | Ga0495658_0005661 | |||
| 1061 | Ga0495658_0214183 | |||
| 1062 | Ga0495658_0241078 | |||
| 1063 | Ga0495613_0013505 | |||
| 1064 | Ga0495613_0456212 | |||
| 1065 | Ga0495613_0473395 | |||
| 1066 | Ga0495624_0010787 | |||
| 1067 | Ga0495600_0088660 | |||
| 1068 | Ga0495600_0159510 | |||
| 1069 | Ga0495600_0184140 | |||
| 1070 | Ga0495581_0022524 | |||
| 1071 | Ga0495581_0815763 | |||
| 1072 | Ga0495604_0000004 | |||
| 1073 | Ga0495604_0078930 | |||
| 1074 | Ga0495636_0136255 | |||
| 1075 | Ga0495674_0137073 | |||
| 1076 | Ga0495674_0149643 | |||
| 1077 | Ga0495674_0287747 | |||
| 1078 | Ga0495674_0351163 | |||
| 1079 | Ga0495674_0794285 | |||
| 1080 | Ga0495676_0000766 | |||
| 1081 | Ga0495676_0188593 | |||
| 1082 | Ga0495680_0013308 | |||
| 1083 | Ga0495680_0030539 | |||
| 1084 | Ga0495680_0053917 | |||
| 1085 | Ga0495680_0116166 | |||
| 1086 | Ga0495680_0188116 | |||
| 1087 | Ga0495680_0247483 | |||
| 1088 | Ga0495680_0375610 | |||
| 1089 | Ga0495675_0000079 | |||
| 1090 | Ga0495675_0228379 | |||
| 1091 | Ga0495675_0625183 | |||
| 1092 | Ga0495679_036931 | |||
| 1093 | Ga0495684_0003487 | |||
| 1094 | Ga0495684_0026751 | |||
| 1095 | Ga0495684_0066179 | |||
| 1096 | Ga0495684_0098211 | |||
| 1097 | Ga0495602_0003737 | |||
| 1098 | Ga0495602_0011503 | |||
| 1099 | Ga0495602_0175354 | |||
| 1100 | Ga0495614_0000786 | |||
| 1101 | Ga0496100_0174513 | |||
| 1102 | Ga0496100_0421288 | |||
| 1103 | Ga0496101_0232046 | |||
| 1104 | Ga0496101_0695834 | |||
| 1105 | Ga0496102_0011255 | |||
| 1106 | Ga0496102_0245691 | |||
| 1107 | Ga0496103_0110244 | |||
| 1108 | Ga0496103_0179179 | |||
| 1109 | Ga0496104_0012667 | |||
| 1110 | Ga0496104_0027463 | |||
| 1111 | Ga0496104_0142234 | |||
| 1112 | Ga0496104_0551830 | |||
| 1113 | Ga0496104_0927485 | |||
| 1114 | Ga0496105_0004484 | |||
| 1115 | Ga0496105_0010012 | |||
| 1116 | Ga0496105_0071613 | |||
| 1117 | Ga0496105_0133102 | |||
| 1118 | Ga0496105_0308081 | |||
| 1119 | Ga0496105_0409373 | |||
| 1120 | Ga0496106_0097806 | |||
| 1121 | Ga0496106_0514281 | |||
| 1122 | Ga0496106_0808907 | |||
| 1123 | Ga0496106_1077928 | |||
| 1124 | Ga0496107_0133269 | |||
| 1125 | Ga0496107_0207526 | |||
| 1126 | Ga0496107_0375338 | |||
| 1127 | Ga0496107_0423895 | |||
| 1128 | Ga0496107_0936038 | |||
| 1129 | Ga0496107_1127330 | |||
| 1130 | Ga0496108_0003668 | |||
| 1131 | Ga0496108_0040200 | |||
| 1132 | Ga0496108_0225618 | |||
| 1133 | Ga0496108_0740722 | |||
| 1134 | Ga0496108_1128638 | |||
| 1135 | Ga0496109_0003288 | |||
| 1136 | Ga0496109_0015721 | |||
| 1137 | Ga0496109_0206402 | |||
| 1138 | Ga0496109_0316584 | |||
| 1139 | Ga0496109_0326278 | |||
| 1140 | Ga0496110_0061924 | |||
| 1141 | Ga0496110_0198224 | |||
| 1142 | Ga0496111_0011389 | |||
| 1143 | Ga0496111_0291177 | |||
| 1144 | Ga0496111_0310637 | |||
| 1145 | Ga0496111_0515640 | |||
| 1146 | Ga0496111_1205111 | |||
| 1147 | Ga0496112_0023281 | |||
| 1148 | Ga0496112_0033644 | |||
| 1149 | Ga0496112_0145477 | |||
| 1150 | Ga0496112_0193617 | |||
| 1151 | Ga0496112_0442214 | |||
| 1152 | Ga0496112_0725179 | |||
| 1153 | Ga0496112_0831915 | |||
| 1154 | Ga0496113_0130240 | |||
| 1155 | Ga0496113_0134813 | |||
| 1156 | Ga0496113_0291199 | |||
| 1157 | Ga0496114_0016870 | |||
| 1158 | Ga0496115_0032746 | |||
| 1159 | Ga0496115_0045173 | |||
| 1160 | Ga0496115_0209401 | |||
| 1161 | Ga0496115_0249527 | |||
| 1162 | Ga0496115_0756317 | |||
| 1163 | Ga0501031_0038723 | |||
| 1164 | Ga0501032_0175082 | |||
| 1165 | Ga0501033_0452429 | |||
| 1166 | Ga0501036_0021823 | |||
| 1167 | Ga0501038_0007250 | |||
| 1168 | Ga0501039_0103648 | |||
| 1169 | Ga0501040_0021682 | |||
| 1170 | Ga0501040_0270426 | |||
| 1171 | Ga0501041_0012588 | |||
| 1172 | Ga0501042_0060176 | |||
| 1173 | Ga0501043_0065478 | |||
| 1174 | Ga0501046_0121139 | |||
| 1175 | Ga0501048_0159872 | |||
| 1176 | Ga0501067_0017072 | |||
| 1177 | Ga0501069_0256060 | |||
| 1178 | Ga0501071_0064503 | |||
| 1179 | Ga0501072_0140919 | |||
| 1180 | Ga0501074_0001407 | |||
| 1181 | Ga0501076_0256774 | |||
| 1182 | Ga0501077_0482014 | |||
| 1183 | Ga0501079_0016167 | |||
| 1184 | Ga0501081_0008631 | |||
| 1185 | Ga0501083_0042367 | |||
| 1186 | Ga0501045_0000516 | |||
| 1187 | Ga0501045_0301999 | |||
| 1188 | nmdc:mga08y16_2126682_c1 | |||
| 1189 | nmdc:mga0rr50_74384_c1 | |||
| 1190 | Ga0495601_0001391 | |||
| 1191 | Ga0495601_0010171 | |||
| 1192 | Ga0495601_0104890 | |||
| 1193 | Ga0495601_0203653 | |||
| 1194 | Ga0495601_0238084 | |||
| 1195 | Ga0495601_0461560 | |||
| 1196 | Ga0495612_0005820 | |||
| 1197 | Ga0495612_0042105 | |||
| 1198 | Ga0495612_0148781 | |||
| 1199 | Ga0495612_0305203 | |||
| 1200 | Ga0495595_0016850 | |||
| 1201 | Ga0495595_0095259 | |||
| 1202 | Ga0495595_0106885 | |||
| 1203 | Ga0495595_0156638 | |||
| 1204 | Ga0495595_0194656 | |||
| 1205 | Ga0495619_0002372 | |||
| 1206 | Ga0495619_0223791 | |||
| 1207 | Ga0495619_0602618 | |||
| 1208 | Ga0500566_0209922 | |||
| 1209 | Ga0501084_0001482 | |||
| 1210 | Ga0501084_0839055 | |||
| 1211 | Ga0501082_0014026 | |||
| 1212 | Ga0466962_0000230 | |||
| 1213 | Ga0466962_0006516 | |||
| 1214 | Ga0466962_0173653 | |||
| 1215 | Ga0466962_0211946 | |||
| 1216 | Ga0466962_0266599 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5f3m-assembly1.cif.gz_A | crystal structure of dihydroneopterin aldolase from bacillus anthracis complexed with l-neopterin at 1.5 angstroms resolution . | 0.9159 | 1 | 114 |
| 1nbu-assembly1.cif.gz_C | 7,8-dihydroneopterin aldolase complexed with product from mycobacterium tuberculosis | 0.9078 | 1 | 114 |
| 2nm2-assembly1.cif.gz_C | crystal structure of dihydroneopterin aldolase from s. aureus in complex with (1s,2r)-neopterin at 1.50 angstrom resolution | 0.9059 | 2 | 114 |
| 5f3m-assembly1.cif.gz_A | crystal structure of dihydroneopterin aldolase from bacillus anthracis complexed with l-neopterin at 1.5 angstroms resolution . | 0.9009 | 1 | 114 |
| 8evk-assembly1.cif.gz_A | crystal structure of helicobacter pylori dihydroneopterin aldolase (dhna) | 0.9006 | 2 | 114 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0J0C6_26_148_3.30.1130.10 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.9196 | 1 | 114 | 3.30.1130.10 |
| 2nm2B00 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.9158 | 2 | 114 | 3.30.1130.10 |
| 5farH00 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.9097 | 2 | 114 | 3.30.1130.10 |
| af_A0A0R0J0C6_26_148_3.30.1130.10 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.9045 | 1 | 114 | 3.30.1130.10 |
| 2nm2B00 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.8933 | 2 | 114 | 3.30.1130.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538E4I0-F1-model_v4 | 7,8-dihydroneopterin aldolase (EC 4.1.2.25) | 0.9608 | 2 | 114 |
GO:0004150
GO:0005737 GO:0046654 GO:0046656 |
| AF-A0A538FUG0-F1-model_v4 | 7,8-dihydroneopterin aldolase (EC 4.1.2.25) | 0.9588 | 2 | 114 |
GO:0004150
GO:0005737 GO:0046654 GO:0046656 |
| AF-A0A538HLE2-F1-model_v4 | 7,8-dihydroneopterin aldolase (EC 4.1.2.25) | 0.9528 | 12 | 114 |
GO:0004150
GO:0005737 GO:0046654 GO:0046656 |
| AF-A0A7M2YX50-F1-model_v4 | 7,8-dihydroneopterin aldolase (EC 4.1.2.25) | 0.9412 | 2 | 114 |
GO:0004150
GO:0005737 GO:0046654 GO:0046656 |
| AF-A0A7V4MYU1-F1-model_v4 | 7,8-dihydroneopterin aldolase (EC 4.1.2.25) | 0.9398 | 2 | 114 |
GO:0004150
GO:0005737 GO:0046654 GO:0046656 |