F468783

General Info

Members Datasets Scaffolds Average Seq Length
608 297 1216 210

Family's Representative Sequence

Representative Sequence 3300012508|Ga0157315_1002353|Ga0157315_10023532
Length 207
Sequence VAHEYDVVGSTTPFSGRIWSVRSDEVAMPGGVTSQRDVVVHPGAVAVVALRGEGDGTEVLLVNQYRHPVGRRLDELPAGLLDVAHEPALEAARRELAEEAGCAATTWHVLVDVLTSPGFTDEAIRVYLATGVTEVTRSVQHDEELEMTAHWVPLATAVRAALSGELENGVCVTGVLAAAAALADSGGVRLRSADAPWRSRPAAAPGS

Samples

Sample ID Description Type Environment
1 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
168 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
169 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
173 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
174 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
175 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
176 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
177 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
178 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
179 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
180 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
181 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
182 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
183 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
184 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
185 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
186 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
187 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
188 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
189 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
190 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
191 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
192 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
193 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
194 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
195 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
196 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
197 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
198 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
199 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
200 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
201 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
202 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
203 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
204 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
205 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
206 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
207 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
208 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
209 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
226 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
227 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
228 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
229 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
230 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
231 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
232 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
233 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
234 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
235 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
236 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
237 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
248 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
249 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
250 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
251 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
253 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
254 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
255 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
256 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
257 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
258 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
259 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
260 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
261 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
262 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
263 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
264 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
265 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
266 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
267 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
268 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
269 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
270 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
271 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
272 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
273 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
274 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
275 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
276 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
277 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
278 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
279 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
280 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
281 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
282 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
283 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
284 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
285 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
286 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
287 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
288 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
289 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
290 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
291 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
292 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
293 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
294 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
295 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
296 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
297 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.71
Metatranscriptomes 0.16
Isolates 3.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.49
Nodule 0
Rhizoplane 13.32
Rhizosphere 64.97
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157315_1002353 3300012508 Bacteria 1174
2 JGI24749J21850_1011458 3300002076 Bacteria 1245
3 JGI24744J21845_10001133 3300002077 Bacteria 5188
4 JGI24742J22300_10007032 3300002244 Bacteria 1855
5 rootH2_10214696 3300003320 Bacteria 1352
6 Ga0055540_1000147 3300003792 Bacteria 70743
7 Ga0055540_1001059 3300003792 Bacteria 17527
8 Ga0055540_1002003 3300003792 Bacteria 11371
9 Ga0055540_1011935 3300003792 Bacteria 2761
10 Ga0070690_100204653 3300005330 Bacteria 1375
11 Ga0070690_100541893 3300005330 Bacteria 876
12 Ga0068869_100190409 3300005334 Bacteria 1613
13 Ga0070666_10061937 3300005335 Bacteria 2534
14 Ga0070682_100009138 3300005337 Bacteria 5602
15 Ga0070682_100128917 3300005337 Bacteria 1709
16 Ga0070682_100300279 3300005337 Bacteria 1178
17 Ga0068868_100003016 3300005338 Bacteria 11713
18 Ga0068868_100119293 3300005338 Bacteria 2150
19 Ga0070660_100297766 3300005339 Bacteria 1322
20 Ga0070689_100008366 3300005340 Bacteria 7286
21 Ga0070689_100417923 3300005340 Bacteria 1136
22 Ga0070691_10015107 3300005341 Bacteria 3547
23 Ga0070687_100036368 3300005343 Bacteria 2453
24 Ga0070692_10113289 3300005345 Bacteria 1503
25 Ga0070668_100001818 3300005347 Bacteria 15519
26 Ga0070668_100011080 3300005347 Bacteria 6711
27 Ga0070668_100067132 3300005347 Bacteria 2785
28 Ga0070669_100003102 3300005353 Bacteria 11957
29 Ga0070675_100118496 3300005354 Bacteria 2247
30 Ga0070675_100150667 3300005354 Bacteria 1994
31 Ga0070671_100098634 3300005355 Bacteria 2451
32 Ga0070674_100168617 3300005356 Bacteria 1667
33 Ga0070673_100019084 3300005364 Bacteria 4919
34 Ga0070688_100006038 3300005365 Bacteria 6430
35 Ga0070659_100083957 3300005366 Bacteria 2546
36 Ga0070659_100285120 3300005366 Bacteria 1374
37 Ga0070667_100000905 3300005367 Bacteria 27397
38 Ga0070667_100017717 3300005367 Bacteria 5903
39 Ga0070667_100018290 3300005367 Bacteria 5810
40 Ga0070667_100127844 3300005367 Bacteria 2216
41 Ga0070667_100431108 3300005367 Bacteria 1203
42 Ga0070709_10133553 3300005434 Bacteria 1697
43 Ga0070714_100177100 3300005435 Bacteria 1938
44 Ga0070714_100295359 3300005435 Bacteria 1509
45 Ga0070714_100309002 3300005435 Bacteria 1476
46 Ga0070714_100437490 3300005435 Bacteria 1241
47 Ga0070714_100630559 3300005435 Bacteria 1031
48 Ga0070710_10002895 3300005437 Bacteria 8177
49 Ga0070710_10009958 3300005437 Bacteria 4659
50 Ga0070710_10106892 3300005437 Bacteria 1675
51 Ga0070701_10089130 3300005438 Bacteria 1686
52 Ga0070701_10475304 3300005438 Bacteria 807
53 Ga0070711_100001070 3300005439 Bacteria 14613
54 Ga0070711_100021562 3300005439 Bacteria 4168
55 Ga0070705_100006220 3300005440 Bacteria 5846
56 Ga0070700_100014620 3300005441 Bacteria 4434
57 Ga0070694_100099075 3300005444 Bacteria 2059
58 Ga0070694_100132099 3300005444 Bacteria 1804
59 Ga0070663_100038783 3300005455 Bacteria 3325
60 Ga0070663_100074754 3300005455 Bacteria 2475
61 Ga0070663_100124098 3300005455 Bacteria 1954
62 Ga0070663_100315143 3300005455 Bacteria 1256
63 Ga0070678_100001690 3300005456 Bacteria 11839
64 Ga0070678_100750304 3300005456 Bacteria 883
65 Ga0070662_100017737 3300005457 Bacteria 4803
66 Ga0070662_100096548 3300005457 Bacteria 2229
67 Ga0068867_100001579 3300005459 Bacteria 15844
68 Ga0068867_100080266 3300005459 Bacteria 2456
69 Ga0070685_10114574 3300005466 Bacteria 1666
70 Ga0070707_100697457 3300005468 Bacteria 978
71 Ga0070679_100439184 3300005530 Bacteria 1250
72 Ga0068853_100011224 3300005539 Bacteria 7269
73 Ga0068853_100023541 3300005539 Bacteria 5157
74 Ga0070672_100151307 3300005543 Bacteria 1920
75 Ga0070686_100098673 3300005544 Bacteria 1969
76 Ga0070686_100259599 3300005544 Bacteria 1273
77 Ga0070695_100024273 3300005545 Bacteria 3733
78 Ga0070695_100179347 3300005545 Bacteria 1500
79 Ga0070696_100030613 3300005546 Bacteria 3686
80 Ga0070693_100041237 3300005547 Bacteria 2596
81 Ga0070665_100010888 3300005548 Bacteria 9201
82 Ga0070665_100035016 3300005548 Bacteria 5051
83 Ga0070665_100085095 3300005548 Bacteria 3167
84 Ga0070665_100198491 3300005548 Bacteria 2007
85 Ga0070665_101199153 3300005548 Bacteria 770
86 Ga0070704_100002074 3300005549 Bacteria 11134
87 Ga0068855_100479080 3300005563 Bacteria 1355
88 Ga0068854_100054624 3300005578 Bacteria 2873
89 Ga0068854_100229082 3300005578 Bacteria 1474
90 Ga0068856_100103856 3300005614 Bacteria 2835
91 Ga0070702_100002091 3300005615 Bacteria 8470
92 Ga0070702_100037787 3300005615 Bacteria 2683
93 Ga0068852_100037720 3300005616 Bacteria 4055
94 Ga0068859_100002349 3300005617 Bacteria 19240
95 Ga0068859_100004387 3300005617 Bacteria 14388
96 Ga0068859_100509550 3300005617 Bacteria 1298
97 Ga0068864_100561123 3300005618 Bacteria 1105
98 Ga0068866_10000420 3300005718 Bacteria 19701
99 Ga0068866_10692729 3300005718 Bacteria 698
100 Ga0068861_100000698 3300005719 Bacteria 20136
101 Ga0068861_100118631 3300005719 Bacteria 2131
102 Ga0068861_100435127 3300005719 Bacteria 1172
103 Ga0068851_10082350 3300005834 Bacteria 1682
104 Ga0068863_100005279 3300005841 Bacteria 12755
105 Ga0068863_100005982 3300005841 Bacteria 11934
106 Ga0068863_100362675 3300005841 Bacteria 1413
107 Ga0068858_100002137 3300005842 Bacteria 20025
108 Ga0068858_100019006 3300005842 Bacteria 6429
109 Ga0068858_100355688 3300005842 Bacteria 1403
110 Ga0068858_100497008 3300005842 Bacteria 1178
111 Ga0068858_100586693 3300005842 Bacteria 1080
112 Ga0068860_100001313 3300005843 Bacteria 27011
113 Ga0068860_100003307 3300005843 Bacteria 16588
114 Ga0068860_100056344 3300005843 Bacteria 3737
115 Ga0068862_100000600 3300005844 Bacteria 37473
116 Ga0068862_100018050 3300005844 Bacteria 5876
117 Ga0068862_100347057 3300005844 Bacteria 1376
118 Ga0068862_100367536 3300005844 Bacteria 1338
119 Ga0068862_100680961 3300005844 Bacteria 994
120 Ga0081455_10060756 3300005937 Bacteria 3184
121 Ga0081455_10272036 3300005937 Bacteria 1228
122 Ga0081538_10122078 3300005981 Bacteria 1249
123 Ga0075365_10005990 3300006038 Bacteria 6636
124 Ga0075365_10025868 3300006038 Bacteria 3719
125 Ga0075365_10220300 3300006038 Bacteria 1331
126 Ga0075363_100005004 3300006048 Bacteria 5862
127 Ga0075363_100007115 3300006048 Bacteria 5120
128 Ga0075363_100008467 3300006048 Bacteria 4790
129 Ga0075363_100039462 3300006048 Bacteria 2485
130 Ga0075364_10003099 3300006051 Bacteria 9405
131 Ga0075364_10006687 3300006051 Bacteria 6798
132 Ga0075364_10009037 3300006051 Bacteria 5969
133 Ga0075364_10035219 3300006051 Bacteria 3234
134 Ga0075364_10086758 3300006051 Bacteria 2074
135 Ga0075364_10325472 3300006051 Bacteria 1047
136 Ga0075364_10619964 3300006051 Bacteria 739
137 Ga0070715_10010617 3300006163 Bacteria 3289
138 Ga0070715_10018975 3300006163 Bacteria 2630
139 Ga0070716_100104845 3300006173 Bacteria 1741
140 Ga0070716_100143322 3300006173 Bacteria 1527
141 Ga0070712_100001935 3300006175 Bacteria 12677
142 Ga0070712_100055037 3300006175 Bacteria 2784
143 Ga0075362_10001161 3300006177 Bacteria 8234
144 Ga0075362_10030476 3300006177 Bacteria 2329
145 Ga0075362_10035310 3300006177 Bacteria 2182
146 Ga0075367_10021303 3300006178 Bacteria 3620
147 Ga0075367_10198850 3300006178 Bacteria 1252
148 Ga0075369_10002559 3300006186 Bacteria 6513
149 Ga0075369_10054902 3300006186 Bacteria 1730
150 Ga0075369_10062358 3300006186 Bacteria 1628
151 Ga0097621_100214939 3300006237 Bacteria 1673
152 Ga0075370_10012376 3300006353 Bacteria 4507
153 Ga0075370_10018513 3300006353 Bacteria 3780
154 Ga0075370_10249452 3300006353 Bacteria 1052
155 Ga0068871_100149445 3300006358 Bacteria 1991
156 Ga0075428_100008204 3300006844 Bacteria 11585
157 Ga0075430_100043865 3300006846 Bacteria 3782
158 Ga0075431_100168928 3300006847 Bacteria 2248
159 Ga0068865_100001047 3300006881 Bacteria 15890
160 Ga0097620_100002349 3300006931 Bacteria 19240
161 Ga0097620_100004387 3300006931 Bacteria 14388
162 Ga0097620_100509546 3300006931 Bacteria 1298
163 Ga0105250_10105982 3300009092 Bacteria 1149
164 Ga0111539_10955786 3300009094 Bacteria 996
165 Ga0105245_10005013 3300009098 Bacteria 11639
166 Ga0105245_10087946 3300009098 Bacteria 2853
167 Ga0105247_10000363 3300009101 Bacteria 38715
168 Ga0105247_10001907 3300009101 Bacteria 14560
169 Ga0105247_10278140 3300009101 Bacteria 1154
170 Ga0114129_10183477 3300009147 Bacteria 2846
171 Ga0114129_10310238 3300009147 Bacteria 2100
172 Ga0105243_10004058 3300009148 Bacteria 11664
173 Ga0105243_10016115 3300009148 Bacteria 5654
174 Ga0105242_10002171 3300009176 Bacteria 15466
175 Ga0105242_10273360 3300009176 Bacteria 1531
176 Ga0105248_10002634 3300009177 Bacteria 19960
177 Ga0105248_10106414 3300009177 Bacteria 3162
178 Ga0105248_10277857 3300009177 Bacteria 1885
179 Ga0105237_10005561 3300009545 Bacteria 14215
180 Ga0105237_10012513 3300009545 Bacteria 8938
181 Ga0105237_10172197 3300009545 Bacteria 2165
182 Ga0105237_10214342 3300009545 Bacteria 1925
183 Ga0105238_10311748 3300009551 Bacteria 1558
184 Ga0105249_10000563 3300009553 Bacteria 34180
185 Ga0105249_10001694 3300009553 Bacteria 19302
186 Ga0105249_10007070 3300009553 Bacteria 9794
187 Ga0105249_11456409 3300009553 Bacteria 757
188 Ga0105239_10008351 3300010375 Bacteria 11796
189 Ga0105239_10014074 3300010375 Bacteria 8881
190 Ga0105239_10030476 3300010375 Bacteria 5930
191 Ga0105239_10095238 3300010375 Bacteria 3289
192 Ga0105239_10120759 3300010375 Bacteria 2910
193 Ga0105239_10315626 3300010375 Bacteria 1762
194 Ga0105239_10658385 3300010375 Bacteria 1196
195 Ga0105246_10047873 3300011119 Bacteria 2922
196 Ga0157338_1039723 3300012515 Bacteria 636
197 Ga0157371_10151806 3300013102 Bacteria 1652
198 Ga0157369_10135348 3300013105 Bacteria 2609
199 Ga0157369_10736632 3300013105 Bacteria 1014
200 Ga0157374_10087827 3300013296 Bacteria 2961
201 Ga0157378_10001722 3300013297 Bacteria 19648
202 Ga0157378_10812587 3300013297 Bacteria 961
203 Ga0163162_10005316 3300013306 Bacteria 12423
204 Ga0163162_10011165 3300013306 Bacteria 8750
205 Ga0163162_10064588 3300013306 Bacteria 3705
206 Ga0163162_10213117 3300013306 Bacteria 2061
207 Ga0163162_10591858 3300013306 Bacteria 1236
208 Ga0157372_10024000 3300013307 Bacteria 6616
209 Ga0157372_10088546 3300013307 Bacteria 3515
210 Ga0157372_10387501 3300013307 Bacteria 1628
211 Ga0157375_10027214 3300013308 Bacteria 5342
212 Ga0157375_10069268 3300013308 Bacteria 3533
213 Ga0163163_10234225 3300014325 Bacteria 1885
214 Ga0163163_10552972 3300014325 Bacteria 1213
215 Ga0157380_10000677 3300014326 Bacteria 21112
216 Ga0157380_10239646 3300014326 Bacteria 1634
217 Ga0157377_10023705 3300014745 Bacteria 3256
218 Ga0157379_10002543 3300014968 Bacteria 15302
219 Ga0157379_10080813 3300014968 Bacteria 2912
220 Ga0157379_10217089 3300014968 Bacteria 1732
221 Ga0157379_10312106 3300014968 Bacteria 1435
222 Ga0157376_10145424 3300014969 Bacteria 2132
223 Ga0157376_10248240 3300014969 Bacteria 1661
224 Ga0163161_10023999 3300017792 Bacteria 4305
225 Ga0206353_10939220 3300020082 Bacteria 5587
226 Ga0209673_1048437 3300025273 Bacteria 1144
227 Ga0209051_1000333 3300025303 Bacteria 70796
228 Ga0209051_1000789 3300025303 Bacteria 33294
229 Ga0209051_1005924 3300025303 Bacteria 7014
230 Ga0209051_1007120 3300025303 Bacteria 6175
231 Ga0209051_1095010 3300025303 Bacteria 818
232 Ga0207696_1034653 3300025711 Bacteria 1506
233 Ga0207692_10070301 3300025898 Bacteria 1842
234 Ga0207642_10000269 3300025899 Bacteria 15626
235 Ga0207710_10000309 3300025900 Bacteria 38647
236 Ga0207710_10009478 3300025900 Bacteria 4095
237 Ga0207710_10046576 3300025900 Bacteria 1936
238 Ga0207710_10188290 3300025900 Bacteria 1015
239 Ga0207688_10000386 3300025901 Bacteria 20634
240 Ga0207688_10016423 3300025901 Bacteria 4014
241 Ga0207680_10042595 3300025903 Bacteria 2657
242 Ga0207647_10037694 3300025904 Bacteria 3063
243 Ga0207647_10062641 3300025904 Bacteria 2265
244 Ga0207685_10011097 3300025905 Bacteria 2694
245 Ga0207685_10012483 3300025905 Bacteria 2594
246 Ga0207699_10223243 3300025906 Bacteria 1287
247 Ga0207654_10142815 3300025911 Bacteria 1528
248 Ga0207671_10020290 3300025914 Bacteria 5062
249 Ga0207671_10130074 3300025914 Bacteria 1932
250 Ga0207693_10003754 3300025915 Bacteria 12951
251 Ga0207693_10004543 3300025915 Bacteria 11719
252 Ga0207663_10000986 3300025916 Bacteria 13008
253 Ga0207663_10051096 3300025916 Bacteria 2572
254 Ga0207662_10149187 3300025918 Bacteria 1486
255 Ga0207657_10016190 3300025919 Bacteria 7198
256 Ga0207657_10302768 3300025919 Bacteria 1266
257 Ga0207681_10004311 3300025923 Bacteria 8782
258 Ga0207681_10019273 3300025923 Bacteria 4309
259 Ga0207681_10320549 3300025923 Bacteria 1232
260 Ga0207659_10079163 3300025926 Bacteria 2424
261 Ga0207687_10007109 3300025927 Bacteria 7379
262 Ga0207687_10466603 3300025927 Bacteria 1049
263 Ga0207687_10496999 3300025927 Bacteria 1018
264 Ga0207664_10030906 3300025929 Bacteria 4093
265 Ga0207644_10058807 3300025931 Bacteria 2779
266 Ga0207690_10065449 3300025932 Bacteria 2486
267 Ga0207706_10007577 3300025933 Bacteria 10040
268 Ga0207706_10031936 3300025933 Bacteria 4691
269 Ga0207686_10118367 3300025934 Bacteria 1799
270 Ga0207686_10214337 3300025934 Bacteria 1386
271 Ga0207709_10002447 3300025935 Bacteria 11659
272 Ga0207670_10006717 3300025936 Bacteria 6398
273 Ga0207669_10003680 3300025937 Bacteria 6662
274 Ga0207669_10128850 3300025937 Bacteria 1734
275 Ga0207704_10001011 3300025938 Bacteria 12469
276 Ga0207704_10117680 3300025938 Bacteria 1811
277 Ga0207665_10004904 3300025939 Bacteria 8919
278 Ga0207665_10031780 3300025939 Bacteria 3494
279 Ga0207665_10201554 3300025939 Bacteria 1450
280 Ga0207691_10115776 3300025940 Bacteria 2380
281 Ga0207691_10174384 3300025940 Bacteria 1881
282 Ga0207711_10002488 3300025941 Bacteria 16445
283 Ga0207711_10205326 3300025941 Bacteria 1799
284 Ga0207711_10288906 3300025941 Bacteria 1511
285 Ga0207689_10164839 3300025942 Bacteria 1826
286 Ga0207667_10184156 3300025949 Bacteria 2144
287 Ga0207651_10111693 3300025960 Bacteria 2053
288 Ga0207712_10000016 3300025961 Bacteria 343014
289 Ga0207712_10015764 3300025961 Bacteria 4881
290 Ga0207712_10022184 3300025961 Bacteria 4177
291 Ga0207668_10003246 3300025972 Bacteria 9534
292 Ga0207668_10011508 3300025972 Bacteria 5380
293 Ga0207668_10059760 3300025972 Bacteria 2672
294 Ga0207640_10005950 3300025981 Bacteria 6660
295 Ga0207658_10002173 3300025986 Bacteria 14582
296 Ga0207658_10002895 3300025986 Bacteria 12300
297 Ga0207658_10063240 3300025986 Bacteria 2773
298 Ga0207658_10067125 3300025986 Bacteria 2700
299 Ga0207658_10104130 3300025986 Bacteria 2229
300 Ga0207658_10146061 3300025986 Bacteria 1921
301 Ga0207677_10006010 3300026023 Bacteria 6615
302 Ga0207703_10012817 3300026035 Bacteria 6536
303 Ga0207703_10027635 3300026035 Bacteria 4467
304 Ga0207703_10034587 3300026035 Bacteria 4010
305 Ga0207703_10555855 3300026035 Bacteria 1082
306 Ga0207639_10004533 3300026041 Bacteria 9363
307 Ga0207639_10245358 3300026041 Bacteria 1559
308 Ga0207678_10029489 3300026067 Bacteria 4789
309 Ga0207678_10146132 3300026067 Bacteria 2018
310 Ga0207708_10006762 3300026075 Bacteria 8484
311 Ga0207708_10069306 3300026075 Bacteria 2700
312 Ga0207702_10178277 3300026078 Bacteria 1955
313 Ga0207641_10003179 3300026088 Bacteria 14698
314 Ga0207641_10015807 3300026088 Bacteria 6181
315 Ga0207648_10006405 3300026089 Bacteria 11700
316 Ga0207648_10012216 3300026089 Bacteria 8043
317 Ga0207676_10060329 3300026095 Bacteria 3000
318 Ga0207675_100005978 3300026118 Bacteria 11587
319 Ga0207675_100046333 3300026118 Bacteria 4061
320 Ga0207683_10019439 3300026121 Bacteria 5801
321 Ga0207683_10020007 3300026121 Bacteria 5719
322 Ga0207698_10021511 3300026142 Bacteria 4463
323 Ga0207698_10085030 3300026142 Bacteria 2567
324 Ga0268266_10017310 3300028379 Bacteria 6151
325 Ga0268266_10132940 3300028379 Bacteria 2227
326 Ga0268266_11459147 3300028379 Bacteria 660
327 Ga0268265_10000572 3300028380 Bacteria 37490
328 Ga0268265_10393786 3300028380 Bacteria 1278
329 Ga0268264_10000053 3300028381 Bacteria 320368
330 Ga0268264_10007030 3300028381 Bacteria 9441
331 Ga0265327_10002859 3300031251 Bacteria 17383
332 Ga0307410_10423174 3300031852 Bacteria 1081
333 Ga0307409_100999199 3300031995 Bacteria 855
334 Ga0373948_0040793 3300034817 Bacteria 970
335 Ga0373938_0010030 3300034957 Bacteria 1730
336 Ga0373932_0062927 3300035112 Bacteria 1132
337 Ga0373931_0004521 3300035691 Bacteria 6362
338 Ga0373931_0080402 3300035691 Bacteria 1797
339 Ga0436365_0810711 3300039437 Bacteria 50192
340 Ga0436365_1566470 3300039437 Bacteria 2204
341 Ga0439461_0003032 3300041410 Bacteria 2737
342 Ga0439461_0011102 3300041410 Bacteria 1666
343 Ga0439466_0003473 3300041411 Bacteria 6107
344 Ga0439466_0021863 3300041411 Bacteria 2262
345 Ga0439465_0001767 3300041413 Bacteria 7071
346 Ga0439465_0004399 3300041413 Bacteria 4557
347 Ga0439431_0011486 3300041997 Bacteria 2024
348 Ga0439431_0019280 3300041997 Bacteria 1620
349 Ga0439431_0020791 3300041997 Bacteria 1571
350 Ga0439442_004045 3300042002 Bacteria 2907
351 Ga0439442_031365 3300042002 Bacteria 1110
352 Ga0439445_0002964 3300042004 Bacteria 3795
353 Ga0439445_0004460 3300042004 Bacteria 3172
354 Ga0439445_0083472 3300042004 Bacteria 894
355 Ga0439459_0006872 3300042438 Bacteria 1908
356 Ga0466972_0001909 3300044658 Bacteria 10228
357 Ga0466972_0002904 3300044658 Bacteria 8485
358 Ga0466972_0078376 3300044658 Bacteria 1574
359 Ga0466965_0012006 3300044683 Bacteria 4065
360 Ga0466965_0107803 3300044683 Bacteria 1429
361 Ga0466966_0012004 3300044684 Bacteria 5740
362 Ga0466961_0040984 3300044693 Bacteria 2968
363 Ga0466964_0170517 3300044706 Bacteria 1024
364 Ga0466968_0001329 3300044735 Bacteria 8841
365 Ga0466970_0040234 3300044765 Bacteria 2482
366 Ga0466957_0002478 3300044842 Bacteria 9915
367 Ga0466957_0039912 3300044842 Bacteria 2833
368 Ga0466957_0482685 3300044842 Bacteria 857
369 Ga0466960_0001301 3300044901 Bacteria 9051
370 Ga0466960_0013794 3300044901 Bacteria 3442
371 Ga0466959_0054136 3300045049 Bacteria 2932
372 Ga0466967_0005866 3300045976 Bacteria 8596
373 Ga0466967_0028739 3300045976 Bacteria 4646
374 Ga0466967_0154506 3300045976 Bacteria 2148
375 Ga0466967_0308016 3300045976 Bacteria 1525
376 Ga0495592_0446759 3300046454 Bacteria 811
377 Ga0495603_0025172 3300046455 Bacteria 3599
378 Ga0495629_0041645 3300046459 Bacteria 3231
379 Ga0495638_0035979 3300046460 Bacteria 3154
380 Ga0495641_0037269 3300046461 Bacteria 2280
381 Ga0495662_0237522 3300046476 Bacteria 898
382 Ga0495594_0066750 3300046499 Bacteria 1996
383 Ga0495606_0029848 3300046507 Bacteria 3821
384 Ga0495606_0182013 3300046507 Bacteria 1211
385 Ga0495630_0385763 3300046517 Bacteria 1073
386 Ga0495665_0013122 3300046531 Bacteria 4484
387 Ga0495640_0136995 3300046533 Bacteria 1580
388 Ga0495668_0031699 3300046616 Bacteria 2979
389 Ga0495668_0051779 3300046616 Bacteria 2273
390 Ga0495658_0009901 3300046683 Bacteria 4755
391 Ga0495613_0097894 3300046689 Bacteria 2120
392 Ga0495624_0016795 3300046690 Bacteria 4926
393 Ga0495581_0013424 3300047315 Bacteria 4751
394 Ga0495672_0003590 3300047320 Bacteria 13179
395 Ga0495672_0069676 3300047320 Bacteria 1996
396 Ga0495672_0078077 3300047320 Bacteria 1853
397 Ga0495673_0001212 3300047469 Bacteria 21466
398 Ga0495686_0001798 3300047472 Bacteria 21725
399 Ga0495593_0015351 3300047673 Bacteria 4341
400 Ga0496100_0000157 3300048903 Bacteria 38109
401 Ga0496100_0021728 3300048903 Bacteria 3871
402 Ga0496100_0034020 3300048903 Bacteria 3193
403 Ga0496100_0178118 3300048903 Bacteria 1536
404 Ga0496100_0468830 3300048903 Bacteria 967
405 Ga0496101_0000295 3300048904 Bacteria 34847
406 Ga0496101_0000353 3300048904 Bacteria 31006
407 Ga0496101_0011555 3300048904 Bacteria 5863
408 Ga0496101_0050146 3300048904 Bacteria 3003
409 Ga0496101_0121655 3300048904 Bacteria 1974
410 Ga0496101_0329040 3300048904 Bacteria 1199
411 Ga0496101_0482642 3300048904 Bacteria 979
412 Ga0496102_0000239 3300048905 Bacteria 72112
413 Ga0496102_0000989 3300048905 Bacteria 26703
414 Ga0496102_0001510 3300048905 Bacteria 20529
415 Ga0496102_0015532 3300048905 Bacteria 6634
416 Ga0496102_0070711 3300048905 Bacteria 3204
417 Ga0496102_0132374 3300048905 Bacteria 2335
418 Ga0496102_0765040 3300048905 Bacteria 888
419 Ga0496102_0937460 3300048905 Bacteria 787
420 Ga0496103_0000148 3300048906 Bacteria 72710
421 Ga0496103_0000679 3300048906 Bacteria 25570
422 Ga0496103_0000893 3300048906 Bacteria 21538
423 Ga0496103_0001188 3300048906 Bacteria 17875
424 Ga0496103_0040113 3300048906 Bacteria 2877
425 Ga0496104_0004587 3300048907 Bacteria 12041
426 Ga0496104_0007268 3300048907 Bacteria 9774
427 Ga0496104_0414427 3300048907 Bacteria 1259
428 Ga0496104_0455792 3300048907 Bacteria 1191
429 Ga0496104_0564573 3300048907 Bacteria 1049
430 Ga0496105_0010330 3300048908 Bacteria 7340
431 Ga0496106_0001150 3300048909 Bacteria 19607
432 Ga0496106_0001306 3300048909 Bacteria 18697
433 Ga0496106_0053343 3300048909 Bacteria 3054
434 Ga0496106_0053381 3300048909 Bacteria 3052
435 Ga0496106_0082543 3300048909 Bacteria 2470
436 Ga0496106_0138440 3300048909 Bacteria 1913
437 Ga0496107_0004199 3300048910 Bacteria 9731
438 Ga0496107_0005559 3300048910 Bacteria 8634
439 Ga0496107_0010525 3300048910 Bacteria 6427
440 Ga0496107_0010714 3300048910 Bacteria 6376
441 Ga0496107_0102301 3300048910 Bacteria 2101
442 Ga0496107_0632241 3300048910 Bacteria 790
443 Ga0496108_0001205 3300048911 Bacteria 20278
444 Ga0496108_0009737 3300048911 Bacteria 7787
445 Ga0496108_0057697 3300048911 Bacteria 3262
446 Ga0496108_0196218 3300048911 Bacteria 1751
447 Ga0496108_0303463 3300048911 Bacteria 1391
448 Ga0496109_0000200 3300048912 Bacteria 59537
449 Ga0496109_0008607 3300048912 Bacteria 8686
450 Ga0496109_0010910 3300048912 Bacteria 7783
451 Ga0496109_0014798 3300048912 Bacteria 6788
452 Ga0496109_0063941 3300048912 Bacteria 3366
453 Ga0496109_0198474 3300048912 Bacteria 1886
454 Ga0496109_0709691 3300048912 Bacteria 943
455 Ga0496109_0902655 3300048912 Bacteria 822
456 Ga0496110_0062765 3300048913 Bacteria 3282
457 Ga0496110_0100954 3300048913 Bacteria 2586
458 Ga0496110_0107889 3300048913 Bacteria 2500
459 Ga0496110_0168736 3300048913 Bacteria 1985
460 Ga0496110_0227710 3300048913 Bacteria 1695
461 Ga0496111_0325819 3300048914 Bacteria 1137
462 Ga0496112_0013863 3300048915 Bacteria 7456
463 Ga0496112_0086446 3300048915 Bacteria 3102
464 Ga0496112_0095431 3300048915 Bacteria 2944
465 Ga0496112_0272982 3300048915 Bacteria 1639
466 Ga0496112_0880972 3300048915 Bacteria 818
467 Ga0496113_0022741 3300048916 Bacteria 4439
468 Ga0496113_0069292 3300048916 Bacteria 2679
469 Ga0496113_0079352 3300048916 Bacteria 2513
470 Ga0496113_0174748 3300048916 Bacteria 1702
471 Ga0496113_0518033 3300048916 Bacteria 957
472 Ga0496114_0000560 3300048917 Bacteria 27551
473 Ga0496114_0002369 3300048917 Bacteria 14347
474 Ga0496114_0003944 3300048917 Bacteria 11443
475 Ga0496114_0086551 3300048917 Bacteria 2656
476 Ga0496114_0241589 3300048917 Bacteria 1588
477 Ga0496114_0932623 3300048917 Bacteria 750
478 Ga0496115_0001604 3300048918 Bacteria 16241
479 Ga0496115_0004966 3300048918 Bacteria 9662
480 Ga0496115_0006045 3300048918 Bacteria 8839
481 Ga0496116_0000355 3300048919 Bacteria 72106
482 Ga0496116_0002885 3300048919 Bacteria 17589
483 Ga0496116_0021126 3300048919 Bacteria 4917
484 Ga0496117_0000051 3300048920 Bacteria 285716
485 Ga0496117_0001798 3300048920 Bacteria 29146
486 Ga0496117_0003276 3300048920 Bacteria 19004
487 Ga0496118_0000043 3300048921 Bacteria 285716
488 Ga0496118_0006591 3300048921 Bacteria 12680
489 Ga0496118_0034666 3300048921 Bacteria 4112
490 Ga0496118_0201809 3300048921 Bacteria 1177
491 Ga0496119_0000990 3300048922 Bacteria 36498
492 Ga0496119_0009504 3300048922 Bacteria 8333
493 Ga0496119_0011289 3300048922 Bacteria 7420
494 Ga0496120_0001994 3300048923 Bacteria 22232
495 Ga0496120_0013760 3300048923 Bacteria 5429
496 Ga0496120_0029092 3300048923 Bacteria 3376
497 Ga0496121_0000134 3300048924 Bacteria 165728
498 Ga0496121_0003652 3300048924 Bacteria 21640
499 Ga0496121_0005390 3300048924 Bacteria 16432
500 Ga0496121_0292160 3300048924 Bacteria 1110
501 Ga0496122_0001041 3300048925 Bacteria 48644
502 Ga0496122_0036161 3300048925 Bacteria 4000
503 Ga0496123_0011690 3300048926 Bacteria 7573
504 Ga0496123_0012707 3300048926 Bacteria 7145
505 Ga0496124_0000113 3300048927 Bacteria 165710
506 Ga0496124_0050803 3300048927 Bacteria 3530
507 Ga0496125_0000127 3300048928 Bacteria 165710
508 Ga0496125_0138107 3300048928 Bacteria 1700
509 Ga0496125_0189725 3300048928 Bacteria 1359
510 Ga0496125_0289029 3300048928 Bacteria 1011
511 Ga0496126_0000140 3300048929 Bacteria 165728
512 Ga0496126_0005587 3300048929 Bacteria 14302
513 Ga0496126_0007544 3300048929 Bacteria 11904
514 Ga0496126_0016139 3300048929 Bacteria 7482
515 Ga0496126_0232714 3300048929 Bacteria 1543
516 Ga0501031_0003447 3300049568 Bacteria 10150
517 Ga0501032_0002379 3300049569 Bacteria 14689
518 Ga0501033_0178914 3300049570 Bacteria 1521
519 Ga0501034_0160692 3300049571 Bacteria 2218
520 Ga0501036_0122432 3300049572 Bacteria 2197
521 Ga0501037_0054219 3300049573 Bacteria 2932
522 Ga0501038_0004550 3300049574 Bacteria 12903
523 Ga0501043_0001575 3300049579 Bacteria 19859
524 Ga0501047_0030525 3300049581 Bacteria 5195
525 Ga0501047_0089491 3300049581 Bacteria 2955
526 Ga0501047_0237802 3300049581 Bacteria 1673
527 Ga0501048_0000405 3300049582 Bacteria 30043
528 Ga0501069_0017284 3300049585 Bacteria 3880
529 Ga0501069_0498568 3300049585 Bacteria 726
530 Ga0501070_0006466 3300049586 Bacteria 9975
531 Ga0501070_0090204 3300049586 Bacteria 2537
532 Ga0501073_0362586 3300049589 Bacteria 1001
533 Ga0501080_0377785 3300049742 Bacteria 1277
534 Ga0501035_0028944 3300049822 Bacteria 5054
535 Ga0501035_0394549 3300049822 Bacteria 1152
536 Ga0501044_0059308 3300049823 Bacteria 3921
537 nmdc:mga03683_26415_c1 3300050489 Bacteria 2290
538 nmdc:mga03683_34662_c1 3300050489 Bacteria 2043
539 nmdc:mga03n38_29421_c1 3300050490 Bacteria 2299
540 nmdc:mga03n38_66624_c1 3300050490 Bacteria 1655
541 nmdc:mga03n38_8153_c1 3300050490 Bacteria 3744
542 nmdc:mga03n38_82904_c1 3300050490 Bacteria 1511
543 nmdc:mga03n38_96759_c1 3300050490 Bacteria 1416
544 nmdc:mga00v17_125605_c1 3300050491 Bacteria 1637
545 nmdc:mga00v17_24007_c1 3300050491 Bacteria 3532
546 nmdc:mga00v17_34821_c1 3300050491 Bacteria 2994
547 nmdc:mga00v17_3497_c1 3300050491 Bacteria 8132
548 nmdc:mga00v17_45137_c1 3300050491 Bacteria 2661
549 nmdc:mga00v17_52936_c1 3300050491 Bacteria 2473
550 nmdc:mga00v17_73736_c1 3300050491 Bacteria 2120
551 nmdc:mga0yw44_16163_c2 3300050492 Bacteria 1515
552 nmdc:mga0yw44_583908_c1 3300050492 Bacteria 759
553 nmdc:mga0yw44_63128_c1 3300050492 Bacteria 2277
554 nmdc:mga0yw44_81530_c1 3300050492 Bacteria 2028
555 nmdc:mga0k408_379439_c1 3300050493 Bacteria 842
556 nmdc:mga06z11_12513_c1 3300050494 Bacteria 3693
557 nmdc:mga06z11_44238_c1 3300050494 Bacteria 2244
558 nmdc:mga04h51_249779_c1 3300050495 Bacteria 710
559 nmdc:mga07m45_147871_c1 3300050496 Bacteria 1362
560 nmdc:mga07m45_18610_c1 3300050496 Bacteria 3753
561 nmdc:mga07m45_39097_c1 3300050496 Bacteria 2650
562 nmdc:mga07m45_47488_c1 3300050496 Bacteria 2414
563 nmdc:mga07m45_640_c1 3300050496 Bacteria 14898
564 nmdc:mga05p37_247155_c1 3300050507 Bacteria 2141
565 nmdc:mga0qj67_35865_c1 3300050509 Bacteria 3878
566 nmdc:mga0qj67_8143_c1 3300050509 Bacteria 7763
567 nmdc:mga06r32_199765_c1 3300050510 Bacteria 1987
568 nmdc:mga0sz30_1251_c1 3300050516 Bacteria 9089
569 nmdc:mga0sz30_249324_c1 3300050516 Bacteria 790
570 nmdc:mga0sz30_57489_c1 3300050516 Bacteria 1657
571 nmdc:mga0sz30_6957_c1 3300050516 Bacteria 4226
572 nmdc:mga0sz30_9162_c1 3300050516 Bacteria 3757
573 Ga0495601_0417078 3300053077 Bacteria 870
574 Ga0500610_0025065 3300053079 Bacteria 2971
575 Ga0500635_0151520 3300053080 Bacteria 885
576 Ga0500578_0271214 3300053086 Bacteria 1015
577 Ga0500643_007549 3300053087 Bacteria 4366
578 Ga0500641_0195517 3300053096 Bacteria 865
579 Ga0500556_0015286 3300053104 Bacteria 2364
580 Ga0500556_0052496 3300053104 Bacteria 1479
581 Ga0500652_000827 3300053131 Bacteria 10302
582 Ga0500658_0085517 3300053134 Bacteria 1356
583 Ga0500559_0005382 3300053136 Bacteria 5893
584 Ga0500568_0060643 3300053139 Bacteria 1465
585 Ga0500616_0006205 3300053153 Bacteria 7885
586 Ga0500616_0029694 3300053153 Bacteria 3007
587 Ga0500645_000006 3300053730 Bacteria 276677
588 Ga0500645_042903 3300053730 Bacteria 1333
589 Ga0466962_0018715 3300061719 Bacteria 3330
590 2644491448 2643221687 Bacteria 6500351
591 2644634781 2643221715 Bacteria 6671032
592 2738704133 2738541274 Bacteria 6909446
593 2739146863 2738541356 Bacteria 5935017
594 2739331383 2738543028 Bacteria 6917070
595 2739367372 2738543034 Bacteria 6084756
596 2776375072 2775506925 Bacteria 7237746
597 2863072266 2863067949 Bacteria 8541735
598 2891328328 2891326441 Bacteria 6439512
599 2902793630 2902792274 Bacteria 7270173
600 2902811135 2902810491 Bacteria 6794147
601 2902838191 2902837492 Bacteria 6697721
602 2904770220 2904765812 Bacteria 5369154
603 2904771625 2904770941 Bacteria 5580202
604 2908812415 2908811453 Bacteria 5478616
605 2919422877 2919420072 Bacteria 5390363
606 2919435485 2919432681 Bacteria 5390474
607 2929215678 2929212328 Bacteria 7708288
608 8056212926 8056207758 Bacteria 8639239
609 Ga0157315_1002353
610 JGI24749J21850_1011458
611 JGI24744J21845_10001133
612 JGI24742J22300_10007032
613 rootH2_10214696
614 Ga0055540_1000147
615 Ga0055540_1001059
616 Ga0055540_1002003
617 Ga0055540_1011935
618 Ga0070690_100204653
619 Ga0070690_100541893
620 Ga0068869_100190409
621 Ga0070666_10061937
622 Ga0070682_100009138
623 Ga0070682_100128917
624 Ga0070682_100300279
625 Ga0068868_100003016
626 Ga0068868_100119293
627 Ga0070660_100297766
628 Ga0070689_100008366
629 Ga0070689_100417923
630 Ga0070691_10015107
631 Ga0070687_100036368
632 Ga0070692_10113289
633 Ga0070668_100001818
634 Ga0070668_100011080
635 Ga0070668_100067132
636 Ga0070669_100003102
637 Ga0070675_100118496
638 Ga0070675_100150667
639 Ga0070671_100098634
640 Ga0070674_100168617
641 Ga0070673_100019084
642 Ga0070688_100006038
643 Ga0070659_100083957
644 Ga0070659_100285120
645 Ga0070667_100000905
646 Ga0070667_100017717
647 Ga0070667_100018290
648 Ga0070667_100127844
649 Ga0070667_100431108
650 Ga0070709_10133553
651 Ga0070714_100177100
652 Ga0070714_100295359
653 Ga0070714_100309002
654 Ga0070714_100437490
655 Ga0070714_100630559
656 Ga0070710_10002895
657 Ga0070710_10009958
658 Ga0070710_10106892
659 Ga0070701_10089130
660 Ga0070701_10475304
661 Ga0070711_100001070
662 Ga0070711_100021562
663 Ga0070705_100006220
664 Ga0070700_100014620
665 Ga0070694_100099075
666 Ga0070694_100132099
667 Ga0070663_100038783
668 Ga0070663_100074754
669 Ga0070663_100124098
670 Ga0070663_100315143
671 Ga0070678_100001690
672 Ga0070678_100750304
673 Ga0070662_100017737
674 Ga0070662_100096548
675 Ga0068867_100001579
676 Ga0068867_100080266
677 Ga0070685_10114574
678 Ga0070707_100697457
679 Ga0070679_100439184
680 Ga0068853_100011224
681 Ga0068853_100023541
682 Ga0070672_100151307
683 Ga0070686_100098673
684 Ga0070686_100259599
685 Ga0070695_100024273
686 Ga0070695_100179347
687 Ga0070696_100030613
688 Ga0070693_100041237
689 Ga0070665_100010888
690 Ga0070665_100035016
691 Ga0070665_100085095
692 Ga0070665_100198491
693 Ga0070665_101199153
694 Ga0070704_100002074
695 Ga0068855_100479080
696 Ga0068854_100054624
697 Ga0068854_100229082
698 Ga0068856_100103856
699 Ga0070702_100002091
700 Ga0070702_100037787
701 Ga0068852_100037720
702 Ga0068859_100002349
703 Ga0068859_100004387
704 Ga0068859_100509550
705 Ga0068864_100561123
706 Ga0068866_10000420
707 Ga0068866_10692729
708 Ga0068861_100000698
709 Ga0068861_100118631
710 Ga0068861_100435127
711 Ga0068851_10082350
712 Ga0068863_100005279
713 Ga0068863_100005982
714 Ga0068863_100362675
715 Ga0068858_100002137
716 Ga0068858_100019006
717 Ga0068858_100355688
718 Ga0068858_100497008
719 Ga0068858_100586693
720 Ga0068860_100001313
721 Ga0068860_100003307
722 Ga0068860_100056344
723 Ga0068862_100000600
724 Ga0068862_100018050
725 Ga0068862_100347057
726 Ga0068862_100367536
727 Ga0068862_100680961
728 Ga0081455_10060756
729 Ga0081455_10272036
730 Ga0081538_10122078
731 Ga0075365_10005990
732 Ga0075365_10025868
733 Ga0075365_10220300
734 Ga0075363_100005004
735 Ga0075363_100007115
736 Ga0075363_100008467
737 Ga0075363_100039462
738 Ga0075364_10003099
739 Ga0075364_10006687
740 Ga0075364_10009037
741 Ga0075364_10035219
742 Ga0075364_10086758
743 Ga0075364_10325472
744 Ga0075364_10619964
745 Ga0070715_10010617
746 Ga0070715_10018975
747 Ga0070716_100104845
748 Ga0070716_100143322
749 Ga0070712_100001935
750 Ga0070712_100055037
751 Ga0075362_10001161
752 Ga0075362_10030476
753 Ga0075362_10035310
754 Ga0075367_10021303
755 Ga0075367_10198850
756 Ga0075369_10002559
757 Ga0075369_10054902
758 Ga0075369_10062358
759 Ga0097621_100214939
760 Ga0075370_10012376
761 Ga0075370_10018513
762 Ga0075370_10249452
763 Ga0068871_100149445
764 Ga0075428_100008204
765 Ga0075430_100043865
766 Ga0075431_100168928
767 Ga0068865_100001047
768 Ga0097620_100002349
769 Ga0097620_100004387
770 Ga0097620_100509546
771 Ga0105250_10105982
772 Ga0111539_10955786
773 Ga0105245_10005013
774 Ga0105245_10087946
775 Ga0105247_10000363
776 Ga0105247_10001907
777 Ga0105247_10278140
778 Ga0114129_10183477
779 Ga0114129_10310238
780 Ga0105243_10004058
781 Ga0105243_10016115
782 Ga0105242_10002171
783 Ga0105242_10273360
784 Ga0105248_10002634
785 Ga0105248_10106414
786 Ga0105248_10277857
787 Ga0105237_10005561
788 Ga0105237_10012513
789 Ga0105237_10172197
790 Ga0105237_10214342
791 Ga0105238_10311748
792 Ga0105249_10000563
793 Ga0105249_10001694
794 Ga0105249_10007070
795 Ga0105249_11456409
796 Ga0105239_10008351
797 Ga0105239_10014074
798 Ga0105239_10030476
799 Ga0105239_10095238
800 Ga0105239_10120759
801 Ga0105239_10315626
802 Ga0105239_10658385
803 Ga0105246_10047873
804 Ga0157338_1039723
805 Ga0157371_10151806
806 Ga0157369_10135348
807 Ga0157369_10736632
808 Ga0157374_10087827
809 Ga0157378_10001722
810 Ga0157378_10812587
811 Ga0163162_10005316
812 Ga0163162_10011165
813 Ga0163162_10064588
814 Ga0163162_10213117
815 Ga0163162_10591858
816 Ga0157372_10024000
817 Ga0157372_10088546
818 Ga0157372_10387501
819 Ga0157375_10027214
820 Ga0157375_10069268
821 Ga0163163_10234225
822 Ga0163163_10552972
823 Ga0157380_10000677
824 Ga0157380_10239646
825 Ga0157377_10023705
826 Ga0157379_10002543
827 Ga0157379_10080813
828 Ga0157379_10217089
829 Ga0157379_10312106
830 Ga0157376_10145424
831 Ga0157376_10248240
832 Ga0163161_10023999
833 Ga0206353_10939220
834 Ga0209673_1048437
835 Ga0209051_1000333
836 Ga0209051_1000789
837 Ga0209051_1005924
838 Ga0209051_1007120
839 Ga0209051_1095010
840 Ga0207696_1034653
841 Ga0207692_10070301
842 Ga0207642_10000269
843 Ga0207710_10000309
844 Ga0207710_10009478
845 Ga0207710_10046576
846 Ga0207710_10188290
847 Ga0207688_10000386
848 Ga0207688_10016423
849 Ga0207680_10042595
850 Ga0207647_10037694
851 Ga0207647_10062641
852 Ga0207685_10011097
853 Ga0207685_10012483
854 Ga0207699_10223243
855 Ga0207654_10142815
856 Ga0207671_10020290
857 Ga0207671_10130074
858 Ga0207693_10003754
859 Ga0207693_10004543
860 Ga0207663_10000986
861 Ga0207663_10051096
862 Ga0207662_10149187
863 Ga0207657_10016190
864 Ga0207657_10302768
865 Ga0207681_10004311
866 Ga0207681_10019273
867 Ga0207681_10320549
868 Ga0207659_10079163
869 Ga0207687_10007109
870 Ga0207687_10466603
871 Ga0207687_10496999
872 Ga0207664_10030906
873 Ga0207644_10058807
874 Ga0207690_10065449
875 Ga0207706_10007577
876 Ga0207706_10031936
877 Ga0207686_10118367
878 Ga0207686_10214337
879 Ga0207709_10002447
880 Ga0207670_10006717
881 Ga0207669_10003680
882 Ga0207669_10128850
883 Ga0207704_10001011
884 Ga0207704_10117680
885 Ga0207665_10004904
886 Ga0207665_10031780
887 Ga0207665_10201554
888 Ga0207691_10115776
889 Ga0207691_10174384
890 Ga0207711_10002488
891 Ga0207711_10205326
892 Ga0207711_10288906
893 Ga0207689_10164839
894 Ga0207667_10184156
895 Ga0207651_10111693
896 Ga0207712_10000016
897 Ga0207712_10015764
898 Ga0207712_10022184
899 Ga0207668_10003246
900 Ga0207668_10011508
901 Ga0207668_10059760
902 Ga0207640_10005950
903 Ga0207658_10002173
904 Ga0207658_10002895
905 Ga0207658_10063240
906 Ga0207658_10067125
907 Ga0207658_10104130
908 Ga0207658_10146061
909 Ga0207677_10006010
910 Ga0207703_10012817
911 Ga0207703_10027635
912 Ga0207703_10034587
913 Ga0207703_10555855
914 Ga0207639_10004533
915 Ga0207639_10245358
916 Ga0207678_10029489
917 Ga0207678_10146132
918 Ga0207708_10006762
919 Ga0207708_10069306
920 Ga0207702_10178277
921 Ga0207641_10003179
922 Ga0207641_10015807
923 Ga0207648_10006405
924 Ga0207648_10012216
925 Ga0207676_10060329
926 Ga0207675_100005978
927 Ga0207675_100046333
928 Ga0207683_10019439
929 Ga0207683_10020007
930 Ga0207698_10021511
931 Ga0207698_10085030
932 Ga0268266_10017310
933 Ga0268266_10132940
934 Ga0268266_11459147
935 Ga0268265_10000572
936 Ga0268265_10393786
937 Ga0268264_10000053
938 Ga0268264_10007030
939 Ga0265327_10002859
940 Ga0307410_10423174
941 Ga0307409_100999199
942 Ga0373948_0040793
943 Ga0373938_0010030
944 Ga0373932_0062927
945 Ga0373931_0004521
946 Ga0373931_0080402
947 Ga0436365_0810711
948 Ga0436365_1566470
949 Ga0439461_0003032
950 Ga0439461_0011102
951 Ga0439466_0003473
952 Ga0439466_0021863
953 Ga0439465_0001767
954 Ga0439465_0004399
955 Ga0439431_0011486
956 Ga0439431_0019280
957 Ga0439431_0020791
958 Ga0439442_004045
959 Ga0439442_031365
960 Ga0439445_0002964
961 Ga0439445_0004460
962 Ga0439445_0083472
963 Ga0439459_0006872
964 Ga0466972_0001909
965 Ga0466972_0002904
966 Ga0466972_0078376
967 Ga0466965_0012006
968 Ga0466965_0107803
969 Ga0466966_0012004
970 Ga0466961_0040984
971 Ga0466964_0170517
972 Ga0466968_0001329
973 Ga0466970_0040234
974 Ga0466957_0002478
975 Ga0466957_0039912
976 Ga0466957_0482685
977 Ga0466960_0001301
978 Ga0466960_0013794
979 Ga0466959_0054136
980 Ga0466967_0005866
981 Ga0466967_0028739
982 Ga0466967_0154506
983 Ga0466967_0308016
984 Ga0495592_0446759
985 Ga0495603_0025172
986 Ga0495629_0041645
987 Ga0495638_0035979
988 Ga0495641_0037269
989 Ga0495662_0237522
990 Ga0495594_0066750
991 Ga0495606_0029848
992 Ga0495606_0182013
993 Ga0495630_0385763
994 Ga0495665_0013122
995 Ga0495640_0136995
996 Ga0495668_0031699
997 Ga0495668_0051779
998 Ga0495658_0009901
999 Ga0495613_0097894
1000 Ga0495624_0016795
1001 Ga0495581_0013424
1002 Ga0495672_0003590
1003 Ga0495672_0069676
1004 Ga0495672_0078077
1005 Ga0495673_0001212
1006 Ga0495686_0001798
1007 Ga0495593_0015351
1008 Ga0496100_0000157
1009 Ga0496100_0021728
1010 Ga0496100_0034020
1011 Ga0496100_0178118
1012 Ga0496100_0468830
1013 Ga0496101_0000295
1014 Ga0496101_0000353
1015 Ga0496101_0011555
1016 Ga0496101_0050146
1017 Ga0496101_0121655
1018 Ga0496101_0329040
1019 Ga0496101_0482642
1020 Ga0496102_0000239
1021 Ga0496102_0000989
1022 Ga0496102_0001510
1023 Ga0496102_0015532
1024 Ga0496102_0070711
1025 Ga0496102_0132374
1026 Ga0496102_0765040
1027 Ga0496102_0937460
1028 Ga0496103_0000148
1029 Ga0496103_0000679
1030 Ga0496103_0000893
1031 Ga0496103_0001188
1032 Ga0496103_0040113
1033 Ga0496104_0004587
1034 Ga0496104_0007268
1035 Ga0496104_0414427
1036 Ga0496104_0455792
1037 Ga0496104_0564573
1038 Ga0496105_0010330
1039 Ga0496106_0001150
1040 Ga0496106_0001306
1041 Ga0496106_0053343
1042 Ga0496106_0053381
1043 Ga0496106_0082543
1044 Ga0496106_0138440
1045 Ga0496107_0004199
1046 Ga0496107_0005559
1047 Ga0496107_0010525
1048 Ga0496107_0010714
1049 Ga0496107_0102301
1050 Ga0496107_0632241
1051 Ga0496108_0001205
1052 Ga0496108_0009737
1053 Ga0496108_0057697
1054 Ga0496108_0196218
1055 Ga0496108_0303463
1056 Ga0496109_0000200
1057 Ga0496109_0008607
1058 Ga0496109_0010910
1059 Ga0496109_0014798
1060 Ga0496109_0063941
1061 Ga0496109_0198474
1062 Ga0496109_0709691
1063 Ga0496109_0902655
1064 Ga0496110_0062765
1065 Ga0496110_0100954
1066 Ga0496110_0107889
1067 Ga0496110_0168736
1068 Ga0496110_0227710
1069 Ga0496111_0325819
1070 Ga0496112_0013863
1071 Ga0496112_0086446
1072 Ga0496112_0095431
1073 Ga0496112_0272982
1074 Ga0496112_0880972
1075 Ga0496113_0022741
1076 Ga0496113_0069292
1077 Ga0496113_0079352
1078 Ga0496113_0174748
1079 Ga0496113_0518033
1080 Ga0496114_0000560
1081 Ga0496114_0002369
1082 Ga0496114_0003944
1083 Ga0496114_0086551
1084 Ga0496114_0241589
1085 Ga0496114_0932623
1086 Ga0496115_0001604
1087 Ga0496115_0004966
1088 Ga0496115_0006045
1089 Ga0496116_0000355
1090 Ga0496116_0002885
1091 Ga0496116_0021126
1092 Ga0496117_0000051
1093 Ga0496117_0001798
1094 Ga0496117_0003276
1095 Ga0496118_0000043
1096 Ga0496118_0006591
1097 Ga0496118_0034666
1098 Ga0496118_0201809
1099 Ga0496119_0000990
1100 Ga0496119_0009504
1101 Ga0496119_0011289
1102 Ga0496120_0001994
1103 Ga0496120_0013760
1104 Ga0496120_0029092
1105 Ga0496121_0000134
1106 Ga0496121_0003652
1107 Ga0496121_0005390
1108 Ga0496121_0292160
1109 Ga0496122_0001041
1110 Ga0496122_0036161
1111 Ga0496123_0011690
1112 Ga0496123_0012707
1113 Ga0496124_0000113
1114 Ga0496124_0050803
1115 Ga0496125_0000127
1116 Ga0496125_0138107
1117 Ga0496125_0189725
1118 Ga0496125_0289029
1119 Ga0496126_0000140
1120 Ga0496126_0005587
1121 Ga0496126_0007544
1122 Ga0496126_0016139
1123 Ga0496126_0232714
1124 Ga0501031_0003447
1125 Ga0501032_0002379
1126 Ga0501033_0178914
1127 Ga0501034_0160692
1128 Ga0501036_0122432
1129 Ga0501037_0054219
1130 Ga0501038_0004550
1131 Ga0501043_0001575
1132 Ga0501047_0030525
1133 Ga0501047_0089491
1134 Ga0501047_0237802
1135 Ga0501048_0000405
1136 Ga0501069_0017284
1137 Ga0501069_0498568
1138 Ga0501070_0006466
1139 Ga0501070_0090204
1140 Ga0501073_0362586
1141 Ga0501080_0377785
1142 Ga0501035_0028944
1143 Ga0501035_0394549
1144 Ga0501044_0059308
1145 nmdc:mga03683_26415_c1
1146 nmdc:mga03683_34662_c1
1147 nmdc:mga03n38_29421_c1
1148 nmdc:mga03n38_66624_c1
1149 nmdc:mga03n38_8153_c1
1150 nmdc:mga03n38_82904_c1
1151 nmdc:mga03n38_96759_c1
1152 nmdc:mga00v17_125605_c1
1153 nmdc:mga00v17_24007_c1
1154 nmdc:mga00v17_34821_c1
1155 nmdc:mga00v17_3497_c1
1156 nmdc:mga00v17_45137_c1
1157 nmdc:mga00v17_52936_c1
1158 nmdc:mga00v17_73736_c1
1159 nmdc:mga0yw44_16163_c2
1160 nmdc:mga0yw44_583908_c1
1161 nmdc:mga0yw44_63128_c1
1162 nmdc:mga0yw44_81530_c1
1163 nmdc:mga0k408_379439_c1
1164 nmdc:mga06z11_12513_c1
1165 nmdc:mga06z11_44238_c1
1166 nmdc:mga04h51_249779_c1
1167 nmdc:mga07m45_147871_c1
1168 nmdc:mga07m45_18610_c1
1169 nmdc:mga07m45_39097_c1
1170 nmdc:mga07m45_47488_c1
1171 nmdc:mga07m45_640_c1
1172 nmdc:mga05p37_247155_c1
1173 nmdc:mga0qj67_35865_c1
1174 nmdc:mga0qj67_8143_c1
1175 nmdc:mga06r32_199765_c1
1176 nmdc:mga0sz30_1251_c1
1177 nmdc:mga0sz30_249324_c1
1178 nmdc:mga0sz30_57489_c1
1179 nmdc:mga0sz30_6957_c1
1180 nmdc:mga0sz30_9162_c1
1181 Ga0495601_0417078
1182 Ga0500610_0025065
1183 Ga0500635_0151520
1184 Ga0500578_0271214
1185 Ga0500643_007549
1186 Ga0500641_0195517
1187 Ga0500556_0015286
1188 Ga0500556_0052496
1189 Ga0500652_000827
1190 Ga0500658_0085517
1191 Ga0500559_0005382
1192 Ga0500568_0060643
1193 Ga0500616_0006205
1194 Ga0500616_0029694
1195 Ga0500645_000006
1196 Ga0500645_042903
1197 Ga0466962_0018715
1198 2644491448
1199 2644634781
1200 2738704133
1201 2739146863
1202 2739331383
1203 2739367372
1204 2776375072
1205 2863072266
1206 2891328328
1207 2902793630
1208 2902811135
1209 2902838191
1210 2904770220
1211 2904771625
1212 2908812415
1213 2919422877
1214 2919435485
1215 2929215678
1216 8056212926

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

40

170

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mqw-assembly1.cif.gz_A-2 structure of the mt-adprase in complex with three mn2+ ions and ampcpr, a nudix enzyme 0.9649 22 220
1mqw-assembly1.cif.gz_A-2 structure of the mt-adprase in complex with three mn2+ ions and ampcpr, a nudix enzyme 0.9555 22 220
1mk1-assembly1.cif.gz_A structure of the mt-adprase in complex with adpr, a nudix enzyme 0.9537 24 223
5i8u-assembly4.cif.gz_E crystal structure of the rv1700 (mt adprase) e142q mutant 0.9526 24 221
2w4e-assembly1.cif.gz_B structure of an n-terminally truncated nudix hydrolase dr2204 from deinococcus radiodurans 0.9468 62 194
ID Description Score Start End Superfamily
af_Q2FY72_1_175_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9475 20 194 3.90.79.10
2w4eB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9468 62 194 3.90.79.10
5c8lB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9441 22 194 3.90.79.10
5i8uB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9439 24 223 3.90.79.10
5i8uB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9303 24 223 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A4Q7CQ81-F1-model_v4 NUDIX hydrolase 0.9871 31 194 GO:0005829
GO:0006753
GO:0016787
GO:0019693
AF-A0A1S1JCF0-F1-model_v4 ADP-ribose pyrophosphatase 0.9787 25 172 GO:0005829
GO:0006753
GO:0019693
AF-A0A7X7DD36-F1-model_v4 NUDIX hydrolase 0.9754 18 194 GO:0005829
GO:0006753
GO:0016787
GO:0019693
AF-I6X235-F1-model_v4 ADP-ribose pyrophosphatase (EC 3.6.1.13) (8-oxo-(d)GDP phosphatase) (EC 3.6.1.58) (ADPR hydrolase) (MT-ADPRase) 0.9711 19 223 GO:0005829
GO:0006260
GO:0006281
GO:0006753
GO:0019693
GO:0044715
GO:0044716
GO:0046872
GO:0047631
AF-A0A355L6Z2-F1-model_v4 ADP-ribose pyrophosphatase 0.97 22 195 GO:0005829
GO:0006753
GO:0019693

Map