F468757
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 608 | 217 | 608 | 62 |
Family's Representative Sequence
| Representative Sequence | 3300001989|JGI24739J22299_10009390|JGI24739J22299_100093906 |
| Length | 65 |
| Sequence | MAKSSAIDRAFDLARSGHYRSVSEIIRRLPVDDRAIVEAHLAQPAARRELILICSDAWLSADHGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 8 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 9 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 10 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 11 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 12 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 13 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 14 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 15 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 16 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 17 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 18 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 19 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 28 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 163 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 164 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 165 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 166 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 167 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 168 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 169 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 170 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 171 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 172 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 173 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 174 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 175 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 176 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 177 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 178 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 179 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 180 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 181 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 182 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 183 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 184 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 185 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 186 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 187 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 188 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 189 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 190 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 191 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 192 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 193 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 194 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 204 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 205 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 206 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 207 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 208 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 209 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 210 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 211 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 212 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 213 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 214 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 216 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 217 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.64 |
| Nodule | 0 |
| Rhizoplane | 1.81 |
| Rhizosphere | 93.59 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.96 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1005300 | 3300001904 | Bacteria | 2179 |
| 2 | JGI24741J21665_1009958 | 3300001915 | Bacteria | 1722 |
| 3 | JGI24741J21665_1011557 | 3300001915 | Bacteria | 1538 |
| 4 | JGI24747J21853_1042045 | 3300001978 | Unclassified | 544 |
| 5 | JGI24740J21852_10003183 | 3300001979 | Bacteria | 7247 |
| 6 | JGI24740J21852_10030262 | 3300001979 | Bacteria | 1765 |
| 7 | JGI24740J21852_10098601 | 3300001979 | Bacteria | 746 |
| 8 | JGI24740J21852_10105756 | 3300001979 | Bacteria | 713 |
| 9 | JGI24739J22299_10000035 | 3300001989 | Bacteria | 37844 |
| 10 | JGI24739J22299_10000226 | 3300001989 | Bacteria | 19010 |
| 11 | JGI24739J22299_10002884 | 3300001989 | Bacteria | 6601 |
| 12 | JGI24739J22299_10009390 | 3300001989 | Bacteria | 3644 |
| 13 | JGI24739J22299_10013219 | 3300001989 | Bacteria | 3017 |
| 14 | JGI24739J22299_10213379 | 3300001989 | Unclassified | 566 |
| 15 | JGI24739J22299_10221727 | 3300001989 | Bacteria | 554 |
| 16 | JGI24737J22298_10000020 | 3300001990 | Bacteria | 46324 |
| 17 | JGI24737J22298_10001654 | 3300001990 | Bacteria | 7959 |
| 18 | JGI24737J22298_10087698 | 3300001990 | Bacteria | 924 |
| 19 | JGI24737J22298_10174590 | 3300001990 | Unclassified | 634 |
| 20 | JGI24737J22298_10236500 | 3300001990 | Bacteria | 539 |
| 21 | JGI24743J22301_10011075 | 3300001991 | Bacteria | 1618 |
| 22 | JGI24743J22301_10088907 | 3300001991 | Unclassified | 657 |
| 23 | JGI24735J21928_10000410 | 3300002067 | Bacteria | 14956 |
| 24 | JGI24735J21928_10001761 | 3300002067 | Bacteria | 7614 |
| 25 | JGI24735J21928_10002885 | 3300002067 | Bacteria | 5917 |
| 26 | JGI24735J21928_10005066 | 3300002067 | Bacteria | 4386 |
| 27 | JGI24735J21928_10005516 | 3300002067 | Bacteria | 4195 |
| 28 | JGI24735J21928_10006583 | 3300002067 | Bacteria | 3819 |
| 29 | JGI24735J21928_10019969 | 3300002067 | Bacteria | 2056 |
| 30 | JGI24735J21928_10115648 | 3300002067 | Unclassified | 772 |
| 31 | JGI24748J21848_1008077 | 3300002074 | Bacteria | 1236 |
| 32 | JGI24738J21930_10000050 | 3300002075 | Bacteria | 24055 |
| 33 | JGI24738J21930_10004723 | 3300002075 | Bacteria | 3318 |
| 34 | JGI24738J21930_10004991 | 3300002075 | Bacteria | 3210 |
| 35 | JGI24749J21850_1009490 | 3300002076 | Bacteria | 1360 |
| 36 | JGI24744J21845_10000597 | 3300002077 | Bacteria | 6510 |
| 37 | JGI24744J21845_10033763 | 3300002077 | Unclassified | 973 |
| 38 | JGI24035J26624_1016107 | 3300002126 | Bacteria | 769 |
| 39 | JGI24033J26618_1054937 | 3300002155 | Bacteria | 577 |
| 40 | JGI24034J26672_10005517 | 3300002239 | Bacteria | 1814 |
| 41 | JGI24034J26672_10042179 | 3300002239 | Bacteria | 768 |
| 42 | JGI25164J39214_1011673 | 3300002772 | Bacteria | 839 |
| 43 | JGI25165J46597_1000043 | 3300003214 | Bacteria | 264515 |
| 44 | rootL2_10307941 | 3300003322 | Bacteria | 3580 |
| 45 | Ga0055542_1006341 | 3300003762 | Bacteria | 2540 |
| 46 | Ga0055529_1034584 | 3300003763 | Unclassified | 617 |
| 47 | Ga0070658_10000105 | 3300005327 | Bacteria | 75360 |
| 48 | Ga0070658_10002340 | 3300005327 | Bacteria | 15909 |
| 49 | Ga0070658_10010382 | 3300005327 | Bacteria | 7468 |
| 50 | Ga0070658_10376300 | 3300005327 | Bacteria | 1218 |
| 51 | Ga0070658_10448517 | 3300005327 | Bacteria | 1111 |
| 52 | Ga0070658_10615364 | 3300005327 | Bacteria | 942 |
| 53 | Ga0070658_10774143 | 3300005327 | Bacteria | 833 |
| 54 | Ga0070658_10915381 | 3300005327 | Bacteria | 762 |
| 55 | Ga0070658_11751836 | 3300005327 | Bacteria | 537 |
| 56 | Ga0070658_11997011 | 3300005327 | Bacteria | 500 |
| 57 | Ga0070676_10034535 | 3300005328 | Bacteria | 2904 |
| 58 | Ga0070676_10150929 | 3300005328 | Unclassified | 1487 |
| 59 | Ga0070676_10175818 | 3300005328 | Bacteria | 1388 |
| 60 | Ga0070676_10305685 | 3300005328 | Bacteria | 1080 |
| 61 | Ga0070676_10330695 | 3300005328 | Bacteria | 1042 |
| 62 | Ga0070676_11491700 | 3300005328 | Bacteria | 520 |
| 63 | Ga0070683_100257604 | 3300005329 | Bacteria | 1659 |
| 64 | Ga0070690_101104046 | 3300005330 | Unclassified | 629 |
| 65 | Ga0070690_101249797 | 3300005330 | Unclassified | 594 |
| 66 | Ga0070670_100014177 | 3300005331 | Bacteria | 6839 |
| 67 | Ga0070670_100016985 | 3300005331 | Bacteria | 6248 |
| 68 | Ga0070670_100153515 | 3300005331 | Bacteria | 1993 |
| 69 | Ga0070677_10027489 | 3300005333 | Bacteria | 2142 |
| 70 | Ga0070677_10340714 | 3300005333 | Bacteria | 774 |
| 71 | Ga0070677_10552400 | 3300005333 | Bacteria | 631 |
| 72 | Ga0070677_10716467 | 3300005333 | Bacteria | 565 |
| 73 | Ga0068869_100000043 | 3300005334 | Bacteria | 52392 |
| 74 | Ga0068869_100048853 | 3300005334 | Bacteria | 3061 |
| 75 | Ga0068869_100648954 | 3300005334 | Unclassified | 896 |
| 76 | Ga0068869_100686647 | 3300005334 | Bacteria | 872 |
| 77 | Ga0070666_10082256 | 3300005335 | Bacteria | 2202 |
| 78 | Ga0070666_10138425 | 3300005335 | Bacteria | 1695 |
| 79 | Ga0070666_10156146 | 3300005335 | Bacteria | 1593 |
| 80 | Ga0070666_10742320 | 3300005335 | Bacteria | 721 |
| 81 | Ga0068868_100000149 | 3300005338 | Bacteria | 45719 |
| 82 | Ga0068868_100001402 | 3300005338 | Bacteria | 16620 |
| 83 | Ga0068868_100600288 | 3300005338 | Bacteria | 975 |
| 84 | Ga0068868_101928251 | 3300005338 | Unclassified | 560 |
| 85 | Ga0068868_102425121 | 3300005338 | Unclassified | 501 |
| 86 | Ga0070660_100000415 | 3300005339 | Bacteria | 28402 |
| 87 | Ga0070660_100000816 | 3300005339 | Bacteria | 20682 |
| 88 | Ga0070660_100002945 | 3300005339 | Bacteria | 11711 |
| 89 | Ga0070660_100035953 | 3300005339 | Bacteria | 3750 |
| 90 | Ga0070660_100037728 | 3300005339 | Bacteria | 3663 |
| 91 | Ga0070660_100259556 | 3300005339 | Bacteria | 1418 |
| 92 | Ga0070660_100282521 | 3300005339 | Bacteria | 1358 |
| 93 | Ga0070660_100431694 | 3300005339 | Bacteria | 1091 |
| 94 | Ga0070660_100458177 | 3300005339 | Bacteria | 1058 |
| 95 | Ga0070660_100994775 | 3300005339 | Bacteria | 708 |
| 96 | Ga0070689_100047067 | 3300005340 | Bacteria | 3325 |
| 97 | Ga0070687_100502791 | 3300005343 | Bacteria | 816 |
| 98 | Ga0070661_100012789 | 3300005344 | Bacteria | 5877 |
| 99 | Ga0070661_100023604 | 3300005344 | Bacteria | 4409 |
| 100 | Ga0070661_100176000 | 3300005344 | Bacteria | 1626 |
| 101 | Ga0070661_100583845 | 3300005344 | Bacteria | 902 |
| 102 | Ga0070661_101513762 | 3300005344 | Unclassified | 566 |
| 103 | Ga0070661_101898358 | 3300005344 | Unclassified | 506 |
| 104 | Ga0070668_100045674 | 3300005347 | Unclassified | 3361 |
| 105 | Ga0070668_100155474 | 3300005347 | Bacteria | 1852 |
| 106 | Ga0070669_100000209 | 3300005353 | Bacteria | 48982 |
| 107 | Ga0070669_100028859 | 3300005353 | Bacteria | 3997 |
| 108 | Ga0070669_100554231 | 3300005353 | Bacteria | 959 |
| 109 | Ga0070675_100004052 | 3300005354 | Bacteria | 11123 |
| 110 | Ga0070675_100016633 | 3300005354 | Bacteria | 5840 |
| 111 | Ga0070671_100016942 | 3300005355 | Bacteria | 5894 |
| 112 | Ga0070671_100020598 | 3300005355 | Bacteria | 5381 |
| 113 | Ga0070671_100059613 | 3300005355 | Bacteria | 3176 |
| 114 | Ga0070671_100077792 | 3300005355 | Bacteria | 2772 |
| 115 | Ga0070671_100122151 | 3300005355 | Bacteria | 2192 |
| 116 | Ga0070671_100410109 | 3300005355 | Bacteria | 1160 |
| 117 | Ga0070674_100034729 | 3300005356 | Bacteria | 3371 |
| 118 | Ga0070673_100000006 | 3300005364 | Bacteria | 184299 |
| 119 | Ga0070673_100000440 | 3300005364 | Bacteria | 21943 |
| 120 | Ga0070673_100047277 | 3300005364 | Bacteria | 3348 |
| 121 | Ga0070673_100598642 | 3300005364 | Bacteria | 1005 |
| 122 | Ga0070673_100652108 | 3300005364 | Bacteria | 964 |
| 123 | Ga0070659_100000903 | 3300005366 | Bacteria | 21708 |
| 124 | Ga0070659_100028621 | 3300005366 | Bacteria | 4305 |
| 125 | Ga0070659_100101931 | 3300005366 | Bacteria | 2311 |
| 126 | Ga0070659_100129529 | 3300005366 | Bacteria | 2048 |
| 127 | Ga0070659_100280577 | 3300005366 | Bacteria | 1386 |
| 128 | Ga0070659_100514577 | 3300005366 | Bacteria | 1021 |
| 129 | Ga0070659_100522544 | 3300005366 | Bacteria | 1013 |
| 130 | Ga0070659_101057472 | 3300005366 | Bacteria | 714 |
| 131 | Ga0070659_101634477 | 3300005366 | Unclassified | 575 |
| 132 | Ga0070667_100002316 | 3300005367 | Bacteria | 16687 |
| 133 | Ga0070667_100010891 | 3300005367 | Bacteria | 7522 |
| 134 | Ga0070667_100023848 | 3300005367 | Bacteria | 5080 |
| 135 | Ga0070667_100127545 | 3300005367 | Bacteria | 2218 |
| 136 | Ga0070667_100132042 | 3300005367 | Bacteria | 2180 |
| 137 | Ga0070667_100175676 | 3300005367 | Bacteria | 1893 |
| 138 | Ga0070667_101011187 | 3300005367 | Bacteria | 776 |
| 139 | Ga0070663_100007148 | 3300005455 | Bacteria | 6778 |
| 140 | Ga0070663_100053840 | 3300005455 | Bacteria | 2874 |
| 141 | Ga0070663_100108188 | 3300005455 | Bacteria | 2085 |
| 142 | Ga0070663_100183657 | 3300005455 | Bacteria | 1624 |
| 143 | Ga0070663_100200873 | 3300005455 | Unclassified | 1556 |
| 144 | Ga0070663_100396315 | 3300005455 | Bacteria | 1127 |
| 145 | Ga0070663_100441267 | 3300005455 | Bacteria | 1071 |
| 146 | Ga0070663_100625860 | 3300005455 | Bacteria | 908 |
| 147 | Ga0070663_100720859 | 3300005455 | Bacteria | 849 |
| 148 | Ga0070678_100029246 | 3300005456 | Bacteria | 3771 |
| 149 | Ga0070678_100286752 | 3300005456 | Bacteria | 1394 |
| 150 | Ga0070662_100000324 | 3300005457 | Bacteria | 28542 |
| 151 | Ga0070662_100035356 | 3300005457 | Bacteria | 3527 |
| 152 | Ga0070662_100116766 | 3300005457 | Bacteria | 2040 |
| 153 | Ga0070662_100444353 | 3300005457 | Bacteria | 1075 |
| 154 | Ga0070662_100461994 | 3300005457 | Bacteria | 1055 |
| 155 | Ga0070662_100840458 | 3300005457 | Bacteria | 781 |
| 156 | Ga0070662_101403613 | 3300005457 | Unclassified | 602 |
| 157 | Ga0070681_10791254 | 3300005458 | Unclassified | 865 |
| 158 | Ga0070681_11966076 | 3300005458 | Bacteria | 513 |
| 159 | Ga0068867_100000001 | 3300005459 | Bacteria | 427563 |
| 160 | Ga0068867_100001209 | 3300005459 | Bacteria | 17732 |
| 161 | Ga0068867_100012453 | 3300005459 | Bacteria | 6018 |
| 162 | Ga0070679_100102138 | 3300005530 | Bacteria | 2853 |
| 163 | Ga0070684_100198327 | 3300005535 | Bacteria | 1828 |
| 164 | Ga0070684_101547806 | 3300005535 | Bacteria | 625 |
| 165 | Ga0068853_100004143 | 3300005539 | Bacteria | 11177 |
| 166 | Ga0068853_100078085 | 3300005539 | Bacteria | 2893 |
| 167 | Ga0068853_100126163 | 3300005539 | Bacteria | 2286 |
| 168 | Ga0068853_100145612 | 3300005539 | Bacteria | 2129 |
| 169 | Ga0068853_102466044 | 3300005539 | Bacteria | 503 |
| 170 | Ga0070672_100003604 | 3300005543 | Bacteria | 10038 |
| 171 | Ga0070672_100259143 | 3300005543 | Bacteria | 1466 |
| 172 | Ga0070672_100427725 | 3300005543 | Bacteria | 1138 |
| 173 | Ga0070672_101665019 | 3300005543 | Unclassified | 573 |
| 174 | Ga0070696_100267423 | 3300005546 | Bacteria | 1299 |
| 175 | Ga0070696_101529780 | 3300005546 | Bacteria | 572 |
| 176 | Ga0070693_101173023 | 3300005547 | Bacteria | 589 |
| 177 | Ga0070665_100002264 | 3300005548 | Bacteria | 21390 |
| 178 | Ga0070665_100022041 | 3300005548 | Bacteria | 6408 |
| 179 | Ga0070665_100127195 | 3300005548 | Bacteria | 2550 |
| 180 | Ga0070665_100264050 | 3300005548 | Bacteria | 1723 |
| 181 | Ga0070665_100513964 | 3300005548 | Unclassified | 1209 |
| 182 | Ga0070665_100995054 | 3300005548 | Bacteria | 851 |
| 183 | Ga0070665_101534936 | 3300005548 | Unclassified | 674 |
| 184 | Ga0070665_101748498 | 3300005548 | Bacteria | 629 |
| 185 | Ga0068855_100000780 | 3300005563 | Bacteria | 39315 |
| 186 | Ga0068855_100311462 | 3300005563 | Bacteria | 1741 |
| 187 | Ga0070664_100112271 | 3300005564 | Bacteria | 2380 |
| 188 | Ga0070664_100181918 | 3300005564 | Bacteria | 1868 |
| 189 | Ga0070664_100314517 | 3300005564 | Bacteria | 1418 |
| 190 | Ga0070664_100544828 | 3300005564 | Bacteria | 1072 |
| 191 | Ga0070664_100701453 | 3300005564 | Bacteria | 943 |
| 192 | Ga0070664_101753151 | 3300005564 | Bacteria | 589 |
| 193 | Ga0070664_102124326 | 3300005564 | Unclassified | 533 |
| 194 | Ga0068857_100001963 | 3300005577 | Bacteria | 16623 |
| 195 | Ga0068857_100019067 | 3300005577 | Bacteria | 6020 |
| 196 | Ga0068857_100251458 | 3300005577 | Bacteria | 1620 |
| 197 | Ga0068857_100260817 | 3300005577 | Bacteria | 1590 |
| 198 | Ga0068854_100004099 | 3300005578 | Bacteria | 9155 |
| 199 | Ga0068854_100039628 | 3300005578 | Bacteria | 3321 |
| 200 | Ga0068854_100057595 | 3300005578 | Bacteria | 2803 |
| 201 | Ga0068854_100071113 | 3300005578 | Bacteria | 2544 |
| 202 | Ga0068854_100870800 | 3300005578 | Unclassified | 790 |
| 203 | Ga0068854_101486806 | 3300005578 | Bacteria | 614 |
| 204 | Ga0068856_100014359 | 3300005614 | Bacteria | 7656 |
| 205 | Ga0068856_100065440 | 3300005614 | Bacteria | 3593 |
| 206 | Ga0068856_100097984 | 3300005614 | Bacteria | 2922 |
| 207 | Ga0068856_100492521 | 3300005614 | Bacteria | 1247 |
| 208 | Ga0068852_100000562 | 3300005616 | Bacteria | 24464 |
| 209 | Ga0068852_100116770 | 3300005616 | Bacteria | 2435 |
| 210 | Ga0068852_100707891 | 3300005616 | Bacteria | 1017 |
| 211 | Ga0068852_101230914 | 3300005616 | Bacteria | 770 |
| 212 | Ga0068852_101301540 | 3300005616 | Bacteria | 748 |
| 213 | Ga0068852_101425013 | 3300005616 | Bacteria | 715 |
| 214 | Ga0068859_100000783 | 3300005617 | Bacteria | 32120 |
| 215 | Ga0068859_100000934 | 3300005617 | Bacteria | 29961 |
| 216 | Ga0068859_100356512 | 3300005617 | Bacteria | 1557 |
| 217 | Ga0068859_100684571 | 3300005617 | Bacteria | 1117 |
| 218 | Ga0068864_100000181 | 3300005618 | Bacteria | 58221 |
| 219 | Ga0068864_100002274 | 3300005618 | Bacteria | 15886 |
| 220 | Ga0068864_100019551 | 3300005618 | Bacteria | 5665 |
| 221 | Ga0068864_100125712 | 3300005618 | Bacteria | 2298 |
| 222 | Ga0068866_10018207 | 3300005718 | Unclassified | 3173 |
| 223 | Ga0068866_10323917 | 3300005718 | Unclassified | 970 |
| 224 | Ga0068861_100016704 | 3300005719 | Bacteria | 5199 |
| 225 | Ga0068861_100110779 | 3300005719 | Bacteria | 2199 |
| 226 | Ga0068851_10037597 | 3300005834 | Bacteria | 2427 |
| 227 | Ga0068851_10078145 | 3300005834 | Bacteria | 1724 |
| 228 | Ga0068851_10235183 | 3300005834 | Bacteria | 1034 |
| 229 | Ga0068851_10453301 | 3300005834 | Bacteria | 763 |
| 230 | Ga0068851_10913634 | 3300005834 | Unclassified | 550 |
| 231 | Ga0068870_10421550 | 3300005840 | Unclassified | 873 |
| 232 | Ga0068870_11373404 | 3300005840 | Bacteria | 517 |
| 233 | Ga0068863_100001525 | 3300005841 | Bacteria | 22887 |
| 234 | Ga0068863_100013287 | 3300005841 | Bacteria | 7946 |
| 235 | Ga0068863_100121938 | 3300005841 | Bacteria | 2486 |
| 236 | Ga0068858_100002349 | 3300005842 | Bacteria | 19115 |
| 237 | Ga0068858_100009036 | 3300005842 | Bacteria | 9528 |
| 238 | Ga0068858_100225319 | 3300005842 | Bacteria | 1776 |
| 239 | Ga0068858_101029458 | 3300005842 | Bacteria | 807 |
| 240 | Ga0068860_100005988 | 3300005843 | Bacteria | 12240 |
| 241 | Ga0068860_100063691 | 3300005843 | Bacteria | 3501 |
| 242 | Ga0068860_100160815 | 3300005843 | Bacteria | 2165 |
| 243 | Ga0068862_100015334 | 3300005844 | Bacteria | 6364 |
| 244 | Ga0068862_100690692 | 3300005844 | Bacteria | 988 |
| 245 | Ga0068862_101288528 | 3300005844 | Bacteria | 731 |
| 246 | Ga0068862_101859369 | 3300005844 | Unclassified | 612 |
| 247 | Ga0075362_10591220 | 3300006177 | Unclassified | 573 |
| 248 | Ga0097621_100027264 | 3300006237 | Bacteria | 4491 |
| 249 | Ga0097621_102443103 | 3300006237 | Unclassified | 500 |
| 250 | Ga0068871_100060974 | 3300006358 | Bacteria | 3079 |
| 251 | Ga0068865_100000003 | 3300006881 | Bacteria | 231761 |
| 252 | Ga0068865_100000775 | 3300006881 | Bacteria | 17940 |
| 253 | Ga0068865_100543879 | 3300006881 | Bacteria | 974 |
| 254 | Ga0097620_100000783 | 3300006931 | Bacteria | 32120 |
| 255 | Ga0097620_100000934 | 3300006931 | Bacteria | 29961 |
| 256 | Ga0097620_100356513 | 3300006931 | Bacteria | 1557 |
| 257 | Ga0097620_100684518 | 3300006931 | Bacteria | 1117 |
| 258 | Ga0105250_10027166 | 3300009092 | Bacteria | 2306 |
| 259 | Ga0105250_10512887 | 3300009092 | Unclassified | 545 |
| 260 | Ga0105240_10036359 | 3300009093 | Bacteria | 6337 |
| 261 | Ga0105245_10000120 | 3300009098 | Bacteria | 75923 |
| 262 | Ga0105245_10106004 | 3300009098 | Bacteria | 2607 |
| 263 | Ga0105247_10182973 | 3300009101 | Bacteria | 1399 |
| 264 | Ga0105247_10216856 | 3300009101 | Bacteria | 1293 |
| 265 | Ga0105243_10029665 | 3300009148 | Bacteria | 4207 |
| 266 | Ga0105243_10075598 | 3300009148 | Bacteria | 2734 |
| 267 | Ga0105243_11771821 | 3300009148 | Unclassified | 648 |
| 268 | Ga0105241_10099141 | 3300009174 | Bacteria | 2313 |
| 269 | Ga0105241_10442899 | 3300009174 | Bacteria | 1148 |
| 270 | Ga0105241_12194235 | 3300009174 | Bacteria | 547 |
| 271 | Ga0105242_10002812 | 3300009176 | Bacteria | 13637 |
| 272 | Ga0105242_10601788 | 3300009176 | Bacteria | 1062 |
| 273 | Ga0105248_10000256 | 3300009177 | Bacteria | 62138 |
| 274 | Ga0105248_10028022 | 3300009177 | Bacteria | 6274 |
| 275 | Ga0105248_10327279 | 3300009177 | Bacteria | 1726 |
| 276 | Ga0105248_11007265 | 3300009177 | Bacteria | 941 |
| 277 | Ga0105248_11472195 | 3300009177 | Bacteria | 771 |
| 278 | Ga0105237_10245525 | 3300009545 | Bacteria | 1792 |
| 279 | Ga0105238_10128438 | 3300009551 | Bacteria | 2513 |
| 280 | Ga0105238_10945371 | 3300009551 | Bacteria | 881 |
| 281 | Ga0105238_10992963 | 3300009551 | Unclassified | 860 |
| 282 | Ga0105249_10043627 | 3300009553 | Bacteria | 4078 |
| 283 | Ga0105249_10358075 | 3300009553 | Bacteria | 1480 |
| 284 | Ga0105249_10395917 | 3300009553 | Bacteria | 1410 |
| 285 | Ga0105239_10090598 | 3300010375 | Bacteria | 3374 |
| 286 | Ga0105239_12196724 | 3300010375 | Bacteria | 642 |
| 287 | Ga0105246_10001420 | 3300011119 | Bacteria | 14190 |
| 288 | Ga0105246_10033753 | 3300011119 | Bacteria | 3404 |
| 289 | Ga0105246_10070186 | 3300011119 | Bacteria | 2463 |
| 290 | Ga0157373_10002630 | 3300013100 | Bacteria | 13620 |
| 291 | Ga0157373_10059883 | 3300013100 | Bacteria | 2698 |
| 292 | Ga0157373_10266538 | 3300013100 | Bacteria | 1212 |
| 293 | Ga0157373_11278801 | 3300013100 | Bacteria | 555 |
| 294 | Ga0157371_10023247 | 3300013102 | Bacteria | 4532 |
| 295 | Ga0157371_10113518 | 3300013102 | Bacteria | 1924 |
| 296 | Ga0157371_10194020 | 3300013102 | Unclassified | 1455 |
| 297 | Ga0157371_10380753 | 3300013102 | Bacteria | 1030 |
| 298 | Ga0157370_10000069 | 3300013104 | Bacteria | 112889 |
| 299 | Ga0157370_10349270 | 3300013104 | Bacteria | 1363 |
| 300 | Ga0157369_10046681 | 3300013105 | Bacteria | 4707 |
| 301 | Ga0157369_10332080 | 3300013105 | Bacteria | 1580 |
| 302 | Ga0157369_12689950 | 3300013105 | Unclassified | 501 |
| 303 | Ga0157374_10214942 | 3300013296 | Bacteria | 1886 |
| 304 | Ga0157374_12156187 | 3300013296 | Unclassified | 584 |
| 305 | Ga0157378_10274682 | 3300013297 | Bacteria | 1622 |
| 306 | Ga0157378_13159307 | 3300013297 | Bacteria | 512 |
| 307 | Ga0163162_10016313 | 3300013306 | Bacteria | 7262 |
| 308 | Ga0163162_10101365 | 3300013306 | Bacteria | 2971 |
| 309 | Ga0163162_10198189 | 3300013306 | Bacteria | 2137 |
| 310 | Ga0157372_10016779 | 3300013307 | Bacteria | 7861 |
| 311 | Ga0157372_10069560 | 3300013307 | Bacteria | 3959 |
| 312 | Ga0157372_10103381 | 3300013307 | Unclassified | 3255 |
| 313 | Ga0157372_10135847 | 3300013307 | Bacteria | 2832 |
| 314 | Ga0157372_10279329 | 3300013307 | Bacteria | 1941 |
| 315 | Ga0157372_10409917 | 3300013307 | Bacteria | 1579 |
| 316 | Ga0157372_10671516 | 3300013307 | Bacteria | 1206 |
| 317 | Ga0157372_10785700 | 3300013307 | Unclassified | 1106 |
| 318 | Ga0157372_11032750 | 3300013307 | Bacteria | 952 |
| 319 | Ga0157372_11818059 | 3300013307 | Bacteria | 701 |
| 320 | Ga0157375_10003338 | 3300013308 | Bacteria | 13911 |
| 321 | Ga0157375_11282399 | 3300013308 | Unclassified | 861 |
| 322 | Ga0157375_13006601 | 3300013308 | Unclassified | 563 |
| 323 | Ga0157375_13159729 | 3300013308 | Unclassified | 549 |
| 324 | Ga0163163_10000192 | 3300014325 | Bacteria | 62963 |
| 325 | Ga0163163_10084563 | 3300014325 | Bacteria | 3179 |
| 326 | Ga0157380_13439736 | 3300014326 | Unclassified | 507 |
| 327 | Ga0157377_10018041 | 3300014745 | Bacteria | 3662 |
| 328 | Ga0157377_10146491 | 3300014745 | Bacteria | 1456 |
| 329 | Ga0157379_10004595 | 3300014968 | Bacteria | 11843 |
| 330 | Ga0157379_11222280 | 3300014968 | Bacteria | 723 |
| 331 | Ga0157376_10001542 | 3300014969 | Bacteria | 15190 |
| 332 | Ga0157376_12627142 | 3300014969 | Bacteria | 543 |
| 333 | Ga0209148_1000870 | 3300025254 | Bacteria | 21040 |
| 334 | Ga0209455_1000386 | 3300025272 | Bacteria | 39294 |
| 335 | Ga0207697_10000260 | 3300025315 | Bacteria | 29097 |
| 336 | Ga0207697_10468182 | 3300025315 | Unclassified | 558 |
| 337 | Ga0207656_10505788 | 3300025321 | Bacteria | 613 |
| 338 | Ga0207696_1048108 | 3300025711 | Bacteria | 1227 |
| 339 | Ga0207682_10303354 | 3300025893 | Bacteria | 749 |
| 340 | Ga0207642_10096507 | 3300025899 | Bacteria | 1474 |
| 341 | Ga0207710_10499630 | 3300025900 | Unclassified | 631 |
| 342 | Ga0207688_10000225 | 3300025901 | Bacteria | 25468 |
| 343 | Ga0207688_10051768 | 3300025901 | Bacteria | 2300 |
| 344 | Ga0207688_10893955 | 3300025901 | Bacteria | 562 |
| 345 | Ga0207680_10026049 | 3300025903 | Bacteria | 3235 |
| 346 | Ga0207680_10063603 | 3300025903 | Bacteria | 2259 |
| 347 | Ga0207680_10108768 | 3300025903 | Bacteria | 1794 |
| 348 | Ga0207647_10000052 | 3300025904 | Bacteria | 87651 |
| 349 | Ga0207647_10000261 | 3300025904 | Bacteria | 43301 |
| 350 | Ga0207647_10012956 | 3300025904 | Bacteria | 5794 |
| 351 | Ga0207647_10023553 | 3300025904 | Bacteria | 4071 |
| 352 | Ga0207647_10091150 | 3300025904 | Bacteria | 1817 |
| 353 | Ga0207647_10171196 | 3300025904 | Bacteria | 1264 |
| 354 | Ga0207645_10011101 | 3300025907 | Bacteria | 6162 |
| 355 | Ga0207645_10100868 | 3300025907 | Bacteria | 1862 |
| 356 | Ga0207645_10143824 | 3300025907 | Bacteria | 1554 |
| 357 | Ga0207643_10919816 | 3300025908 | Unclassified | 567 |
| 358 | Ga0207705_10000022 | 3300025909 | Bacteria | 302232 |
| 359 | Ga0207705_10000591 | 3300025909 | Bacteria | 30449 |
| 360 | Ga0207705_10038135 | 3300025909 | Bacteria | 3439 |
| 361 | Ga0207705_10360482 | 3300025909 | Bacteria | 1121 |
| 362 | Ga0207705_10469357 | 3300025909 | Bacteria | 976 |
| 363 | Ga0207705_10494925 | 3300025909 | Bacteria | 949 |
| 364 | Ga0207705_10660955 | 3300025909 | Bacteria | 813 |
| 365 | Ga0207705_11217465 | 3300025909 | Bacteria | 577 |
| 366 | Ga0207705_11262416 | 3300025909 | Bacteria | 565 |
| 367 | Ga0207654_10052413 | 3300025911 | Bacteria | 2351 |
| 368 | Ga0207707_11098924 | 3300025912 | Bacteria | 648 |
| 369 | Ga0207695_10051333 | 3300025913 | Bacteria | 4331 |
| 370 | Ga0207671_10136657 | 3300025914 | Bacteria | 1885 |
| 371 | Ga0207662_10892089 | 3300025918 | Bacteria | 629 |
| 372 | Ga0207657_10001207 | 3300025919 | Bacteria | 27516 |
| 373 | Ga0207657_10002788 | 3300025919 | Bacteria | 18798 |
| 374 | Ga0207657_10004059 | 3300025919 | Bacteria | 15547 |
| 375 | Ga0207657_10007120 | 3300025919 | Bacteria | 11485 |
| 376 | Ga0207657_10027835 | 3300025919 | Bacteria | 5169 |
| 377 | Ga0207657_10036418 | 3300025919 | Bacteria | 4404 |
| 378 | Ga0207657_10595582 | 3300025919 | Bacteria | 863 |
| 379 | Ga0207657_10806690 | 3300025919 | Bacteria | 725 |
| 380 | Ga0207657_10956909 | 3300025919 | Bacteria | 658 |
| 381 | Ga0207649_10009658 | 3300025920 | Bacteria | 5283 |
| 382 | Ga0207649_10025729 | 3300025920 | Bacteria | 3434 |
| 383 | Ga0207649_10142207 | 3300025920 | Bacteria | 1643 |
| 384 | Ga0207649_10688947 | 3300025920 | Bacteria | 792 |
| 385 | Ga0207649_10748748 | 3300025920 | Bacteria | 760 |
| 386 | Ga0207649_10808887 | 3300025920 | Bacteria | 732 |
| 387 | Ga0207649_10836566 | 3300025920 | Unclassified | 720 |
| 388 | Ga0207652_10733461 | 3300025921 | Bacteria | 880 |
| 389 | Ga0207681_10002587 | 3300025923 | Bacteria | 11459 |
| 390 | Ga0207681_10081882 | 3300025923 | Bacteria | 2280 |
| 391 | Ga0207681_10303548 | 3300025923 | Bacteria | 1264 |
| 392 | Ga0207694_10147759 | 3300025924 | Bacteria | 1893 |
| 393 | Ga0207694_11539105 | 3300025924 | Bacteria | 561 |
| 394 | Ga0207694_11787363 | 3300025924 | Unclassified | 517 |
| 395 | Ga0207650_10006658 | 3300025925 | Bacteria | 7881 |
| 396 | Ga0207650_10329826 | 3300025925 | Bacteria | 1251 |
| 397 | Ga0207650_11276749 | 3300025925 | Unclassified | 625 |
| 398 | Ga0207659_10041870 | 3300025926 | Bacteria | 3209 |
| 399 | Ga0207659_10122426 | 3300025926 | Bacteria | 1995 |
| 400 | Ga0207687_10006406 | 3300025927 | Bacteria | 7776 |
| 401 | Ga0207644_10010959 | 3300025931 | Bacteria | 5989 |
| 402 | Ga0207644_10014050 | 3300025931 | Bacteria | 5353 |
| 403 | Ga0207644_10194660 | 3300025931 | Bacteria | 1596 |
| 404 | Ga0207644_10335807 | 3300025931 | Bacteria | 1224 |
| 405 | Ga0207644_10924349 | 3300025931 | Bacteria | 731 |
| 406 | Ga0207644_11473298 | 3300025931 | Unclassified | 571 |
| 407 | Ga0207644_11783386 | 3300025931 | Unclassified | 515 |
| 408 | Ga0207690_10000463 | 3300025932 | Bacteria | 26092 |
| 409 | Ga0207690_10018806 | 3300025932 | Bacteria | 4242 |
| 410 | Ga0207690_10396487 | 3300025932 | Bacteria | 1100 |
| 411 | Ga0207690_10714145 | 3300025932 | Bacteria | 825 |
| 412 | Ga0207690_11023658 | 3300025932 | Bacteria | 687 |
| 413 | Ga0207706_10001178 | 3300025933 | Bacteria | 26405 |
| 414 | Ga0207706_10009206 | 3300025933 | Bacteria | 9073 |
| 415 | Ga0207706_10009419 | 3300025933 | Bacteria | 8966 |
| 416 | Ga0207706_10044141 | 3300025933 | Bacteria | 3951 |
| 417 | Ga0207706_10056717 | 3300025933 | Bacteria | 3453 |
| 418 | Ga0207706_10127883 | 3300025933 | Bacteria | 2234 |
| 419 | Ga0207686_10003952 | 3300025934 | Bacteria | 7947 |
| 420 | Ga0207686_10364344 | 3300025934 | Bacteria | 1092 |
| 421 | Ga0207709_10012181 | 3300025935 | Bacteria | 4740 |
| 422 | Ga0207709_10227256 | 3300025935 | Bacteria | 1350 |
| 423 | Ga0207670_10101714 | 3300025936 | Bacteria | 2053 |
| 424 | Ga0207704_10000001 | 3300025938 | Bacteria | 716296 |
| 425 | Ga0207704_10015412 | 3300025938 | Bacteria | 3894 |
| 426 | Ga0207691_10035008 | 3300025940 | Bacteria | 4666 |
| 427 | Ga0207691_10327663 | 3300025940 | Bacteria | 1312 |
| 428 | Ga0207691_11282061 | 3300025940 | Unclassified | 605 |
| 429 | Ga0207711_10004639 | 3300025941 | Bacteria | 11676 |
| 430 | Ga0207711_10100492 | 3300025941 | Bacteria | 2558 |
| 431 | Ga0207711_11011740 | 3300025941 | Bacteria | 771 |
| 432 | Ga0207711_11261931 | 3300025941 | Bacteria | 681 |
| 433 | Ga0207689_10000014 | 3300025942 | Bacteria | 122534 |
| 434 | Ga0207689_10009319 | 3300025942 | Bacteria | 8487 |
| 435 | Ga0207689_10038367 | 3300025942 | Bacteria | 3968 |
| 436 | Ga0207661_10583436 | 3300025944 | Bacteria | 1025 |
| 437 | Ga0207679_10023452 | 3300025945 | Bacteria | 4221 |
| 438 | Ga0207679_10148183 | 3300025945 | Bacteria | 1906 |
| 439 | Ga0207679_10270068 | 3300025945 | Bacteria | 1454 |
| 440 | Ga0207679_10394474 | 3300025945 | Bacteria | 1216 |
| 441 | Ga0207679_10910409 | 3300025945 | Bacteria | 805 |
| 442 | Ga0207679_11264249 | 3300025945 | Bacteria | 677 |
| 443 | Ga0207667_10029534 | 3300025949 | Bacteria | 5945 |
| 444 | Ga0207667_10195785 | 3300025949 | Bacteria | 2073 |
| 445 | Ga0207651_10000002 | 3300025960 | Bacteria | 427663 |
| 446 | Ga0207651_10000310 | 3300025960 | Bacteria | 20959 |
| 447 | Ga0207651_10006153 | 3300025960 | Bacteria | 6244 |
| 448 | Ga0207651_10093201 | 3300025960 | Bacteria | 2211 |
| 449 | Ga0207651_10851434 | 3300025960 | Bacteria | 810 |
| 450 | Ga0207651_11393103 | 3300025960 | Unclassified | 631 |
| 451 | Ga0207712_10232546 | 3300025961 | Bacteria | 1480 |
| 452 | Ga0207712_10268883 | 3300025961 | Bacteria | 1386 |
| 453 | Ga0207668_10488183 | 3300025972 | Bacteria | 1057 |
| 454 | Ga0207640_10001199 | 3300025981 | Bacteria | 14165 |
| 455 | Ga0207640_10033526 | 3300025981 | Bacteria | 3196 |
| 456 | Ga0207640_10183867 | 3300025981 | Bacteria | 1569 |
| 457 | Ga0207640_10511030 | 3300025981 | Bacteria | 1002 |
| 458 | Ga0207640_10758514 | 3300025981 | Bacteria | 837 |
| 459 | Ga0207640_11251272 | 3300025981 | Unclassified | 661 |
| 460 | Ga0207658_10005035 | 3300025986 | Bacteria | 9101 |
| 461 | Ga0207658_10005707 | 3300025986 | Bacteria | 8511 |
| 462 | Ga0207658_10034873 | 3300025986 | Bacteria | 3599 |
| 463 | Ga0207658_10069179 | 3300025986 | Bacteria | 2667 |
| 464 | Ga0207658_10107948 | 3300025986 | Bacteria | 2194 |
| 465 | Ga0207658_10219822 | 3300025986 | Bacteria | 1597 |
| 466 | Ga0207658_10244640 | 3300025986 | Bacteria | 1521 |
| 467 | Ga0207677_10000776 | 3300026023 | Bacteria | 18351 |
| 468 | Ga0207677_10002094 | 3300026023 | Bacteria | 10500 |
| 469 | Ga0207677_10690026 | 3300026023 | Bacteria | 905 |
| 470 | Ga0207677_11373280 | 3300026023 | Bacteria | 650 |
| 471 | Ga0207703_10001172 | 3300026035 | Bacteria | 24751 |
| 472 | Ga0207703_10027804 | 3300026035 | Bacteria | 4454 |
| 473 | Ga0207703_11759504 | 3300026035 | Bacteria | 596 |
| 474 | Ga0207639_10004768 | 3300026041 | Bacteria | 9139 |
| 475 | Ga0207639_10027474 | 3300026041 | Bacteria | 4147 |
| 476 | Ga0207639_10136429 | 3300026041 | Bacteria | 2038 |
| 477 | Ga0207639_10200488 | 3300026041 | Bacteria | 1711 |
| 478 | Ga0207639_10228672 | 3300026041 | Bacteria | 1611 |
| 479 | Ga0207639_10540011 | 3300026041 | Bacteria | 1069 |
| 480 | Ga0207639_10715370 | 3300026041 | Bacteria | 930 |
| 481 | Ga0207639_11849706 | 3300026041 | Bacteria | 565 |
| 482 | Ga0207678_10000354 | 3300026067 | Bacteria | 41704 |
| 483 | Ga0207678_10008727 | 3300026067 | Bacteria | 8925 |
| 484 | Ga0207678_10068990 | 3300026067 | Bacteria | 3032 |
| 485 | Ga0207678_10310959 | 3300026067 | Bacteria | 1355 |
| 486 | Ga0207678_10943910 | 3300026067 | Bacteria | 763 |
| 487 | Ga0207678_10963768 | 3300026067 | Unclassified | 755 |
| 488 | Ga0207702_10151789 | 3300026078 | Bacteria | 2108 |
| 489 | Ga0207702_10279512 | 3300026078 | Bacteria | 1578 |
| 490 | Ga0207702_10460330 | 3300026078 | Bacteria | 1235 |
| 491 | Ga0207641_10033991 | 3300026088 | Bacteria | 4238 |
| 492 | Ga0207641_10105797 | 3300026088 | Bacteria | 2485 |
| 493 | Ga0207641_10156621 | 3300026088 | Bacteria | 2067 |
| 494 | Ga0207641_10502534 | 3300026088 | Bacteria | 1177 |
| 495 | Ga0207641_10548265 | 3300026088 | Bacteria | 1127 |
| 496 | Ga0207641_10554415 | 3300026088 | Bacteria | 1121 |
| 497 | Ga0207648_10000001 | 3300026089 | Bacteria | 427499 |
| 498 | Ga0207648_10001420 | 3300026089 | Bacteria | 26422 |
| 499 | Ga0207648_10010858 | 3300026089 | Bacteria | 8609 |
| 500 | Ga0207648_11619473 | 3300026089 | Bacteria | 608 |
| 501 | Ga0207676_10000666 | 3300026095 | Bacteria | 27542 |
| 502 | Ga0207676_10065760 | 3300026095 | Bacteria | 2888 |
| 503 | Ga0207676_10482224 | 3300026095 | Bacteria | 1174 |
| 504 | Ga0207674_10000139 | 3300026116 | Bacteria | 84273 |
| 505 | Ga0207674_10000244 | 3300026116 | Bacteria | 67590 |
| 506 | Ga0207674_10004090 | 3300026116 | Bacteria | 17674 |
| 507 | Ga0207674_10311577 | 3300026116 | Bacteria | 1523 |
| 508 | Ga0207674_12214480 | 3300026116 | Unclassified | 512 |
| 509 | Ga0207675_100068862 | 3300026118 | Bacteria | 3307 |
| 510 | Ga0207675_100290115 | 3300026118 | Bacteria | 1591 |
| 511 | Ga0207675_100557677 | 3300026118 | Bacteria | 1145 |
| 512 | Ga0207683_10013761 | 3300026121 | Bacteria | 6898 |
| 513 | Ga0207683_10328477 | 3300026121 | Bacteria | 1402 |
| 514 | Ga0207698_10008014 | 3300026142 | Bacteria | 6659 |
| 515 | Ga0207698_10175895 | 3300026142 | Bacteria | 1890 |
| 516 | Ga0207698_11557728 | 3300026142 | Bacteria | 676 |
| 517 | Ga0207698_12143158 | 3300026142 | Bacteria | 572 |
| 518 | Ga0268266_10001998 | 3300028379 | Bacteria | 22799 |
| 519 | Ga0268266_10093825 | 3300028379 | Bacteria | 2633 |
| 520 | Ga0268266_10410457 | 3300028379 | Bacteria | 1282 |
| 521 | Ga0268266_10510427 | 3300028379 | Bacteria | 1148 |
| 522 | Ga0268265_10031590 | 3300028380 | Bacteria | 3825 |
| 523 | Ga0268265_10102357 | 3300028380 | Bacteria | 2316 |
| 524 | Ga0268265_10224201 | 3300028380 | Bacteria | 1647 |
| 525 | Ga0268265_10442413 | 3300028380 | Bacteria | 1212 |
| 526 | Ga0268265_10515553 | 3300028380 | Bacteria | 1129 |
| 527 | Ga0268264_10003356 | 3300028381 | Bacteria | 13841 |
| 528 | Ga0268264_10004801 | 3300028381 | Bacteria | 11462 |
| 529 | Ga0268264_10527383 | 3300028381 | Bacteria | 1155 |
| 530 | Ga0268264_10907169 | 3300028381 | Unclassified | 885 |
| 531 | Ga0268264_11512634 | 3300028381 | Bacteria | 682 |
| 532 | Ga0307408_100135068 | 3300031548 | Unclassified | 1929 |
| 533 | Ga0307405_10001525 | 3300031731 | Bacteria | 9807 |
| 534 | Ga0307413_10013408 | 3300031824 | Bacteria | 4119 |
| 535 | Ga0307410_10007748 | 3300031852 | Bacteria | 5900 |
| 536 | Ga0307412_10037822 | 3300031911 | Bacteria | 3103 |
| 537 | Ga0307409_100001492 | 3300031995 | Bacteria | 11545 |
| 538 | Ga0307416_100000484 | 3300032002 | Bacteria | 20246 |
| 539 | Ga0307414_10007126 | 3300032004 | Bacteria | 6276 |
| 540 | Ga0307411_10004047 | 3300032005 | Bacteria | 6939 |
| 541 | Ga0307415_100001486 | 3300032126 | Bacteria | 11242 |
| 542 | Ga0395899_0023425 | 3300037312 | Bacteria | 4676 |
| 543 | Ga0395899_0159599 | 3300037312 | Bacteria | 1594 |
| 544 | Ga0395899_0965980 | 3300037312 | Unclassified | 516 |
| 545 | Ga0395900_0278919 | 3300037418 | Bacteria | 1664 |
| 546 | Ga0395900_0651483 | 3300037418 | Unclassified | 990 |
| 547 | Ga0395898_0457807 | 3300037466 | Bacteria | 1215 |
| 548 | Ga0395898_1018130 | 3300037466 | Bacteria | 764 |
| 549 | Ga0395905_0124998 | 3300037471 | Unclassified | 2419 |
| 550 | Ga0395905_0900659 | 3300037471 | Unclassified | 787 |
| 551 | Ga0395905_1660352 | 3300037471 | Unclassified | 544 |
| 552 | Ga0395901_0194626 | 3300038443 | Bacteria | 2126 |
| 553 | Ga0395901_0196194 | 3300038443 | Bacteria | 2117 |
| 554 | Ga0395901_0341119 | 3300038443 | Bacteria | 1548 |
| 555 | Ga0395901_0423444 | 3300038443 | Bacteria | 1365 |
| 556 | Ga0395901_1076457 | 3300038443 | Unclassified | 776 |
| 557 | Ga0439465_0263060 | 3300041413 | Unclassified | 640 |
| 558 | Ga0451787_762348 | 3300041441 | Bacteria | 620 |
| 559 | Ga0451789_0823438 | 3300041443 | Bacteria | 1888 |
| 560 | Ga0451789_1301034 | 3300041443 | Bacteria | 631 |
| 561 | Ga0451793_0299515 | 3300041452 | Bacteria | 794 |
| 562 | Ga0451797_1027370 | 3300041453 | Bacteria | 683 |
| 563 | Ga0451795_0528729 | 3300041456 | Bacteria | 1243 |
| 564 | Ga0451798_0040090 | 3300041458 | Bacteria | 764 |
| 565 | Ga0451800_0533049 | 3300041459 | Unclassified | 624 |
| 566 | Ga0451802_0306496 | 3300041460 | Bacteria | 2895 |
| 567 | Ga0451806_825822 | 3300041462 | Bacteria | 4971 |
| 568 | Ga0439445_0069270 | 3300042004 | Unclassified | 974 |
| 569 | Ga0439448_0012147 | 3300042005 | Bacteria | 2573 |
| 570 | Ga0439455_0158024 | 3300042012 | Unclassified | 647 |
| 571 | Ga0439458_0004217 | 3300042157 | Bacteria | 3321 |
| 572 | Ga0466970_0790087 | 3300044765 | Unclassified | 556 |
| 573 | Ga0466958_0166480 | 3300045836 | Bacteria | 1395 |
| 574 | Ga0466967_0218723 | 3300045976 | Bacteria | 1809 |
| 575 | Ga0466967_0334679 | 3300045976 | Bacteria | 1463 |
| 576 | Ga0466967_2494192 | 3300045976 | Unclassified | 512 |
| 577 | Ga0495583_0223227 | 3300046506 | Unclassified | 761 |
| 578 | Ga0495606_0345359 | 3300046507 | Bacteria | 791 |
| 579 | Ga0495632_0311089 | 3300046519 | Unclassified | 697 |
| 580 | Ga0495663_0155627 | 3300046525 | Bacteria | 782 |
| 581 | Ga0495669_0007330 | 3300046684 | Bacteria | 4621 |
| 582 | Ga0495669_0088783 | 3300046684 | Bacteria | 1425 |
| 583 | Ga0495649_0264159 | 3300046694 | Bacteria | 882 |
| 584 | Ga0495589_0569291 | 3300046794 | Bacteria | 516 |
| 585 | Ga0495677_0095472 | 3300047445 | Bacteria | 1123 |
| 586 | Ga0495686_0003535 | 3300047472 | Bacteria | 13465 |
| 587 | Ga0496107_0735006 | 3300048910 | Bacteria | 725 |
| 588 | Ga0496116_0283388 | 3300048919 | Bacteria | 801 |
| 589 | Ga0496117_0009632 | 3300048920 | Bacteria | 8938 |
| 590 | Ga0496117_0028171 | 3300048920 | Bacteria | 4354 |
| 591 | Ga0496117_0059419 | 3300048920 | Bacteria | 2641 |
| 592 | Ga0496118_0064135 | 3300048921 | Bacteria | 2698 |
| 593 | Ga0496118_0113465 | 3300048921 | Bacteria | 1790 |
| 594 | Ga0496119_0020335 | 3300048922 | Bacteria | 4847 |
| 595 | Ga0496120_0027266 | 3300048923 | Bacteria | 3516 |
| 596 | Ga0496121_0076177 | 3300048924 | Bacteria | 2676 |
| 597 | Ga0496121_0129618 | 3300048924 | Bacteria | 1890 |
| 598 | Ga0496121_0630996 | 3300048924 | Bacteria | 656 |
| 599 | Ga0496122_0017742 | 3300048925 | Bacteria | 6627 |
| 600 | Ga0496123_0021916 | 3300048926 | Bacteria | 4946 |
| 601 | Ga0496124_0096661 | 3300048927 | Bacteria | 2399 |
| 602 | Ga0496124_0514772 | 3300048927 | Bacteria | 799 |
| 603 | Ga0496124_0809932 | 3300048927 | Unclassified | 579 |
| 604 | Ga0496125_0006169 | 3300048928 | Bacteria | 13066 |
| 605 | Ga0501035_1179084 | 3300049822 | Unclassified | 595 |
| 606 | Ga0500604_0012109 | 3300053151 | Bacteria | 2325 |
| 607 | Ga0500616_0004722 | 3300053153 | Bacteria | 9590 |
| 608 | Ga0500611_001223 | 3300053727 | Unclassified | 2756 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005577 | Ga0068857_100251458 | Ga0068857_1002514582 | 60 |
| 2 | 3300026116 | Ga0207674_10311577 | Ga0207674_103115772 | 60 |
| 3 | 3300001904 | JGI24736J21556_1005300 | JGI24736J21556_10053003 | 62 |
| 4 | 3300001915 | JGI24741J21665_1009958 | JGI24741J21665_10099582 | 62 |
| 5 | 3300001915 | JGI24741J21665_1011557 | JGI24741J21665_10115573 | 62 |
| 6 | 3300001978 | JGI24747J21853_1042045 | JGI24747J21853_10420452 | 62 |
| 7 | 3300001979 | JGI24740J21852_10003183 | JGI24740J21852_100031834 | 62 |
| 8 | 3300001979 | JGI24740J21852_10030262 | JGI24740J21852_100302622 | 62 |
| 9 | 3300001979 | JGI24740J21852_10098601 | JGI24740J21852_100986012 | 62 |
| 10 | 3300001979 | JGI24740J21852_10105756 | JGI24740J21852_101057562 | 62 |
| 11 | 3300001989 | JGI24739J22299_10000035 | JGI24739J22299_1000003524 | 62 |
| 12 | 3300001989 | JGI24739J22299_10000226 | JGI24739J22299_100002267 | 62 |
| 13 | 3300001989 | JGI24739J22299_10002884 | JGI24739J22299_100028847 | 62 |
| 14 | 3300001989 | JGI24739J22299_10009390 | JGI24739J22299_100093906 | 62 |
| 15 | 3300001989 | JGI24739J22299_10013219 | JGI24739J22299_100132193 | 62 |
| 16 | 3300001989 | JGI24739J22299_10213379 | JGI24739J22299_102133792 | 62 |
| 17 | 3300001989 | JGI24739J22299_10221727 | JGI24739J22299_102217272 | 62 |
| 18 | 3300001990 | JGI24737J22298_10000020 | JGI24737J22298_1000002011 | 62 |
| 19 | 3300001990 | JGI24737J22298_10001654 | JGI24737J22298_100016542 | 62 |
| 20 | 3300001990 | JGI24737J22298_10087698 | JGI24737J22298_100876982 | 62 |
| 21 | 3300001990 | JGI24737J22298_10174590 | JGI24737J22298_101745902 | 62 |
| 22 | 3300001990 | JGI24737J22298_10236500 | JGI24737J22298_102365001 | 62 |
| 23 | 3300001991 | JGI24743J22301_10011075 | JGI24743J22301_100110753 | 62 |
| 24 | 3300001991 | JGI24743J22301_10088907 | JGI24743J22301_100889072 | 62 |
| 25 | 3300002067 | JGI24735J21928_10000410 | JGI24735J21928_1000041017 | 62 |
| 26 | 3300002067 | JGI24735J21928_10001761 | JGI24735J21928_100017613 | 62 |
| 27 | 3300002067 | JGI24735J21928_10002885 | JGI24735J21928_100028857 | 62 |
| 28 | 3300002067 | JGI24735J21928_10005066 | JGI24735J21928_100050661 | 62 |
| 29 | 3300002067 | JGI24735J21928_10005516 | JGI24735J21928_100055163 | 62 |
| 30 | 3300002067 | JGI24735J21928_10006583 | JGI24735J21928_100065834 | 62 |
| 31 | 3300002067 | JGI24735J21928_10019969 | JGI24735J21928_100199691 | 62 |
| 32 | 3300002067 | JGI24735J21928_10115648 | JGI24735J21928_101156482 | 62 |
| 33 | 3300002074 | JGI24748J21848_1008077 | JGI24748J21848_10080771 | 62 |
| 34 | 3300002075 | JGI24738J21930_10000050 | JGI24738J21930_1000005015 | 62 |
| 35 | 3300002075 | JGI24738J21930_10004723 | JGI24738J21930_100047234 | 62 |
| 36 | 3300002075 | JGI24738J21930_10004991 | JGI24738J21930_100049912 | 62 |
| 37 | 3300002076 | JGI24749J21850_1009490 | JGI24749J21850_10094901 | 62 |
| 38 | 3300002077 | JGI24744J21845_10000597 | JGI24744J21845_100005972 | 62 |
| 39 | 3300002077 | JGI24744J21845_10033763 | JGI24744J21845_100337632 | 62 |
| 40 | 3300002126 | JGI24035J26624_1016107 | JGI24035J26624_10161072 | 62 |
| 41 | 3300002155 | JGI24033J26618_1054937 | JGI24033J26618_10549372 | 62 |
| 42 | 3300002239 | JGI24034J26672_10005517 | JGI24034J26672_100055172 | 62 |
| 43 | 3300002239 | JGI24034J26672_10042179 | JGI24034J26672_100421791 | 62 |
| 44 | 3300002772 | JGI25164J39214_1011673 | JGI25164J39214_10116732 | 62 |
| 45 | 3300003214 | JGI25165J46597_1000043 | JGI25165J46597_1000043140 | 62 |
| 46 | 3300003322 | rootL2_10307941 | rootL2_103079412 | 62 |
| 47 | 3300003762 | Ga0055542_1006341 | Ga0055542_10063415 | 62 |
| 48 | 3300003763 | Ga0055529_1034584 | Ga0055529_10345842 | 62 |
| 49 | 3300005327 | Ga0070658_10000105 | Ga0070658_1000010532 | 62 |
| 50 | 3300005327 | Ga0070658_10002340 | Ga0070658_1000234011 | 62 |
| 51 | 3300005327 | Ga0070658_10010382 | Ga0070658_100103827 | 62 |
| 52 | 3300005327 | Ga0070658_10376300 | Ga0070658_103763003 | 62 |
| 53 | 3300005327 | Ga0070658_10448517 | Ga0070658_104485172 | 62 |
| 54 | 3300005327 | Ga0070658_10615364 | Ga0070658_106153642 | 62 |
| 55 | 3300005327 | Ga0070658_10774143 | Ga0070658_107741432 | 62 |
| 56 | 3300005327 | Ga0070658_10915381 | Ga0070658_109153812 | 62 |
| 57 | 3300005327 | Ga0070658_11751836 | Ga0070658_117518362 | 62 |
| 58 | 3300005327 | Ga0070658_11997011 | Ga0070658_119970112 | 62 |
| 59 | 3300005328 | Ga0070676_10034535 | Ga0070676_100345352 | 62 |
| 60 | 3300005328 | Ga0070676_10150929 | Ga0070676_101509292 | 62 |
| 61 | 3300005328 | Ga0070676_10175818 | Ga0070676_101758182 | 62 |
| 62 | 3300005328 | Ga0070676_10305685 | Ga0070676_103056852 | 62 |
| 63 | 3300005328 | Ga0070676_10330695 | Ga0070676_103306952 | 62 |
| 64 | 3300005328 | Ga0070676_11491700 | Ga0070676_114917002 | 62 |
| 65 | 3300005329 | Ga0070683_100257604 | Ga0070683_1002576043 | 62 |
| 66 | 3300005330 | Ga0070690_101104046 | Ga0070690_1011040462 | 62 |
| 67 | 3300005330 | Ga0070690_101249797 | Ga0070690_1012497971 | 62 |
| 68 | 3300005331 | Ga0070670_100014177 | Ga0070670_1000141775 | 62 |
| 69 | 3300005331 | Ga0070670_100016985 | Ga0070670_1000169852 | 62 |
| 70 | 3300005331 | Ga0070670_100153515 | Ga0070670_1001535152 | 62 |
| 71 | 3300005333 | Ga0070677_10027489 | Ga0070677_100274892 | 62 |
| 72 | 3300005333 | Ga0070677_10340714 | Ga0070677_103407141 | 62 |
| 73 | 3300005333 | Ga0070677_10552400 | Ga0070677_105524002 | 62 |
| 74 | 3300005333 | Ga0070677_10716467 | Ga0070677_107164672 | 62 |
| 75 | 3300005334 | Ga0068869_100000043 | Ga0068869_10000004339 | 62 |
| 76 | 3300005334 | Ga0068869_100048853 | Ga0068869_1000488533 | 62 |
| 77 | 3300005334 | Ga0068869_100648954 | Ga0068869_1006489542 | 62 |
| 78 | 3300005334 | Ga0068869_100686647 | Ga0068869_1006866472 | 62 |
| 79 | 3300005335 | Ga0070666_10082256 | Ga0070666_100822561 | 62 |
| 80 | 3300005335 | Ga0070666_10138425 | Ga0070666_101384253 | 62 |
| 81 | 3300005335 | Ga0070666_10156146 | Ga0070666_101561463 | 62 |
| 82 | 3300005335 | Ga0070666_10742320 | Ga0070666_107423202 | 62 |
| 83 | 3300005338 | Ga0068868_100000149 | Ga0068868_1000001495 | 62 |
| 84 | 3300005338 | Ga0068868_100001402 | Ga0068868_1000014027 | 62 |
| 85 | 3300005338 | Ga0068868_100600288 | Ga0068868_1006002882 | 62 |
| 86 | 3300005338 | Ga0068868_101928251 | Ga0068868_1019282512 | 62 |
| 87 | 3300005338 | Ga0068868_102425121 | Ga0068868_1024251211 | 62 |
| 88 | 3300005339 | Ga0070660_100000415 | Ga0070660_1000004155 | 62 |
| 89 | 3300005339 | Ga0070660_100000816 | Ga0070660_1000008162 | 62 |
| 90 | 3300005339 | Ga0070660_100002945 | Ga0070660_1000029457 | 62 |
| 91 | 3300005339 | Ga0070660_100035953 | Ga0070660_1000359532 | 62 |
| 92 | 3300005339 | Ga0070660_100037728 | Ga0070660_1000377282 | 62 |
| 93 | 3300005339 | Ga0070660_100259556 | Ga0070660_1002595563 | 62 |
| 94 | 3300005339 | Ga0070660_100282521 | Ga0070660_1002825213 | 62 |
| 95 | 3300005339 | Ga0070660_100431694 | Ga0070660_1004316942 | 62 |
| 96 | 3300005339 | Ga0070660_100458177 | Ga0070660_1004581772 | 62 |
| 97 | 3300005339 | Ga0070660_100994775 | Ga0070660_1009947751 | 62 |
| 98 | 3300005340 | Ga0070689_100047067 | Ga0070689_1000470672 | 62 |
| 99 | 3300005343 | Ga0070687_100502791 | Ga0070687_1005027912 | 62 |
| 100 | 3300005344 | Ga0070661_100012789 | Ga0070661_1000127893 | 62 |
| 101 | 3300005344 | Ga0070661_100023604 | Ga0070661_1000236043 | 62 |
| 102 | 3300005344 | Ga0070661_100176000 | Ga0070661_1001760002 | 62 |
| 103 | 3300005344 | Ga0070661_100583845 | Ga0070661_1005838452 | 62 |
| 104 | 3300005344 | Ga0070661_101513762 | Ga0070661_1015137621 | 62 |
| 105 | 3300005344 | Ga0070661_101898358 | Ga0070661_1018983581 | 62 |
| 106 | 3300005347 | Ga0070668_100045674 | Ga0070668_1000456742 | 62 |
| 107 | 3300005347 | Ga0070668_100155474 | Ga0070668_1001554742 | 62 |
| 108 | 3300005353 | Ga0070669_100000209 | Ga0070669_10000020926 | 62 |
| 109 | 3300005353 | Ga0070669_100028859 | Ga0070669_1000288592 | 62 |
| 110 | 3300005353 | Ga0070669_100554231 | Ga0070669_1005542312 | 62 |
| 111 | 3300005354 | Ga0070675_100004052 | Ga0070675_1000040528 | 62 |
| 112 | 3300005354 | Ga0070675_100016633 | Ga0070675_1000166337 | 62 |
| 113 | 3300005355 | Ga0070671_100016942 | Ga0070671_1000169427 | 62 |
| 114 | 3300005355 | Ga0070671_100020598 | Ga0070671_1000205984 | 62 |
| 115 | 3300005355 | Ga0070671_100059613 | Ga0070671_1000596134 | 62 |
| 116 | 3300005355 | Ga0070671_100077792 | Ga0070671_1000777923 | 62 |
| 117 | 3300005355 | Ga0070671_100122151 | Ga0070671_1001221511 | 62 |
| 118 | 3300005355 | Ga0070671_100410109 | Ga0070671_1004101092 | 62 |
| 119 | 3300005356 | Ga0070674_100034729 | Ga0070674_1000347292 | 62 |
| 120 | 3300005364 | Ga0070673_100000006 | Ga0070673_10000000667 | 62 |
| 121 | 3300005364 | Ga0070673_100000440 | Ga0070673_10000044016 | 62 |
| 122 | 3300005364 | Ga0070673_100047277 | Ga0070673_1000472776 | 62 |
| 123 | 3300005364 | Ga0070673_100598642 | Ga0070673_1005986422 | 62 |
| 124 | 3300005364 | Ga0070673_100652108 | Ga0070673_1006521082 | 62 |
| 125 | 3300005366 | Ga0070659_100000903 | Ga0070659_10000090310 | 62 |
| 126 | 3300005366 | Ga0070659_100028621 | Ga0070659_1000286214 | 62 |
| 127 | 3300005366 | Ga0070659_100101931 | Ga0070659_1001019312 | 62 |
| 128 | 3300005366 | Ga0070659_100129529 | Ga0070659_1001295293 | 62 |
| 129 | 3300005366 | Ga0070659_100280577 | Ga0070659_1002805775 | 62 |
| 130 | 3300005366 | Ga0070659_100514577 | Ga0070659_1005145771 | 62 |
| 131 | 3300005366 | Ga0070659_100522544 | Ga0070659_1005225442 | 62 |
| 132 | 3300005366 | Ga0070659_101057472 | Ga0070659_1010574721 | 62 |
| 133 | 3300005366 | Ga0070659_101634477 | Ga0070659_1016344772 | 62 |
| 134 | 3300005367 | Ga0070667_100002316 | Ga0070667_1000023167 | 62 |
| 135 | 3300005367 | Ga0070667_100010891 | Ga0070667_10001089110 | 62 |
| 136 | 3300005367 | Ga0070667_100023848 | Ga0070667_1000238483 | 62 |
| 137 | 3300005367 | Ga0070667_100127545 | Ga0070667_1001275452 | 62 |
| 138 | 3300005367 | Ga0070667_100132042 | Ga0070667_1001320423 | 62 |
| 139 | 3300005367 | Ga0070667_100175676 | Ga0070667_1001756763 | 62 |
| 140 | 3300005367 | Ga0070667_101011187 | Ga0070667_1010111872 | 62 |
| 141 | 3300005455 | Ga0070663_100007148 | Ga0070663_1000071483 | 62 |
| 142 | 3300005455 | Ga0070663_100053840 | Ga0070663_1000538403 | 62 |
| 143 | 3300005455 | Ga0070663_100108188 | Ga0070663_1001081884 | 62 |
| 144 | 3300005455 | Ga0070663_100183657 | Ga0070663_1001836572 | 62 |
| 145 | 3300005455 | Ga0070663_100200873 | Ga0070663_1002008732 | 62 |
| 146 | 3300005455 | Ga0070663_100396315 | Ga0070663_1003963152 | 62 |
| 147 | 3300005455 | Ga0070663_100441267 | Ga0070663_1004412672 | 62 |
| 148 | 3300005455 | Ga0070663_100625860 | Ga0070663_1006258601 | 62 |
| 149 | 3300005455 | Ga0070663_100720859 | Ga0070663_1007208592 | 62 |
| 150 | 3300005456 | Ga0070678_100029246 | Ga0070678_1000292464 | 62 |
| 151 | 3300005456 | Ga0070678_100286752 | Ga0070678_1002867522 | 62 |
| 152 | 3300005457 | Ga0070662_100000324 | Ga0070662_10000032418 | 62 |
| 153 | 3300005457 | Ga0070662_100035356 | Ga0070662_1000353563 | 62 |
| 154 | 3300005457 | Ga0070662_100116766 | Ga0070662_1001167662 | 62 |
| 155 | 3300005457 | Ga0070662_100444353 | Ga0070662_1004443532 | 62 |
| 156 | 3300005457 | Ga0070662_100461994 | Ga0070662_1004619941 | 62 |
| 157 | 3300005457 | Ga0070662_100840458 | Ga0070662_1008404582 | 62 |
| 158 | 3300005457 | Ga0070662_101403613 | Ga0070662_1014036132 | 62 |
| 159 | 3300005458 | Ga0070681_10791254 | Ga0070681_107912542 | 62 |
| 160 | 3300005458 | Ga0070681_11966076 | Ga0070681_119660762 | 62 |
| 161 | 3300005459 | Ga0068867_100000001 | Ga0068867_100000001312 | 62 |
| 162 | 3300005459 | Ga0068867_100001209 | Ga0068867_10000120910 | 62 |
| 163 | 3300005459 | Ga0068867_100012453 | Ga0068867_1000124537 | 62 |
| 164 | 3300005530 | Ga0070679_100102138 | Ga0070679_1001021382 | 62 |
| 165 | 3300005535 | Ga0070684_100198327 | Ga0070684_1001983275 | 62 |
| 166 | 3300005535 | Ga0070684_101547806 | Ga0070684_1015478062 | 62 |
| 167 | 3300005539 | Ga0068853_100004143 | Ga0068853_1000041437 | 62 |
| 168 | 3300005539 | Ga0068853_100078085 | Ga0068853_1000780854 | 62 |
| 169 | 3300005539 | Ga0068853_100126163 | Ga0068853_1001261633 | 62 |
| 170 | 3300005539 | Ga0068853_100145612 | Ga0068853_1001456122 | 62 |
| 171 | 3300005539 | Ga0068853_102466044 | Ga0068853_1024660441 | 62 |
| 172 | 3300005543 | Ga0070672_100003604 | Ga0070672_1000036044 | 62 |
| 173 | 3300005543 | Ga0070672_100259143 | Ga0070672_1002591432 | 62 |
| 174 | 3300005543 | Ga0070672_100427725 | Ga0070672_1004277251 | 62 |
| 175 | 3300005543 | Ga0070672_101665019 | Ga0070672_1016650192 | 62 |
| 176 | 3300005546 | Ga0070696_100267423 | Ga0070696_1002674234 | 62 |
| 177 | 3300005546 | Ga0070696_101529780 | Ga0070696_1015297802 | 62 |
| 178 | 3300005547 | Ga0070693_101173023 | Ga0070693_1011730232 | 62 |
| 179 | 3300005548 | Ga0070665_100002264 | Ga0070665_10000226415 | 62 |
| 180 | 3300005548 | Ga0070665_100022041 | Ga0070665_1000220417 | 62 |
| 181 | 3300005548 | Ga0070665_100127195 | Ga0070665_1001271956 | 62 |
| 182 | 3300005548 | Ga0070665_100264050 | Ga0070665_1002640502 | 62 |
| 183 | 3300005548 | Ga0070665_100513964 | Ga0070665_1005139641 | 62 |
| 184 | 3300005548 | Ga0070665_100995054 | Ga0070665_1009950542 | 62 |
| 185 | 3300005548 | Ga0070665_101534936 | Ga0070665_1015349362 | 62 |
| 186 | 3300005548 | Ga0070665_101748498 | Ga0070665_1017484982 | 62 |
| 187 | 3300005563 | Ga0068855_100000780 | Ga0068855_10000078021 | 62 |
| 188 | 3300005563 | Ga0068855_100311462 | Ga0068855_1003114622 | 62 |
| 189 | 3300005564 | Ga0070664_100112271 | Ga0070664_1001122711 | 62 |
| 190 | 3300005564 | Ga0070664_100181918 | Ga0070664_1001819184 | 62 |
| 191 | 3300005564 | Ga0070664_100314517 | Ga0070664_1003145172 | 62 |
| 192 | 3300005564 | Ga0070664_100544828 | Ga0070664_1005448282 | 62 |
| 193 | 3300005564 | Ga0070664_100701453 | Ga0070664_1007014532 | 62 |
| 194 | 3300005564 | Ga0070664_101753151 | Ga0070664_1017531511 | 62 |
| 195 | 3300005564 | Ga0070664_102124326 | Ga0070664_1021243261 | 62 |
| 196 | 3300005577 | Ga0068857_100001963 | Ga0068857_10000196314 | 62 |
| 197 | 3300005577 | Ga0068857_100019067 | Ga0068857_1000190678 | 62 |
| 198 | 3300005577 | Ga0068857_100260817 | Ga0068857_1002608172 | 62 |
| 199 | 3300005578 | Ga0068854_100004099 | Ga0068854_1000040995 | 62 |
| 200 | 3300005578 | Ga0068854_100039628 | Ga0068854_1000396284 | 62 |
| 201 | 3300005578 | Ga0068854_100057595 | Ga0068854_1000575952 | 62 |
| 202 | 3300005578 | Ga0068854_100071113 | Ga0068854_1000711135 | 62 |
| 203 | 3300005578 | Ga0068854_100870800 | Ga0068854_1008708002 | 62 |
| 204 | 3300005578 | Ga0068854_101486806 | Ga0068854_1014868061 | 62 |
| 205 | 3300005614 | Ga0068856_100014359 | Ga0068856_1000143595 | 62 |
| 206 | 3300005614 | Ga0068856_100065440 | Ga0068856_1000654402 | 62 |
| 207 | 3300005614 | Ga0068856_100097984 | Ga0068856_1000979844 | 62 |
| 208 | 3300005614 | Ga0068856_100492521 | Ga0068856_1004925212 | 62 |
| 209 | 3300005616 | Ga0068852_100000562 | Ga0068852_10000056222 | 62 |
| 210 | 3300005616 | Ga0068852_100116770 | Ga0068852_1001167702 | 62 |
| 211 | 3300005616 | Ga0068852_100707891 | Ga0068852_1007078912 | 62 |
| 212 | 3300005616 | Ga0068852_101230914 | Ga0068852_1012309142 | 62 |
| 213 | 3300005616 | Ga0068852_101301540 | Ga0068852_1013015402 | 62 |
| 214 | 3300005616 | Ga0068852_101425013 | Ga0068852_1014250132 | 62 |
| 215 | 3300005617 | Ga0068859_100000783 | Ga0068859_10000078335 | 62 |
| 216 | 3300005617 | Ga0068859_100000934 | Ga0068859_10000093411 | 62 |
| 217 | 3300005617 | Ga0068859_100356512 | Ga0068859_1003565122 | 62 |
| 218 | 3300005617 | Ga0068859_100684571 | Ga0068859_1006845712 | 62 |
| 219 | 3300005618 | Ga0068864_100000181 | Ga0068864_10000018118 | 62 |
| 220 | 3300005618 | Ga0068864_100002274 | Ga0068864_10000227418 | 62 |
| 221 | 3300005618 | Ga0068864_100019551 | Ga0068864_1000195519 | 62 |
| 222 | 3300005618 | Ga0068864_100125712 | Ga0068864_1001257123 | 62 |
| 223 | 3300005718 | Ga0068866_10018207 | Ga0068866_100182075 | 62 |
| 224 | 3300005718 | Ga0068866_10323917 | Ga0068866_103239172 | 62 |
| 225 | 3300005719 | Ga0068861_100016704 | Ga0068861_1000167045 | 62 |
| 226 | 3300005719 | Ga0068861_100110779 | Ga0068861_1001107792 | 62 |
| 227 | 3300005834 | Ga0068851_10037597 | Ga0068851_100375972 | 62 |
| 228 | 3300005834 | Ga0068851_10078145 | Ga0068851_100781452 | 62 |
| 229 | 3300005834 | Ga0068851_10235183 | Ga0068851_102351833 | 62 |
| 230 | 3300005834 | Ga0068851_10453301 | Ga0068851_104533012 | 62 |
| 231 | 3300005834 | Ga0068851_10913634 | Ga0068851_109136342 | 62 |
| 232 | 3300005840 | Ga0068870_10421550 | Ga0068870_104215502 | 62 |
| 233 | 3300005840 | Ga0068870_11373404 | Ga0068870_113734041 | 62 |
| 234 | 3300005841 | Ga0068863_100001525 | Ga0068863_10000152511 | 62 |
| 235 | 3300005841 | Ga0068863_100013287 | Ga0068863_1000132872 | 62 |
| 236 | 3300005841 | Ga0068863_100121938 | Ga0068863_1001219382 | 62 |
| 237 | 3300005842 | Ga0068858_100002349 | Ga0068858_10000234917 | 62 |
| 238 | 3300005842 | Ga0068858_100009036 | Ga0068858_10000903614 | 62 |
| 239 | 3300005842 | Ga0068858_100225319 | Ga0068858_1002253193 | 62 |
| 240 | 3300005842 | Ga0068858_101029458 | Ga0068858_1010294582 | 62 |
| 241 | 3300005843 | Ga0068860_100005988 | Ga0068860_10000598812 | 62 |
| 242 | 3300005843 | Ga0068860_100063691 | Ga0068860_1000636914 | 62 |
| 243 | 3300005843 | Ga0068860_100160815 | Ga0068860_1001608152 | 62 |
| 244 | 3300005844 | Ga0068862_100015334 | Ga0068862_1000153347 | 62 |
| 245 | 3300005844 | Ga0068862_100690692 | Ga0068862_1006906922 | 62 |
| 246 | 3300005844 | Ga0068862_101288528 | Ga0068862_1012885282 | 62 |
| 247 | 3300005844 | Ga0068862_101859369 | Ga0068862_1018593692 | 62 |
| 248 | 3300006177 | Ga0075362_10591220 | Ga0075362_105912202 | 62 |
| 249 | 3300006237 | Ga0097621_100027264 | Ga0097621_1000272642 | 62 |
| 250 | 3300006237 | Ga0097621_102443103 | Ga0097621_1024431032 | 62 |
| 251 | 3300006358 | Ga0068871_100060974 | Ga0068871_1000609742 | 62 |
| 252 | 3300006881 | Ga0068865_100000003 | Ga0068865_10000000351 | 62 |
| 253 | 3300006881 | Ga0068865_100000775 | Ga0068865_10000077514 | 62 |
| 254 | 3300006881 | Ga0068865_100543879 | Ga0068865_1005438792 | 62 |
| 255 | 3300006931 | Ga0097620_100000783 | Ga0097620_1000007834 | 62 |
| 256 | 3300006931 | Ga0097620_100000934 | Ga0097620_10000093423 | 62 |
| 257 | 3300006931 | Ga0097620_100356513 | Ga0097620_1003565132 | 62 |
| 258 | 3300006931 | Ga0097620_100684518 | Ga0097620_1006845182 | 62 |
| 259 | 3300009092 | Ga0105250_10027166 | Ga0105250_100271662 | 62 |
| 260 | 3300009092 | Ga0105250_10512887 | Ga0105250_105128872 | 62 |
| 261 | 3300009093 | Ga0105240_10036359 | Ga0105240_100363595 | 62 |
| 262 | 3300009098 | Ga0105245_10000120 | Ga0105245_1000012013 | 62 |
| 263 | 3300009098 | Ga0105245_10106004 | Ga0105245_101060042 | 62 |
| 264 | 3300009101 | Ga0105247_10182973 | Ga0105247_101829732 | 62 |
| 265 | 3300009101 | Ga0105247_10216856 | Ga0105247_102168562 | 62 |
| 266 | 3300009148 | Ga0105243_10029665 | Ga0105243_100296652 | 62 |
| 267 | 3300009148 | Ga0105243_10075598 | Ga0105243_100755981 | 62 |
| 268 | 3300009148 | Ga0105243_11771821 | Ga0105243_117718211 | 62 |
| 269 | 3300009174 | Ga0105241_10099141 | Ga0105241_100991413 | 62 |
| 270 | 3300009174 | Ga0105241_10442899 | Ga0105241_104428992 | 62 |
| 271 | 3300009174 | Ga0105241_12194235 | Ga0105241_121942351 | 62 |
| 272 | 3300009176 | Ga0105242_10002812 | Ga0105242_100028123 | 62 |
| 273 | 3300009176 | Ga0105242_10601788 | Ga0105242_106017882 | 62 |
| 274 | 3300009177 | Ga0105248_10000256 | Ga0105248_1000025628 | 62 |
| 275 | 3300009177 | Ga0105248_10028022 | Ga0105248_100280223 | 62 |
| 276 | 3300009177 | Ga0105248_10327279 | Ga0105248_103272793 | 62 |
| 277 | 3300009177 | Ga0105248_11007265 | Ga0105248_110072652 | 62 |
| 278 | 3300009177 | Ga0105248_11472195 | Ga0105248_114721952 | 62 |
| 279 | 3300009545 | Ga0105237_10245525 | Ga0105237_102455252 | 62 |
| 280 | 3300009551 | Ga0105238_10128438 | Ga0105238_101284382 | 62 |
| 281 | 3300009551 | Ga0105238_10945371 | Ga0105238_109453712 | 62 |
| 282 | 3300009551 | Ga0105238_10992963 | Ga0105238_109929632 | 62 |
| 283 | 3300009553 | Ga0105249_10043627 | Ga0105249_100436277 | 62 |
| 284 | 3300009553 | Ga0105249_10358075 | Ga0105249_103580752 | 62 |
| 285 | 3300009553 | Ga0105249_10395917 | Ga0105249_103959172 | 62 |
| 286 | 3300010375 | Ga0105239_10090598 | Ga0105239_100905983 | 62 |
| 287 | 3300010375 | Ga0105239_12196724 | Ga0105239_121967241 | 62 |
| 288 | 3300011119 | Ga0105246_10001420 | Ga0105246_100014208 | 62 |
| 289 | 3300011119 | Ga0105246_10033753 | Ga0105246_100337534 | 62 |
| 290 | 3300011119 | Ga0105246_10070186 | Ga0105246_100701863 | 62 |
| 291 | 3300013100 | Ga0157373_10002630 | Ga0157373_100026306 | 62 |
| 292 | 3300013100 | Ga0157373_10059883 | Ga0157373_100598836 | 62 |
| 293 | 3300013100 | Ga0157373_10266538 | Ga0157373_102665382 | 62 |
| 294 | 3300013100 | Ga0157373_11278801 | Ga0157373_112788011 | 62 |
| 295 | 3300013102 | Ga0157371_10023247 | Ga0157371_100232473 | 62 |
| 296 | 3300013102 | Ga0157371_10113518 | Ga0157371_101135183 | 62 |
| 297 | 3300013102 | Ga0157371_10194020 | Ga0157371_101940204 | 62 |
| 298 | 3300013102 | Ga0157371_10380753 | Ga0157371_103807532 | 62 |
| 299 | 3300013104 | Ga0157370_10000069 | Ga0157370_1000006926 | 62 |
| 300 | 3300013104 | Ga0157370_10349270 | Ga0157370_103492702 | 62 |
| 301 | 3300013105 | Ga0157369_10046681 | Ga0157369_100466815 | 62 |
| 302 | 3300013105 | Ga0157369_10332080 | Ga0157369_103320803 | 62 |
| 303 | 3300013105 | Ga0157369_12689950 | Ga0157369_126899502 | 62 |
| 304 | 3300013296 | Ga0157374_10214942 | Ga0157374_102149422 | 62 |
| 305 | 3300013296 | Ga0157374_12156187 | Ga0157374_121561871 | 62 |
| 306 | 3300013297 | Ga0157378_10274682 | Ga0157378_102746822 | 62 |
| 307 | 3300013297 | Ga0157378_13159307 | Ga0157378_131593072 | 62 |
| 308 | 3300013306 | Ga0163162_10016313 | Ga0163162_100163137 | 62 |
| 309 | 3300013306 | Ga0163162_10101365 | Ga0163162_101013653 | 62 |
| 310 | 3300013306 | Ga0163162_10198189 | Ga0163162_101981893 | 62 |
| 311 | 3300013307 | Ga0157372_10016779 | Ga0157372_100167793 | 62 |
| 312 | 3300013307 | Ga0157372_10069560 | Ga0157372_100695603 | 62 |
| 313 | 3300013307 | Ga0157372_10103381 | Ga0157372_101033812 | 62 |
| 314 | 3300013307 | Ga0157372_10135847 | Ga0157372_101358472 | 62 |
| 315 | 3300013307 | Ga0157372_10279329 | Ga0157372_102793292 | 62 |
| 316 | 3300013307 | Ga0157372_10409917 | Ga0157372_104099172 | 62 |
| 317 | 3300013307 | Ga0157372_10671516 | Ga0157372_106715163 | 62 |
| 318 | 3300013307 | Ga0157372_10785700 | Ga0157372_107857003 | 62 |
| 319 | 3300013307 | Ga0157372_11032750 | Ga0157372_110327502 | 62 |
| 320 | 3300013307 | Ga0157372_11818059 | Ga0157372_118180592 | 62 |
| 321 | 3300013308 | Ga0157375_10003338 | Ga0157375_100033384 | 62 |
| 322 | 3300013308 | Ga0157375_11282399 | Ga0157375_112823992 | 62 |
| 323 | 3300013308 | Ga0157375_13006601 | Ga0157375_130066012 | 62 |
| 324 | 3300013308 | Ga0157375_13159729 | Ga0157375_131597292 | 62 |
| 325 | 3300014325 | Ga0163163_10000192 | Ga0163163_100001924 | 62 |
| 326 | 3300014325 | Ga0163163_10084563 | Ga0163163_100845632 | 62 |
| 327 | 3300014326 | Ga0157380_13439736 | Ga0157380_134397361 | 62 |
| 328 | 3300014745 | Ga0157377_10018041 | Ga0157377_100180414 | 62 |
| 329 | 3300014745 | Ga0157377_10146491 | Ga0157377_101464911 | 62 |
| 330 | 3300014968 | Ga0157379_10004595 | Ga0157379_1000459510 | 62 |
| 331 | 3300014968 | Ga0157379_11222280 | Ga0157379_112222802 | 62 |
| 332 | 3300014969 | Ga0157376_10001542 | Ga0157376_100015425 | 62 |
| 333 | 3300014969 | Ga0157376_12627142 | Ga0157376_126271422 | 62 |
| 334 | 3300025254 | Ga0209148_1000870 | Ga0209148_100087014 | 62 |
| 335 | 3300025272 | Ga0209455_1000386 | Ga0209455_100038618 | 62 |
| 336 | 3300025315 | Ga0207697_10000260 | Ga0207697_100002609 | 62 |
| 337 | 3300025315 | Ga0207697_10468182 | Ga0207697_104681822 | 62 |
| 338 | 3300025321 | Ga0207656_10505788 | Ga0207656_105057881 | 62 |
| 339 | 3300025711 | Ga0207696_1048108 | Ga0207696_10481081 | 62 |
| 340 | 3300025893 | Ga0207682_10303354 | Ga0207682_103033542 | 62 |
| 341 | 3300025899 | Ga0207642_10096507 | Ga0207642_100965072 | 62 |
| 342 | 3300025900 | Ga0207710_10499630 | Ga0207710_104996302 | 62 |
| 343 | 3300025901 | Ga0207688_10000225 | Ga0207688_1000022514 | 62 |
| 344 | 3300025901 | Ga0207688_10051768 | Ga0207688_100517683 | 62 |
| 345 | 3300025901 | Ga0207688_10893955 | Ga0207688_108939551 | 62 |
| 346 | 3300025903 | Ga0207680_10026049 | Ga0207680_100260492 | 62 |
| 347 | 3300025903 | Ga0207680_10063603 | Ga0207680_100636032 | 62 |
| 348 | 3300025903 | Ga0207680_10108768 | Ga0207680_101087681 | 62 |
| 349 | 3300025904 | Ga0207647_10000052 | Ga0207647_1000005238 | 62 |
| 350 | 3300025904 | Ga0207647_10000261 | Ga0207647_100002614 | 62 |
| 351 | 3300025904 | Ga0207647_10012956 | Ga0207647_100129563 | 62 |
| 352 | 3300025904 | Ga0207647_10023553 | Ga0207647_100235534 | 62 |
| 353 | 3300025904 | Ga0207647_10091150 | Ga0207647_100911502 | 62 |
| 354 | 3300025904 | Ga0207647_10171196 | Ga0207647_101711963 | 62 |
| 355 | 3300025907 | Ga0207645_10011101 | Ga0207645_100111012 | 62 |
| 356 | 3300025907 | Ga0207645_10100868 | Ga0207645_101008682 | 62 |
| 357 | 3300025907 | Ga0207645_10143824 | Ga0207645_101438243 | 62 |
| 358 | 3300025908 | Ga0207643_10919816 | Ga0207643_109198162 | 62 |
| 359 | 3300025909 | Ga0207705_10000022 | Ga0207705_1000002265 | 62 |
| 360 | 3300025909 | Ga0207705_10000591 | Ga0207705_100005914 | 62 |
| 361 | 3300025909 | Ga0207705_10038135 | Ga0207705_100381353 | 62 |
| 362 | 3300025909 | Ga0207705_10360482 | Ga0207705_103604821 | 62 |
| 363 | 3300025909 | Ga0207705_10469357 | Ga0207705_104693573 | 62 |
| 364 | 3300025909 | Ga0207705_10494925 | Ga0207705_104949252 | 62 |
| 365 | 3300025909 | Ga0207705_10660955 | Ga0207705_106609552 | 62 |
| 366 | 3300025909 | Ga0207705_11217465 | Ga0207705_112174651 | 62 |
| 367 | 3300025909 | Ga0207705_11262416 | Ga0207705_112624162 | 62 |
| 368 | 3300025911 | Ga0207654_10052413 | Ga0207654_100524133 | 62 |
| 369 | 3300025912 | Ga0207707_11098924 | Ga0207707_110989241 | 62 |
| 370 | 3300025913 | Ga0207695_10051333 | Ga0207695_100513335 | 62 |
| 371 | 3300025914 | Ga0207671_10136657 | Ga0207671_101366574 | 62 |
| 372 | 3300025918 | Ga0207662_10892089 | Ga0207662_108920892 | 62 |
| 373 | 3300025919 | Ga0207657_10001207 | Ga0207657_100012073 | 62 |
| 374 | 3300025919 | Ga0207657_10002788 | Ga0207657_1000278815 | 62 |
| 375 | 3300025919 | Ga0207657_10004059 | Ga0207657_100040594 | 62 |
| 376 | 3300025919 | Ga0207657_10007120 | Ga0207657_1000712011 | 62 |
| 377 | 3300025919 | Ga0207657_10027835 | Ga0207657_100278352 | 62 |
| 378 | 3300025919 | Ga0207657_10036418 | Ga0207657_100364184 | 62 |
| 379 | 3300025919 | Ga0207657_10595582 | Ga0207657_105955824 | 62 |
| 380 | 3300025919 | Ga0207657_10806690 | Ga0207657_108066902 | 62 |
| 381 | 3300025919 | Ga0207657_10956909 | Ga0207657_109569091 | 62 |
| 382 | 3300025920 | Ga0207649_10009658 | Ga0207649_100096582 | 62 |
| 383 | 3300025920 | Ga0207649_10025729 | Ga0207649_100257296 | 62 |
| 384 | 3300025920 | Ga0207649_10142207 | Ga0207649_101422072 | 62 |
| 385 | 3300025920 | Ga0207649_10688947 | Ga0207649_106889472 | 62 |
| 386 | 3300025920 | Ga0207649_10748748 | Ga0207649_107487482 | 62 |
| 387 | 3300025920 | Ga0207649_10808887 | Ga0207649_108088871 | 62 |
| 388 | 3300025920 | Ga0207649_10836566 | Ga0207649_108365662 | 62 |
| 389 | 3300025921 | Ga0207652_10733461 | Ga0207652_107334612 | 62 |
| 390 | 3300025923 | Ga0207681_10002587 | Ga0207681_100025878 | 62 |
| 391 | 3300025923 | Ga0207681_10081882 | Ga0207681_100818823 | 62 |
| 392 | 3300025923 | Ga0207681_10303548 | Ga0207681_103035482 | 62 |
| 393 | 3300025924 | Ga0207694_10147759 | Ga0207694_101477593 | 62 |
| 394 | 3300025924 | Ga0207694_11539105 | Ga0207694_115391052 | 62 |
| 395 | 3300025924 | Ga0207694_11787363 | Ga0207694_117873632 | 62 |
| 396 | 3300025925 | Ga0207650_10006658 | Ga0207650_100066588 | 62 |
| 397 | 3300025925 | Ga0207650_10329826 | Ga0207650_103298261 | 62 |
| 398 | 3300025925 | Ga0207650_11276749 | Ga0207650_112767492 | 62 |
| 399 | 3300025926 | Ga0207659_10041870 | Ga0207659_100418704 | 62 |
| 400 | 3300025926 | Ga0207659_10122426 | Ga0207659_101224262 | 62 |
| 401 | 3300025927 | Ga0207687_10006406 | Ga0207687_100064065 | 62 |
| 402 | 3300025931 | Ga0207644_10010959 | Ga0207644_100109592 | 62 |
| 403 | 3300025931 | Ga0207644_10014050 | Ga0207644_100140504 | 62 |
| 404 | 3300025931 | Ga0207644_10194660 | Ga0207644_101946603 | 62 |
| 405 | 3300025931 | Ga0207644_10335807 | Ga0207644_103358072 | 62 |
| 406 | 3300025931 | Ga0207644_10924349 | Ga0207644_109243492 | 62 |
| 407 | 3300025931 | Ga0207644_11473298 | Ga0207644_114732981 | 62 |
| 408 | 3300025931 | Ga0207644_11783386 | Ga0207644_117833861 | 62 |
| 409 | 3300025932 | Ga0207690_10000463 | Ga0207690_1000046324 | 62 |
| 410 | 3300025932 | Ga0207690_10018806 | Ga0207690_100188062 | 62 |
| 411 | 3300025932 | Ga0207690_10396487 | Ga0207690_103964872 | 62 |
| 412 | 3300025932 | Ga0207690_10714145 | Ga0207690_107141451 | 62 |
| 413 | 3300025932 | Ga0207690_11023658 | Ga0207690_110236581 | 62 |
| 414 | 3300025933 | Ga0207706_10001178 | Ga0207706_100011787 | 62 |
| 415 | 3300025933 | Ga0207706_10009206 | Ga0207706_100092068 | 62 |
| 416 | 3300025933 | Ga0207706_10009419 | Ga0207706_100094193 | 62 |
| 417 | 3300025933 | Ga0207706_10044141 | Ga0207706_100441413 | 62 |
| 418 | 3300025933 | Ga0207706_10056717 | Ga0207706_100567173 | 62 |
| 419 | 3300025933 | Ga0207706_10127883 | Ga0207706_101278834 | 62 |
| 420 | 3300025934 | Ga0207686_10003952 | Ga0207686_100039529 | 62 |
| 421 | 3300025934 | Ga0207686_10364344 | Ga0207686_103643443 | 62 |
| 422 | 3300025935 | Ga0207709_10012181 | Ga0207709_100121815 | 62 |
| 423 | 3300025935 | Ga0207709_10227256 | Ga0207709_102272562 | 62 |
| 424 | 3300025936 | Ga0207670_10101714 | Ga0207670_101017143 | 62 |
| 425 | 3300025938 | Ga0207704_10000001 | Ga0207704_10000001468 | 62 |
| 426 | 3300025938 | Ga0207704_10015412 | Ga0207704_100154121 | 62 |
| 427 | 3300025940 | Ga0207691_10035008 | Ga0207691_100350084 | 62 |
| 428 | 3300025940 | Ga0207691_10327663 | Ga0207691_103276632 | 62 |
| 429 | 3300025940 | Ga0207691_11282061 | Ga0207691_112820611 | 62 |
| 430 | 3300025941 | Ga0207711_10004639 | Ga0207711_100046397 | 62 |
| 431 | 3300025941 | Ga0207711_10100492 | Ga0207711_101004924 | 62 |
| 432 | 3300025941 | Ga0207711_11011740 | Ga0207711_110117402 | 62 |
| 433 | 3300025941 | Ga0207711_11261931 | Ga0207711_112619312 | 62 |
| 434 | 3300025942 | Ga0207689_10000014 | Ga0207689_1000001480 | 62 |
| 435 | 3300025942 | Ga0207689_10009319 | Ga0207689_100093193 | 62 |
| 436 | 3300025942 | Ga0207689_10038367 | Ga0207689_100383672 | 62 |
| 437 | 3300025944 | Ga0207661_10583436 | Ga0207661_105834362 | 62 |
| 438 | 3300025945 | Ga0207679_10023452 | Ga0207679_100234524 | 62 |
| 439 | 3300025945 | Ga0207679_10148183 | Ga0207679_101481832 | 62 |
| 440 | 3300025945 | Ga0207679_10270068 | Ga0207679_102700683 | 62 |
| 441 | 3300025945 | Ga0207679_10394474 | Ga0207679_103944742 | 62 |
| 442 | 3300025945 | Ga0207679_10910409 | Ga0207679_109104092 | 62 |
| 443 | 3300025945 | Ga0207679_11264249 | Ga0207679_112642492 | 62 |
| 444 | 3300025949 | Ga0207667_10029534 | Ga0207667_100295345 | 62 |
| 445 | 3300025949 | Ga0207667_10195785 | Ga0207667_101957851 | 62 |
| 446 | 3300025960 | Ga0207651_10000002 | Ga0207651_10000002137 | 62 |
| 447 | 3300025960 | Ga0207651_10000310 | Ga0207651_1000031015 | 62 |
| 448 | 3300025960 | Ga0207651_10006153 | Ga0207651_100061532 | 62 |
| 449 | 3300025960 | Ga0207651_10093201 | Ga0207651_100932013 | 62 |
| 450 | 3300025960 | Ga0207651_10851434 | Ga0207651_108514342 | 62 |
| 451 | 3300025960 | Ga0207651_11393103 | Ga0207651_113931032 | 62 |
| 452 | 3300025961 | Ga0207712_10232546 | Ga0207712_102325462 | 62 |
| 453 | 3300025961 | Ga0207712_10268883 | Ga0207712_102688831 | 62 |
| 454 | 3300025972 | Ga0207668_10488183 | Ga0207668_104881832 | 62 |
| 455 | 3300025981 | Ga0207640_10001199 | Ga0207640_1000119910 | 62 |
| 456 | 3300025981 | Ga0207640_10033526 | Ga0207640_100335265 | 62 |
| 457 | 3300025981 | Ga0207640_10183867 | Ga0207640_101838672 | 62 |
| 458 | 3300025981 | Ga0207640_10511030 | Ga0207640_105110302 | 62 |
| 459 | 3300025981 | Ga0207640_10758514 | Ga0207640_107585142 | 62 |
| 460 | 3300025981 | Ga0207640_11251272 | Ga0207640_112512722 | 62 |
| 461 | 3300025986 | Ga0207658_10005035 | Ga0207658_100050357 | 62 |
| 462 | 3300025986 | Ga0207658_10005707 | Ga0207658_100057075 | 62 |
| 463 | 3300025986 | Ga0207658_10034873 | Ga0207658_100348736 | 62 |
| 464 | 3300025986 | Ga0207658_10069179 | Ga0207658_100691792 | 62 |
| 465 | 3300025986 | Ga0207658_10107948 | Ga0207658_101079484 | 62 |
| 466 | 3300025986 | Ga0207658_10219822 | Ga0207658_102198222 | 62 |
| 467 | 3300025986 | Ga0207658_10244640 | Ga0207658_102446403 | 62 |
| 468 | 3300026023 | Ga0207677_10000776 | Ga0207677_1000077612 | 62 |
| 469 | 3300026023 | Ga0207677_10002094 | Ga0207677_100020942 | 62 |
| 470 | 3300026023 | Ga0207677_10690026 | Ga0207677_106900263 | 62 |
| 471 | 3300026023 | Ga0207677_11373280 | Ga0207677_113732802 | 62 |
| 472 | 3300026035 | Ga0207703_10001172 | Ga0207703_1000117214 | 62 |
| 473 | 3300026035 | Ga0207703_10027804 | Ga0207703_100278045 | 62 |
| 474 | 3300026035 | Ga0207703_11759504 | Ga0207703_117595042 | 62 |
| 475 | 3300026041 | Ga0207639_10004768 | Ga0207639_100047688 | 62 |
| 476 | 3300026041 | Ga0207639_10027474 | Ga0207639_100274742 | 62 |
| 477 | 3300026041 | Ga0207639_10136429 | Ga0207639_101364292 | 62 |
| 478 | 3300026041 | Ga0207639_10200488 | Ga0207639_102004883 | 62 |
| 479 | 3300026041 | Ga0207639_10228672 | Ga0207639_102286722 | 62 |
| 480 | 3300026041 | Ga0207639_10540011 | Ga0207639_105400112 | 62 |
| 481 | 3300026041 | Ga0207639_10715370 | Ga0207639_107153702 | 62 |
| 482 | 3300026041 | Ga0207639_11849706 | Ga0207639_118497062 | 62 |
| 483 | 3300026067 | Ga0207678_10000354 | Ga0207678_100003548 | 62 |
| 484 | 3300026067 | Ga0207678_10008727 | Ga0207678_100087272 | 62 |
| 485 | 3300026067 | Ga0207678_10068990 | Ga0207678_100689903 | 62 |
| 486 | 3300026067 | Ga0207678_10310959 | Ga0207678_103109593 | 62 |
| 487 | 3300026067 | Ga0207678_10943910 | Ga0207678_109439102 | 62 |
| 488 | 3300026067 | Ga0207678_10963768 | Ga0207678_109637682 | 62 |
| 489 | 3300026078 | Ga0207702_10151789 | Ga0207702_101517892 | 62 |
| 490 | 3300026078 | Ga0207702_10279512 | Ga0207702_102795122 | 62 |
| 491 | 3300026078 | Ga0207702_10460330 | Ga0207702_104603302 | 62 |
| 492 | 3300026088 | Ga0207641_10033991 | Ga0207641_100339914 | 62 |
| 493 | 3300026088 | Ga0207641_10105797 | Ga0207641_101057974 | 62 |
| 494 | 3300026088 | Ga0207641_10156621 | Ga0207641_101566212 | 62 |
| 495 | 3300026088 | Ga0207641_10502534 | Ga0207641_105025341 | 62 |
| 496 | 3300026088 | Ga0207641_10548265 | Ga0207641_105482652 | 62 |
| 497 | 3300026088 | Ga0207641_10554415 | Ga0207641_105544152 | 62 |
| 498 | 3300026089 | Ga0207648_10000001 | Ga0207648_10000001137 | 62 |
| 499 | 3300026089 | Ga0207648_10001420 | Ga0207648_100014207 | 62 |
| 500 | 3300026089 | Ga0207648_10010858 | Ga0207648_100108582 | 62 |
| 501 | 3300026089 | Ga0207648_11619473 | Ga0207648_116194732 | 62 |
| 502 | 3300026095 | Ga0207676_10000666 | Ga0207676_1000066624 | 62 |
| 503 | 3300026095 | Ga0207676_10065760 | Ga0207676_100657604 | 62 |
| 504 | 3300026095 | Ga0207676_10482224 | Ga0207676_104822242 | 62 |
| 505 | 3300026116 | Ga0207674_10000139 | Ga0207674_1000013950 | 62 |
| 506 | 3300026116 | Ga0207674_10000244 | Ga0207674_1000024428 | 62 |
| 507 | 3300026116 | Ga0207674_10004090 | Ga0207674_1000409011 | 62 |
| 508 | 3300026116 | Ga0207674_12214480 | Ga0207674_122144801 | 62 |
| 509 | 3300026118 | Ga0207675_100068862 | Ga0207675_1000688624 | 62 |
| 510 | 3300026118 | Ga0207675_100290115 | Ga0207675_1002901152 | 62 |
| 511 | 3300026118 | Ga0207675_100557677 | Ga0207675_1005576772 | 62 |
| 512 | 3300026121 | Ga0207683_10013761 | Ga0207683_100137612 | 62 |
| 513 | 3300026121 | Ga0207683_10328477 | Ga0207683_103284772 | 62 |
| 514 | 3300026142 | Ga0207698_10008014 | Ga0207698_100080148 | 62 |
| 515 | 3300026142 | Ga0207698_10175895 | Ga0207698_101758953 | 62 |
| 516 | 3300026142 | Ga0207698_11557728 | Ga0207698_115577281 | 62 |
| 517 | 3300026142 | Ga0207698_12143158 | Ga0207698_121431582 | 62 |
| 518 | 3300028379 | Ga0268266_10001998 | Ga0268266_100019987 | 62 |
| 519 | 3300028379 | Ga0268266_10093825 | Ga0268266_100938253 | 62 |
| 520 | 3300028379 | Ga0268266_10410457 | Ga0268266_104104574 | 62 |
| 521 | 3300028379 | Ga0268266_10510427 | Ga0268266_105104271 | 62 |
| 522 | 3300028380 | Ga0268265_10031590 | Ga0268265_100315901 | 62 |
| 523 | 3300028380 | Ga0268265_10102357 | Ga0268265_101023573 | 62 |
| 524 | 3300028380 | Ga0268265_10224201 | Ga0268265_102242013 | 62 |
| 525 | 3300028380 | Ga0268265_10442413 | Ga0268265_104424132 | 62 |
| 526 | 3300028380 | Ga0268265_10515553 | Ga0268265_105155532 | 62 |
| 527 | 3300028381 | Ga0268264_10003356 | Ga0268264_100033567 | 62 |
| 528 | 3300028381 | Ga0268264_10004801 | Ga0268264_100048015 | 62 |
| 529 | 3300028381 | Ga0268264_10527383 | Ga0268264_105273832 | 62 |
| 530 | 3300028381 | Ga0268264_10907169 | Ga0268264_109071692 | 62 |
| 531 | 3300028381 | Ga0268264_11512634 | Ga0268264_115126342 | 62 |
| 532 | 3300031548 | Ga0307408_100135068 | Ga0307408_1001350684 | 62 |
| 533 | 3300031731 | Ga0307405_10001525 | Ga0307405_100015257 | 62 |
| 534 | 3300031824 | Ga0307413_10013408 | Ga0307413_100134084 | 62 |
| 535 | 3300031852 | Ga0307410_10007748 | Ga0307410_100077484 | 62 |
| 536 | 3300031911 | Ga0307412_10037822 | Ga0307412_100378224 | 62 |
| 537 | 3300031995 | Ga0307409_100001492 | Ga0307409_1000014926 | 62 |
| 538 | 3300032002 | Ga0307416_100000484 | Ga0307416_10000048410 | 62 |
| 539 | 3300032004 | Ga0307414_10007126 | Ga0307414_100071264 | 62 |
| 540 | 3300032005 | Ga0307411_10004047 | Ga0307411_100040474 | 62 |
| 541 | 3300032126 | Ga0307415_100001486 | Ga0307415_1000014867 | 62 |
| 542 | 3300037312 | Ga0395899_0023425 | Ga0395899_0023425_917_1105 | 62 |
| 543 | 3300037312 | Ga0395899_0159599 | Ga0395899_0159599_849_1037 | 62 |
| 544 | 3300037312 | Ga0395899_0965980 | Ga0395899_0965980_176_364 | 62 |
| 545 | 3300037418 | Ga0395900_0278919 | Ga0395900_0278919_135_323 | 62 |
| 546 | 3300037418 | Ga0395900_0651483 | Ga0395900_0651483_613_801 | 62 |
| 547 | 3300037466 | Ga0395898_0457807 | Ga0395898_0457807_583_771 | 62 |
| 548 | 3300037466 | Ga0395898_1018130 | Ga0395898_1018130_387_575 | 62 |
| 549 | 3300037471 | Ga0395905_0124998 | Ga0395905_0124998_1516_1704 | 62 |
| 550 | 3300037471 | Ga0395905_0900659 | Ga0395905_0900659_94_282 | 62 |
| 551 | 3300037471 | Ga0395905_1660352 | Ga0395905_1660352_201_389 | 62 |
| 552 | 3300038443 | Ga0395901_0194626 | Ga0395901_0194626_1921_2109 | 62 |
| 553 | 3300038443 | Ga0395901_0196194 | Ga0395901_0196194_654_842 | 62 |
| 554 | 3300038443 | Ga0395901_0341119 | Ga0395901_0341119_100_288 | 62 |
| 555 | 3300038443 | Ga0395901_0423444 | Ga0395901_0423444_295_483 | 62 |
| 556 | 3300038443 | Ga0395901_1076457 | Ga0395901_1076457_287_475 | 62 |
| 557 | 3300041413 | Ga0439465_0263060 | Ga0439465_0263060_34_222 | 62 |
| 558 | 3300041441 | Ga0451787_762348 | Ga0451787_762348_286_474 | 62 |
| 559 | 3300041443 | Ga0451789_0823438 | Ga0451789_0823438_1200_1388 | 62 |
| 560 | 3300041443 | Ga0451789_1301034 | Ga0451789_1301034_11_199 | 62 |
| 561 | 3300041452 | Ga0451793_0299515 | Ga0451793_0299515_568_756 | 62 |
| 562 | 3300041453 | Ga0451797_1027370 | Ga0451797_1027370_412_600 | 62 |
| 563 | 3300041456 | Ga0451795_0528729 | Ga0451795_0528729_936_1124 | 62 |
| 564 | 3300041458 | Ga0451798_0040090 | Ga0451798_0040090_459_647 | 62 |
| 565 | 3300041459 | Ga0451800_0533049 | Ga0451800_0533049_327_515 | 62 |
| 566 | 3300041460 | Ga0451802_0306496 | Ga0451802_0306496_2535_2723 | 62 |
| 567 | 3300041462 | Ga0451806_825822 | Ga0451806_825822_2319_2507 | 62 |
| 568 | 3300042004 | Ga0439445_0069270 | Ga0439445_0069270_66_254 | 62 |
| 569 | 3300042005 | Ga0439448_0012147 | Ga0439448_0012147_1781_1978 | 62 |
| 570 | 3300042012 | Ga0439455_0158024 | Ga0439455_0158024_375_572 | 62 |
| 571 | 3300042157 | Ga0439458_0004217 | Ga0439458_0004217_2441_2638 | 62 |
| 572 | 3300044765 | Ga0466970_0790087 | Ga0466970_0790087_143_331 | 62 |
| 573 | 3300045836 | Ga0466958_0166480 | Ga0466958_0166480_1091_1279 | 62 |
| 574 | 3300045976 | Ga0466967_0218723 | Ga0466967_0218723_37_225 | 62 |
| 575 | 3300045976 | Ga0466967_0334679 | Ga0466967_0334679_223_411 | 62 |
| 576 | 3300045976 | Ga0466967_2494192 | Ga0466967_2494192_56_247 | 62 |
| 577 | 3300046506 | Ga0495583_0223227 | Ga0495583_0223227_377_565 | 62 |
| 578 | 3300046507 | Ga0495606_0345359 | Ga0495606_0345359_401_589 | 62 |
| 579 | 3300046519 | Ga0495632_0311089 | Ga0495632_0311089_59_247 | 62 |
| 580 | 3300046525 | Ga0495663_0155627 | Ga0495663_0155627_372_560 | 62 |
| 581 | 3300046684 | Ga0495669_0007330 | Ga0495669_0007330_688_876 | 62 |
| 582 | 3300046684 | Ga0495669_0088783 | Ga0495669_0088783_32_226 | 62 |
| 583 | 3300046694 | Ga0495649_0264159 | Ga0495649_0264159_113_301 | 62 |
| 584 | 3300046794 | Ga0495589_0569291 | Ga0495589_0569291_317_505 | 62 |
| 585 | 3300047445 | Ga0495677_0095472 | Ga0495677_0095472_731_919 | 62 |
| 586 | 3300047472 | Ga0495686_0003535 | Ga0495686_0003535_2761_2949 | 62 |
| 587 | 3300048910 | Ga0496107_0735006 | Ga0496107_0735006_211_399 | 62 |
| 588 | 3300048919 | Ga0496116_0283388 | Ga0496116_0283388_275_463 | 62 |
| 589 | 3300048920 | Ga0496117_0009632 | Ga0496117_0009632_265_453 | 62 |
| 590 | 3300048920 | Ga0496117_0028171 | Ga0496117_0028171_4130_4318 | 62 |
| 591 | 3300048920 | Ga0496117_0059419 | Ga0496117_0059419_2113_2301 | 62 |
| 592 | 3300048921 | Ga0496118_0064135 | Ga0496118_0064135_1389_1577 | 62 |
| 593 | 3300048921 | Ga0496118_0113465 | Ga0496118_0113465_1280_1468 | 62 |
| 594 | 3300048922 | Ga0496119_0020335 | Ga0496119_0020335_3991_4179 | 62 |
| 595 | 3300048923 | Ga0496120_0027266 | Ga0496120_0027266_525_713 | 62 |
| 596 | 3300048924 | Ga0496121_0076177 | Ga0496121_0076177_883_1071 | 62 |
| 597 | 3300048924 | Ga0496121_0129618 | Ga0496121_0129618_871_1059 | 62 |
| 598 | 3300048924 | Ga0496121_0630996 | Ga0496121_0630996_282_470 | 62 |
| 599 | 3300048925 | Ga0496122_0017742 | Ga0496122_0017742_2354_2542 | 62 |
| 600 | 3300048926 | Ga0496123_0021916 | Ga0496123_0021916_1732_1920 | 62 |
| 601 | 3300048927 | Ga0496124_0096661 | Ga0496124_0096661_2012_2200 | 62 |
| 602 | 3300048927 | Ga0496124_0514772 | Ga0496124_0514772_248_436 | 62 |
| 603 | 3300048927 | Ga0496124_0809932 | Ga0496124_0809932_93_281 | 62 |
| 604 | 3300048928 | Ga0496125_0006169 | Ga0496125_0006169_6459_6647 | 62 |
| 605 | 3300049822 | Ga0501035_1179084 | Ga0501035_1179084_165_353 | 62 |
| 606 | 3300053151 | Ga0500604_0012109 | Ga0500604_0012109_124_312 | 62 |
| 607 | 3300053153 | Ga0500616_0004722 | Ga0500616_0004722_4577_4774 | 62 |
| 608 | 3300053727 | Ga0500611_001223 | Ga0500611_001223_1172_1360 | 62 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3soh-assembly2.cif.gz_D | architecture of the flagellar rotor | 0.5734 | 4 | 42 |
| 1fjg-assembly1.cif.gz_T | structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin | 0.5155 | 6 | 61 |
| 4dzp-assembly1.cif.gz_B | crystal structure of the terminase small subunit gp1 with r48a mutation of the bacterial virus sf6 | 0.5092 | 6 | 61 |
| 1fjg-assembly1.cif.gz_T | structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin | 0.4752 | 6 | 61 |
| 4dzp-assembly1.cif.gz_B | crystal structure of the terminase small subunit gp1 with r48a mutation of the bacterial virus sf6 | 0.4719 | 6 | 61 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0E8I8_44_146_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.6822 | 6 | 51 | 1.10.10.10 |
| af_Q9P1P4_46_332_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.596 | 23 | 53 | 1.20.1070.10 |
| 3sohD00 | Mainly Alpha;Orthogonal Bundle;Annexin V; domain 1;Flagellar motor switch protein FliG, alpha-alpha superhelical domain | 0.5734 | 4 | 42 | 1.10.220.30 |
| af_Q54DM4_857_956_1.10.10.2670 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;E3 ubiquitin-protein ligase | 0.531 | 6 | 39 | 1.10.10.2670 |
| af_F1RDB2_113_213_1.10.1240.60 | Mainly Alpha;Orthogonal Bundle;Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1; | 0.5302 | 4 | 60 | 1.10.1240.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6J4ML22-F1-model_v4 | Uncharacterized protein | 0.9817 | 1 | 62 |
|
| AF-A0A7X5YAU5-F1-model_v4 | Uncharacterized protein | 0.9791 | 1 | 62 |
|
| AF-A0A6J4ML22-F1-model_v4 | Uncharacterized protein | 0.9662 | 1 | 62 |
|
| AF-A0A2D7ZIN6-F1-model_v4 | Uncharacterized protein | 0.8795 | 4 | 57 |
|
| AF-A0A4Q3KLV0-F1-model_v4 | deleted | 0.8713 | 1 | 61 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar