F468757

General Info

Members Datasets Scaffolds Average Seq Length
608 217 608 62

Family's Representative Sequence

Representative Sequence 3300001989|JGI24739J22299_10009390|JGI24739J22299_100093906
Length 65
Sequence MAKSSAIDRAFDLARSGHYRSVSEIIRRLPVDDRAIVEAHLAQPAARRELILICSDAWLSADHGR

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
12 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
13 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
14 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
15 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
16 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
17 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
170 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
178 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
179 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
180 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
181 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
182 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
183 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
184 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
185 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
186 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
187 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
188 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
189 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
190 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
191 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
192 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
195 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
196 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
197 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
198 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
199 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
200 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
201 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
202 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
205 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
206 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
207 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
208 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
209 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
210 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
211 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
212 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
213 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
216 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
217 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.64
Nodule 0
Rhizoplane 1.81
Rhizosphere 93.59
Stem 0
Stem Tuber 0
Unclassified 2.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1005300 3300001904 Bacteria 2179
2 JGI24741J21665_1009958 3300001915 Bacteria 1722
3 JGI24741J21665_1011557 3300001915 Bacteria 1538
4 JGI24747J21853_1042045 3300001978 Unclassified 544
5 JGI24740J21852_10003183 3300001979 Bacteria 7247
6 JGI24740J21852_10030262 3300001979 Bacteria 1765
7 JGI24740J21852_10098601 3300001979 Bacteria 746
8 JGI24740J21852_10105756 3300001979 Bacteria 713
9 JGI24739J22299_10000035 3300001989 Bacteria 37844
10 JGI24739J22299_10000226 3300001989 Bacteria 19010
11 JGI24739J22299_10002884 3300001989 Bacteria 6601
12 JGI24739J22299_10009390 3300001989 Bacteria 3644
13 JGI24739J22299_10013219 3300001989 Bacteria 3017
14 JGI24739J22299_10213379 3300001989 Unclassified 566
15 JGI24739J22299_10221727 3300001989 Bacteria 554
16 JGI24737J22298_10000020 3300001990 Bacteria 46324
17 JGI24737J22298_10001654 3300001990 Bacteria 7959
18 JGI24737J22298_10087698 3300001990 Bacteria 924
19 JGI24737J22298_10174590 3300001990 Unclassified 634
20 JGI24737J22298_10236500 3300001990 Bacteria 539
21 JGI24743J22301_10011075 3300001991 Bacteria 1618
22 JGI24743J22301_10088907 3300001991 Unclassified 657
23 JGI24735J21928_10000410 3300002067 Bacteria 14956
24 JGI24735J21928_10001761 3300002067 Bacteria 7614
25 JGI24735J21928_10002885 3300002067 Bacteria 5917
26 JGI24735J21928_10005066 3300002067 Bacteria 4386
27 JGI24735J21928_10005516 3300002067 Bacteria 4195
28 JGI24735J21928_10006583 3300002067 Bacteria 3819
29 JGI24735J21928_10019969 3300002067 Bacteria 2056
30 JGI24735J21928_10115648 3300002067 Unclassified 772
31 JGI24748J21848_1008077 3300002074 Bacteria 1236
32 JGI24738J21930_10000050 3300002075 Bacteria 24055
33 JGI24738J21930_10004723 3300002075 Bacteria 3318
34 JGI24738J21930_10004991 3300002075 Bacteria 3210
35 JGI24749J21850_1009490 3300002076 Bacteria 1360
36 JGI24744J21845_10000597 3300002077 Bacteria 6510
37 JGI24744J21845_10033763 3300002077 Unclassified 973
38 JGI24035J26624_1016107 3300002126 Bacteria 769
39 JGI24033J26618_1054937 3300002155 Bacteria 577
40 JGI24034J26672_10005517 3300002239 Bacteria 1814
41 JGI24034J26672_10042179 3300002239 Bacteria 768
42 JGI25164J39214_1011673 3300002772 Bacteria 839
43 JGI25165J46597_1000043 3300003214 Bacteria 264515
44 rootL2_10307941 3300003322 Bacteria 3580
45 Ga0055542_1006341 3300003762 Bacteria 2540
46 Ga0055529_1034584 3300003763 Unclassified 617
47 Ga0070658_10000105 3300005327 Bacteria 75360
48 Ga0070658_10002340 3300005327 Bacteria 15909
49 Ga0070658_10010382 3300005327 Bacteria 7468
50 Ga0070658_10376300 3300005327 Bacteria 1218
51 Ga0070658_10448517 3300005327 Bacteria 1111
52 Ga0070658_10615364 3300005327 Bacteria 942
53 Ga0070658_10774143 3300005327 Bacteria 833
54 Ga0070658_10915381 3300005327 Bacteria 762
55 Ga0070658_11751836 3300005327 Bacteria 537
56 Ga0070658_11997011 3300005327 Bacteria 500
57 Ga0070676_10034535 3300005328 Bacteria 2904
58 Ga0070676_10150929 3300005328 Unclassified 1487
59 Ga0070676_10175818 3300005328 Bacteria 1388
60 Ga0070676_10305685 3300005328 Bacteria 1080
61 Ga0070676_10330695 3300005328 Bacteria 1042
62 Ga0070676_11491700 3300005328 Bacteria 520
63 Ga0070683_100257604 3300005329 Bacteria 1659
64 Ga0070690_101104046 3300005330 Unclassified 629
65 Ga0070690_101249797 3300005330 Unclassified 594
66 Ga0070670_100014177 3300005331 Bacteria 6839
67 Ga0070670_100016985 3300005331 Bacteria 6248
68 Ga0070670_100153515 3300005331 Bacteria 1993
69 Ga0070677_10027489 3300005333 Bacteria 2142
70 Ga0070677_10340714 3300005333 Bacteria 774
71 Ga0070677_10552400 3300005333 Bacteria 631
72 Ga0070677_10716467 3300005333 Bacteria 565
73 Ga0068869_100000043 3300005334 Bacteria 52392
74 Ga0068869_100048853 3300005334 Bacteria 3061
75 Ga0068869_100648954 3300005334 Unclassified 896
76 Ga0068869_100686647 3300005334 Bacteria 872
77 Ga0070666_10082256 3300005335 Bacteria 2202
78 Ga0070666_10138425 3300005335 Bacteria 1695
79 Ga0070666_10156146 3300005335 Bacteria 1593
80 Ga0070666_10742320 3300005335 Bacteria 721
81 Ga0068868_100000149 3300005338 Bacteria 45719
82 Ga0068868_100001402 3300005338 Bacteria 16620
83 Ga0068868_100600288 3300005338 Bacteria 975
84 Ga0068868_101928251 3300005338 Unclassified 560
85 Ga0068868_102425121 3300005338 Unclassified 501
86 Ga0070660_100000415 3300005339 Bacteria 28402
87 Ga0070660_100000816 3300005339 Bacteria 20682
88 Ga0070660_100002945 3300005339 Bacteria 11711
89 Ga0070660_100035953 3300005339 Bacteria 3750
90 Ga0070660_100037728 3300005339 Bacteria 3663
91 Ga0070660_100259556 3300005339 Bacteria 1418
92 Ga0070660_100282521 3300005339 Bacteria 1358
93 Ga0070660_100431694 3300005339 Bacteria 1091
94 Ga0070660_100458177 3300005339 Bacteria 1058
95 Ga0070660_100994775 3300005339 Bacteria 708
96 Ga0070689_100047067 3300005340 Bacteria 3325
97 Ga0070687_100502791 3300005343 Bacteria 816
98 Ga0070661_100012789 3300005344 Bacteria 5877
99 Ga0070661_100023604 3300005344 Bacteria 4409
100 Ga0070661_100176000 3300005344 Bacteria 1626
101 Ga0070661_100583845 3300005344 Bacteria 902
102 Ga0070661_101513762 3300005344 Unclassified 566
103 Ga0070661_101898358 3300005344 Unclassified 506
104 Ga0070668_100045674 3300005347 Unclassified 3361
105 Ga0070668_100155474 3300005347 Bacteria 1852
106 Ga0070669_100000209 3300005353 Bacteria 48982
107 Ga0070669_100028859 3300005353 Bacteria 3997
108 Ga0070669_100554231 3300005353 Bacteria 959
109 Ga0070675_100004052 3300005354 Bacteria 11123
110 Ga0070675_100016633 3300005354 Bacteria 5840
111 Ga0070671_100016942 3300005355 Bacteria 5894
112 Ga0070671_100020598 3300005355 Bacteria 5381
113 Ga0070671_100059613 3300005355 Bacteria 3176
114 Ga0070671_100077792 3300005355 Bacteria 2772
115 Ga0070671_100122151 3300005355 Bacteria 2192
116 Ga0070671_100410109 3300005355 Bacteria 1160
117 Ga0070674_100034729 3300005356 Bacteria 3371
118 Ga0070673_100000006 3300005364 Bacteria 184299
119 Ga0070673_100000440 3300005364 Bacteria 21943
120 Ga0070673_100047277 3300005364 Bacteria 3348
121 Ga0070673_100598642 3300005364 Bacteria 1005
122 Ga0070673_100652108 3300005364 Bacteria 964
123 Ga0070659_100000903 3300005366 Bacteria 21708
124 Ga0070659_100028621 3300005366 Bacteria 4305
125 Ga0070659_100101931 3300005366 Bacteria 2311
126 Ga0070659_100129529 3300005366 Bacteria 2048
127 Ga0070659_100280577 3300005366 Bacteria 1386
128 Ga0070659_100514577 3300005366 Bacteria 1021
129 Ga0070659_100522544 3300005366 Bacteria 1013
130 Ga0070659_101057472 3300005366 Bacteria 714
131 Ga0070659_101634477 3300005366 Unclassified 575
132 Ga0070667_100002316 3300005367 Bacteria 16687
133 Ga0070667_100010891 3300005367 Bacteria 7522
134 Ga0070667_100023848 3300005367 Bacteria 5080
135 Ga0070667_100127545 3300005367 Bacteria 2218
136 Ga0070667_100132042 3300005367 Bacteria 2180
137 Ga0070667_100175676 3300005367 Bacteria 1893
138 Ga0070667_101011187 3300005367 Bacteria 776
139 Ga0070663_100007148 3300005455 Bacteria 6778
140 Ga0070663_100053840 3300005455 Bacteria 2874
141 Ga0070663_100108188 3300005455 Bacteria 2085
142 Ga0070663_100183657 3300005455 Bacteria 1624
143 Ga0070663_100200873 3300005455 Unclassified 1556
144 Ga0070663_100396315 3300005455 Bacteria 1127
145 Ga0070663_100441267 3300005455 Bacteria 1071
146 Ga0070663_100625860 3300005455 Bacteria 908
147 Ga0070663_100720859 3300005455 Bacteria 849
148 Ga0070678_100029246 3300005456 Bacteria 3771
149 Ga0070678_100286752 3300005456 Bacteria 1394
150 Ga0070662_100000324 3300005457 Bacteria 28542
151 Ga0070662_100035356 3300005457 Bacteria 3527
152 Ga0070662_100116766 3300005457 Bacteria 2040
153 Ga0070662_100444353 3300005457 Bacteria 1075
154 Ga0070662_100461994 3300005457 Bacteria 1055
155 Ga0070662_100840458 3300005457 Bacteria 781
156 Ga0070662_101403613 3300005457 Unclassified 602
157 Ga0070681_10791254 3300005458 Unclassified 865
158 Ga0070681_11966076 3300005458 Bacteria 513
159 Ga0068867_100000001 3300005459 Bacteria 427563
160 Ga0068867_100001209 3300005459 Bacteria 17732
161 Ga0068867_100012453 3300005459 Bacteria 6018
162 Ga0070679_100102138 3300005530 Bacteria 2853
163 Ga0070684_100198327 3300005535 Bacteria 1828
164 Ga0070684_101547806 3300005535 Bacteria 625
165 Ga0068853_100004143 3300005539 Bacteria 11177
166 Ga0068853_100078085 3300005539 Bacteria 2893
167 Ga0068853_100126163 3300005539 Bacteria 2286
168 Ga0068853_100145612 3300005539 Bacteria 2129
169 Ga0068853_102466044 3300005539 Bacteria 503
170 Ga0070672_100003604 3300005543 Bacteria 10038
171 Ga0070672_100259143 3300005543 Bacteria 1466
172 Ga0070672_100427725 3300005543 Bacteria 1138
173 Ga0070672_101665019 3300005543 Unclassified 573
174 Ga0070696_100267423 3300005546 Bacteria 1299
175 Ga0070696_101529780 3300005546 Bacteria 572
176 Ga0070693_101173023 3300005547 Bacteria 589
177 Ga0070665_100002264 3300005548 Bacteria 21390
178 Ga0070665_100022041 3300005548 Bacteria 6408
179 Ga0070665_100127195 3300005548 Bacteria 2550
180 Ga0070665_100264050 3300005548 Bacteria 1723
181 Ga0070665_100513964 3300005548 Unclassified 1209
182 Ga0070665_100995054 3300005548 Bacteria 851
183 Ga0070665_101534936 3300005548 Unclassified 674
184 Ga0070665_101748498 3300005548 Bacteria 629
185 Ga0068855_100000780 3300005563 Bacteria 39315
186 Ga0068855_100311462 3300005563 Bacteria 1741
187 Ga0070664_100112271 3300005564 Bacteria 2380
188 Ga0070664_100181918 3300005564 Bacteria 1868
189 Ga0070664_100314517 3300005564 Bacteria 1418
190 Ga0070664_100544828 3300005564 Bacteria 1072
191 Ga0070664_100701453 3300005564 Bacteria 943
192 Ga0070664_101753151 3300005564 Bacteria 589
193 Ga0070664_102124326 3300005564 Unclassified 533
194 Ga0068857_100001963 3300005577 Bacteria 16623
195 Ga0068857_100019067 3300005577 Bacteria 6020
196 Ga0068857_100251458 3300005577 Bacteria 1620
197 Ga0068857_100260817 3300005577 Bacteria 1590
198 Ga0068854_100004099 3300005578 Bacteria 9155
199 Ga0068854_100039628 3300005578 Bacteria 3321
200 Ga0068854_100057595 3300005578 Bacteria 2803
201 Ga0068854_100071113 3300005578 Bacteria 2544
202 Ga0068854_100870800 3300005578 Unclassified 790
203 Ga0068854_101486806 3300005578 Bacteria 614
204 Ga0068856_100014359 3300005614 Bacteria 7656
205 Ga0068856_100065440 3300005614 Bacteria 3593
206 Ga0068856_100097984 3300005614 Bacteria 2922
207 Ga0068856_100492521 3300005614 Bacteria 1247
208 Ga0068852_100000562 3300005616 Bacteria 24464
209 Ga0068852_100116770 3300005616 Bacteria 2435
210 Ga0068852_100707891 3300005616 Bacteria 1017
211 Ga0068852_101230914 3300005616 Bacteria 770
212 Ga0068852_101301540 3300005616 Bacteria 748
213 Ga0068852_101425013 3300005616 Bacteria 715
214 Ga0068859_100000783 3300005617 Bacteria 32120
215 Ga0068859_100000934 3300005617 Bacteria 29961
216 Ga0068859_100356512 3300005617 Bacteria 1557
217 Ga0068859_100684571 3300005617 Bacteria 1117
218 Ga0068864_100000181 3300005618 Bacteria 58221
219 Ga0068864_100002274 3300005618 Bacteria 15886
220 Ga0068864_100019551 3300005618 Bacteria 5665
221 Ga0068864_100125712 3300005618 Bacteria 2298
222 Ga0068866_10018207 3300005718 Unclassified 3173
223 Ga0068866_10323917 3300005718 Unclassified 970
224 Ga0068861_100016704 3300005719 Bacteria 5199
225 Ga0068861_100110779 3300005719 Bacteria 2199
226 Ga0068851_10037597 3300005834 Bacteria 2427
227 Ga0068851_10078145 3300005834 Bacteria 1724
228 Ga0068851_10235183 3300005834 Bacteria 1034
229 Ga0068851_10453301 3300005834 Bacteria 763
230 Ga0068851_10913634 3300005834 Unclassified 550
231 Ga0068870_10421550 3300005840 Unclassified 873
232 Ga0068870_11373404 3300005840 Bacteria 517
233 Ga0068863_100001525 3300005841 Bacteria 22887
234 Ga0068863_100013287 3300005841 Bacteria 7946
235 Ga0068863_100121938 3300005841 Bacteria 2486
236 Ga0068858_100002349 3300005842 Bacteria 19115
237 Ga0068858_100009036 3300005842 Bacteria 9528
238 Ga0068858_100225319 3300005842 Bacteria 1776
239 Ga0068858_101029458 3300005842 Bacteria 807
240 Ga0068860_100005988 3300005843 Bacteria 12240
241 Ga0068860_100063691 3300005843 Bacteria 3501
242 Ga0068860_100160815 3300005843 Bacteria 2165
243 Ga0068862_100015334 3300005844 Bacteria 6364
244 Ga0068862_100690692 3300005844 Bacteria 988
245 Ga0068862_101288528 3300005844 Bacteria 731
246 Ga0068862_101859369 3300005844 Unclassified 612
247 Ga0075362_10591220 3300006177 Unclassified 573
248 Ga0097621_100027264 3300006237 Bacteria 4491
249 Ga0097621_102443103 3300006237 Unclassified 500
250 Ga0068871_100060974 3300006358 Bacteria 3079
251 Ga0068865_100000003 3300006881 Bacteria 231761
252 Ga0068865_100000775 3300006881 Bacteria 17940
253 Ga0068865_100543879 3300006881 Bacteria 974
254 Ga0097620_100000783 3300006931 Bacteria 32120
255 Ga0097620_100000934 3300006931 Bacteria 29961
256 Ga0097620_100356513 3300006931 Bacteria 1557
257 Ga0097620_100684518 3300006931 Bacteria 1117
258 Ga0105250_10027166 3300009092 Bacteria 2306
259 Ga0105250_10512887 3300009092 Unclassified 545
260 Ga0105240_10036359 3300009093 Bacteria 6337
261 Ga0105245_10000120 3300009098 Bacteria 75923
262 Ga0105245_10106004 3300009098 Bacteria 2607
263 Ga0105247_10182973 3300009101 Bacteria 1399
264 Ga0105247_10216856 3300009101 Bacteria 1293
265 Ga0105243_10029665 3300009148 Bacteria 4207
266 Ga0105243_10075598 3300009148 Bacteria 2734
267 Ga0105243_11771821 3300009148 Unclassified 648
268 Ga0105241_10099141 3300009174 Bacteria 2313
269 Ga0105241_10442899 3300009174 Bacteria 1148
270 Ga0105241_12194235 3300009174 Bacteria 547
271 Ga0105242_10002812 3300009176 Bacteria 13637
272 Ga0105242_10601788 3300009176 Bacteria 1062
273 Ga0105248_10000256 3300009177 Bacteria 62138
274 Ga0105248_10028022 3300009177 Bacteria 6274
275 Ga0105248_10327279 3300009177 Bacteria 1726
276 Ga0105248_11007265 3300009177 Bacteria 941
277 Ga0105248_11472195 3300009177 Bacteria 771
278 Ga0105237_10245525 3300009545 Bacteria 1792
279 Ga0105238_10128438 3300009551 Bacteria 2513
280 Ga0105238_10945371 3300009551 Bacteria 881
281 Ga0105238_10992963 3300009551 Unclassified 860
282 Ga0105249_10043627 3300009553 Bacteria 4078
283 Ga0105249_10358075 3300009553 Bacteria 1480
284 Ga0105249_10395917 3300009553 Bacteria 1410
285 Ga0105239_10090598 3300010375 Bacteria 3374
286 Ga0105239_12196724 3300010375 Bacteria 642
287 Ga0105246_10001420 3300011119 Bacteria 14190
288 Ga0105246_10033753 3300011119 Bacteria 3404
289 Ga0105246_10070186 3300011119 Bacteria 2463
290 Ga0157373_10002630 3300013100 Bacteria 13620
291 Ga0157373_10059883 3300013100 Bacteria 2698
292 Ga0157373_10266538 3300013100 Bacteria 1212
293 Ga0157373_11278801 3300013100 Bacteria 555
294 Ga0157371_10023247 3300013102 Bacteria 4532
295 Ga0157371_10113518 3300013102 Bacteria 1924
296 Ga0157371_10194020 3300013102 Unclassified 1455
297 Ga0157371_10380753 3300013102 Bacteria 1030
298 Ga0157370_10000069 3300013104 Bacteria 112889
299 Ga0157370_10349270 3300013104 Bacteria 1363
300 Ga0157369_10046681 3300013105 Bacteria 4707
301 Ga0157369_10332080 3300013105 Bacteria 1580
302 Ga0157369_12689950 3300013105 Unclassified 501
303 Ga0157374_10214942 3300013296 Bacteria 1886
304 Ga0157374_12156187 3300013296 Unclassified 584
305 Ga0157378_10274682 3300013297 Bacteria 1622
306 Ga0157378_13159307 3300013297 Bacteria 512
307 Ga0163162_10016313 3300013306 Bacteria 7262
308 Ga0163162_10101365 3300013306 Bacteria 2971
309 Ga0163162_10198189 3300013306 Bacteria 2137
310 Ga0157372_10016779 3300013307 Bacteria 7861
311 Ga0157372_10069560 3300013307 Bacteria 3959
312 Ga0157372_10103381 3300013307 Unclassified 3255
313 Ga0157372_10135847 3300013307 Bacteria 2832
314 Ga0157372_10279329 3300013307 Bacteria 1941
315 Ga0157372_10409917 3300013307 Bacteria 1579
316 Ga0157372_10671516 3300013307 Bacteria 1206
317 Ga0157372_10785700 3300013307 Unclassified 1106
318 Ga0157372_11032750 3300013307 Bacteria 952
319 Ga0157372_11818059 3300013307 Bacteria 701
320 Ga0157375_10003338 3300013308 Bacteria 13911
321 Ga0157375_11282399 3300013308 Unclassified 861
322 Ga0157375_13006601 3300013308 Unclassified 563
323 Ga0157375_13159729 3300013308 Unclassified 549
324 Ga0163163_10000192 3300014325 Bacteria 62963
325 Ga0163163_10084563 3300014325 Bacteria 3179
326 Ga0157380_13439736 3300014326 Unclassified 507
327 Ga0157377_10018041 3300014745 Bacteria 3662
328 Ga0157377_10146491 3300014745 Bacteria 1456
329 Ga0157379_10004595 3300014968 Bacteria 11843
330 Ga0157379_11222280 3300014968 Bacteria 723
331 Ga0157376_10001542 3300014969 Bacteria 15190
332 Ga0157376_12627142 3300014969 Bacteria 543
333 Ga0209148_1000870 3300025254 Bacteria 21040
334 Ga0209455_1000386 3300025272 Bacteria 39294
335 Ga0207697_10000260 3300025315 Bacteria 29097
336 Ga0207697_10468182 3300025315 Unclassified 558
337 Ga0207656_10505788 3300025321 Bacteria 613
338 Ga0207696_1048108 3300025711 Bacteria 1227
339 Ga0207682_10303354 3300025893 Bacteria 749
340 Ga0207642_10096507 3300025899 Bacteria 1474
341 Ga0207710_10499630 3300025900 Unclassified 631
342 Ga0207688_10000225 3300025901 Bacteria 25468
343 Ga0207688_10051768 3300025901 Bacteria 2300
344 Ga0207688_10893955 3300025901 Bacteria 562
345 Ga0207680_10026049 3300025903 Bacteria 3235
346 Ga0207680_10063603 3300025903 Bacteria 2259
347 Ga0207680_10108768 3300025903 Bacteria 1794
348 Ga0207647_10000052 3300025904 Bacteria 87651
349 Ga0207647_10000261 3300025904 Bacteria 43301
350 Ga0207647_10012956 3300025904 Bacteria 5794
351 Ga0207647_10023553 3300025904 Bacteria 4071
352 Ga0207647_10091150 3300025904 Bacteria 1817
353 Ga0207647_10171196 3300025904 Bacteria 1264
354 Ga0207645_10011101 3300025907 Bacteria 6162
355 Ga0207645_10100868 3300025907 Bacteria 1862
356 Ga0207645_10143824 3300025907 Bacteria 1554
357 Ga0207643_10919816 3300025908 Unclassified 567
358 Ga0207705_10000022 3300025909 Bacteria 302232
359 Ga0207705_10000591 3300025909 Bacteria 30449
360 Ga0207705_10038135 3300025909 Bacteria 3439
361 Ga0207705_10360482 3300025909 Bacteria 1121
362 Ga0207705_10469357 3300025909 Bacteria 976
363 Ga0207705_10494925 3300025909 Bacteria 949
364 Ga0207705_10660955 3300025909 Bacteria 813
365 Ga0207705_11217465 3300025909 Bacteria 577
366 Ga0207705_11262416 3300025909 Bacteria 565
367 Ga0207654_10052413 3300025911 Bacteria 2351
368 Ga0207707_11098924 3300025912 Bacteria 648
369 Ga0207695_10051333 3300025913 Bacteria 4331
370 Ga0207671_10136657 3300025914 Bacteria 1885
371 Ga0207662_10892089 3300025918 Bacteria 629
372 Ga0207657_10001207 3300025919 Bacteria 27516
373 Ga0207657_10002788 3300025919 Bacteria 18798
374 Ga0207657_10004059 3300025919 Bacteria 15547
375 Ga0207657_10007120 3300025919 Bacteria 11485
376 Ga0207657_10027835 3300025919 Bacteria 5169
377 Ga0207657_10036418 3300025919 Bacteria 4404
378 Ga0207657_10595582 3300025919 Bacteria 863
379 Ga0207657_10806690 3300025919 Bacteria 725
380 Ga0207657_10956909 3300025919 Bacteria 658
381 Ga0207649_10009658 3300025920 Bacteria 5283
382 Ga0207649_10025729 3300025920 Bacteria 3434
383 Ga0207649_10142207 3300025920 Bacteria 1643
384 Ga0207649_10688947 3300025920 Bacteria 792
385 Ga0207649_10748748 3300025920 Bacteria 760
386 Ga0207649_10808887 3300025920 Bacteria 732
387 Ga0207649_10836566 3300025920 Unclassified 720
388 Ga0207652_10733461 3300025921 Bacteria 880
389 Ga0207681_10002587 3300025923 Bacteria 11459
390 Ga0207681_10081882 3300025923 Bacteria 2280
391 Ga0207681_10303548 3300025923 Bacteria 1264
392 Ga0207694_10147759 3300025924 Bacteria 1893
393 Ga0207694_11539105 3300025924 Bacteria 561
394 Ga0207694_11787363 3300025924 Unclassified 517
395 Ga0207650_10006658 3300025925 Bacteria 7881
396 Ga0207650_10329826 3300025925 Bacteria 1251
397 Ga0207650_11276749 3300025925 Unclassified 625
398 Ga0207659_10041870 3300025926 Bacteria 3209
399 Ga0207659_10122426 3300025926 Bacteria 1995
400 Ga0207687_10006406 3300025927 Bacteria 7776
401 Ga0207644_10010959 3300025931 Bacteria 5989
402 Ga0207644_10014050 3300025931 Bacteria 5353
403 Ga0207644_10194660 3300025931 Bacteria 1596
404 Ga0207644_10335807 3300025931 Bacteria 1224
405 Ga0207644_10924349 3300025931 Bacteria 731
406 Ga0207644_11473298 3300025931 Unclassified 571
407 Ga0207644_11783386 3300025931 Unclassified 515
408 Ga0207690_10000463 3300025932 Bacteria 26092
409 Ga0207690_10018806 3300025932 Bacteria 4242
410 Ga0207690_10396487 3300025932 Bacteria 1100
411 Ga0207690_10714145 3300025932 Bacteria 825
412 Ga0207690_11023658 3300025932 Bacteria 687
413 Ga0207706_10001178 3300025933 Bacteria 26405
414 Ga0207706_10009206 3300025933 Bacteria 9073
415 Ga0207706_10009419 3300025933 Bacteria 8966
416 Ga0207706_10044141 3300025933 Bacteria 3951
417 Ga0207706_10056717 3300025933 Bacteria 3453
418 Ga0207706_10127883 3300025933 Bacteria 2234
419 Ga0207686_10003952 3300025934 Bacteria 7947
420 Ga0207686_10364344 3300025934 Bacteria 1092
421 Ga0207709_10012181 3300025935 Bacteria 4740
422 Ga0207709_10227256 3300025935 Bacteria 1350
423 Ga0207670_10101714 3300025936 Bacteria 2053
424 Ga0207704_10000001 3300025938 Bacteria 716296
425 Ga0207704_10015412 3300025938 Bacteria 3894
426 Ga0207691_10035008 3300025940 Bacteria 4666
427 Ga0207691_10327663 3300025940 Bacteria 1312
428 Ga0207691_11282061 3300025940 Unclassified 605
429 Ga0207711_10004639 3300025941 Bacteria 11676
430 Ga0207711_10100492 3300025941 Bacteria 2558
431 Ga0207711_11011740 3300025941 Bacteria 771
432 Ga0207711_11261931 3300025941 Bacteria 681
433 Ga0207689_10000014 3300025942 Bacteria 122534
434 Ga0207689_10009319 3300025942 Bacteria 8487
435 Ga0207689_10038367 3300025942 Bacteria 3968
436 Ga0207661_10583436 3300025944 Bacteria 1025
437 Ga0207679_10023452 3300025945 Bacteria 4221
438 Ga0207679_10148183 3300025945 Bacteria 1906
439 Ga0207679_10270068 3300025945 Bacteria 1454
440 Ga0207679_10394474 3300025945 Bacteria 1216
441 Ga0207679_10910409 3300025945 Bacteria 805
442 Ga0207679_11264249 3300025945 Bacteria 677
443 Ga0207667_10029534 3300025949 Bacteria 5945
444 Ga0207667_10195785 3300025949 Bacteria 2073
445 Ga0207651_10000002 3300025960 Bacteria 427663
446 Ga0207651_10000310 3300025960 Bacteria 20959
447 Ga0207651_10006153 3300025960 Bacteria 6244
448 Ga0207651_10093201 3300025960 Bacteria 2211
449 Ga0207651_10851434 3300025960 Bacteria 810
450 Ga0207651_11393103 3300025960 Unclassified 631
451 Ga0207712_10232546 3300025961 Bacteria 1480
452 Ga0207712_10268883 3300025961 Bacteria 1386
453 Ga0207668_10488183 3300025972 Bacteria 1057
454 Ga0207640_10001199 3300025981 Bacteria 14165
455 Ga0207640_10033526 3300025981 Bacteria 3196
456 Ga0207640_10183867 3300025981 Bacteria 1569
457 Ga0207640_10511030 3300025981 Bacteria 1002
458 Ga0207640_10758514 3300025981 Bacteria 837
459 Ga0207640_11251272 3300025981 Unclassified 661
460 Ga0207658_10005035 3300025986 Bacteria 9101
461 Ga0207658_10005707 3300025986 Bacteria 8511
462 Ga0207658_10034873 3300025986 Bacteria 3599
463 Ga0207658_10069179 3300025986 Bacteria 2667
464 Ga0207658_10107948 3300025986 Bacteria 2194
465 Ga0207658_10219822 3300025986 Bacteria 1597
466 Ga0207658_10244640 3300025986 Bacteria 1521
467 Ga0207677_10000776 3300026023 Bacteria 18351
468 Ga0207677_10002094 3300026023 Bacteria 10500
469 Ga0207677_10690026 3300026023 Bacteria 905
470 Ga0207677_11373280 3300026023 Bacteria 650
471 Ga0207703_10001172 3300026035 Bacteria 24751
472 Ga0207703_10027804 3300026035 Bacteria 4454
473 Ga0207703_11759504 3300026035 Bacteria 596
474 Ga0207639_10004768 3300026041 Bacteria 9139
475 Ga0207639_10027474 3300026041 Bacteria 4147
476 Ga0207639_10136429 3300026041 Bacteria 2038
477 Ga0207639_10200488 3300026041 Bacteria 1711
478 Ga0207639_10228672 3300026041 Bacteria 1611
479 Ga0207639_10540011 3300026041 Bacteria 1069
480 Ga0207639_10715370 3300026041 Bacteria 930
481 Ga0207639_11849706 3300026041 Bacteria 565
482 Ga0207678_10000354 3300026067 Bacteria 41704
483 Ga0207678_10008727 3300026067 Bacteria 8925
484 Ga0207678_10068990 3300026067 Bacteria 3032
485 Ga0207678_10310959 3300026067 Bacteria 1355
486 Ga0207678_10943910 3300026067 Bacteria 763
487 Ga0207678_10963768 3300026067 Unclassified 755
488 Ga0207702_10151789 3300026078 Bacteria 2108
489 Ga0207702_10279512 3300026078 Bacteria 1578
490 Ga0207702_10460330 3300026078 Bacteria 1235
491 Ga0207641_10033991 3300026088 Bacteria 4238
492 Ga0207641_10105797 3300026088 Bacteria 2485
493 Ga0207641_10156621 3300026088 Bacteria 2067
494 Ga0207641_10502534 3300026088 Bacteria 1177
495 Ga0207641_10548265 3300026088 Bacteria 1127
496 Ga0207641_10554415 3300026088 Bacteria 1121
497 Ga0207648_10000001 3300026089 Bacteria 427499
498 Ga0207648_10001420 3300026089 Bacteria 26422
499 Ga0207648_10010858 3300026089 Bacteria 8609
500 Ga0207648_11619473 3300026089 Bacteria 608
501 Ga0207676_10000666 3300026095 Bacteria 27542
502 Ga0207676_10065760 3300026095 Bacteria 2888
503 Ga0207676_10482224 3300026095 Bacteria 1174
504 Ga0207674_10000139 3300026116 Bacteria 84273
505 Ga0207674_10000244 3300026116 Bacteria 67590
506 Ga0207674_10004090 3300026116 Bacteria 17674
507 Ga0207674_10311577 3300026116 Bacteria 1523
508 Ga0207674_12214480 3300026116 Unclassified 512
509 Ga0207675_100068862 3300026118 Bacteria 3307
510 Ga0207675_100290115 3300026118 Bacteria 1591
511 Ga0207675_100557677 3300026118 Bacteria 1145
512 Ga0207683_10013761 3300026121 Bacteria 6898
513 Ga0207683_10328477 3300026121 Bacteria 1402
514 Ga0207698_10008014 3300026142 Bacteria 6659
515 Ga0207698_10175895 3300026142 Bacteria 1890
516 Ga0207698_11557728 3300026142 Bacteria 676
517 Ga0207698_12143158 3300026142 Bacteria 572
518 Ga0268266_10001998 3300028379 Bacteria 22799
519 Ga0268266_10093825 3300028379 Bacteria 2633
520 Ga0268266_10410457 3300028379 Bacteria 1282
521 Ga0268266_10510427 3300028379 Bacteria 1148
522 Ga0268265_10031590 3300028380 Bacteria 3825
523 Ga0268265_10102357 3300028380 Bacteria 2316
524 Ga0268265_10224201 3300028380 Bacteria 1647
525 Ga0268265_10442413 3300028380 Bacteria 1212
526 Ga0268265_10515553 3300028380 Bacteria 1129
527 Ga0268264_10003356 3300028381 Bacteria 13841
528 Ga0268264_10004801 3300028381 Bacteria 11462
529 Ga0268264_10527383 3300028381 Bacteria 1155
530 Ga0268264_10907169 3300028381 Unclassified 885
531 Ga0268264_11512634 3300028381 Bacteria 682
532 Ga0307408_100135068 3300031548 Unclassified 1929
533 Ga0307405_10001525 3300031731 Bacteria 9807
534 Ga0307413_10013408 3300031824 Bacteria 4119
535 Ga0307410_10007748 3300031852 Bacteria 5900
536 Ga0307412_10037822 3300031911 Bacteria 3103
537 Ga0307409_100001492 3300031995 Bacteria 11545
538 Ga0307416_100000484 3300032002 Bacteria 20246
539 Ga0307414_10007126 3300032004 Bacteria 6276
540 Ga0307411_10004047 3300032005 Bacteria 6939
541 Ga0307415_100001486 3300032126 Bacteria 11242
542 Ga0395899_0023425 3300037312 Bacteria 4676
543 Ga0395899_0159599 3300037312 Bacteria 1594
544 Ga0395899_0965980 3300037312 Unclassified 516
545 Ga0395900_0278919 3300037418 Bacteria 1664
546 Ga0395900_0651483 3300037418 Unclassified 990
547 Ga0395898_0457807 3300037466 Bacteria 1215
548 Ga0395898_1018130 3300037466 Bacteria 764
549 Ga0395905_0124998 3300037471 Unclassified 2419
550 Ga0395905_0900659 3300037471 Unclassified 787
551 Ga0395905_1660352 3300037471 Unclassified 544
552 Ga0395901_0194626 3300038443 Bacteria 2126
553 Ga0395901_0196194 3300038443 Bacteria 2117
554 Ga0395901_0341119 3300038443 Bacteria 1548
555 Ga0395901_0423444 3300038443 Bacteria 1365
556 Ga0395901_1076457 3300038443 Unclassified 776
557 Ga0439465_0263060 3300041413 Unclassified 640
558 Ga0451787_762348 3300041441 Bacteria 620
559 Ga0451789_0823438 3300041443 Bacteria 1888
560 Ga0451789_1301034 3300041443 Bacteria 631
561 Ga0451793_0299515 3300041452 Bacteria 794
562 Ga0451797_1027370 3300041453 Bacteria 683
563 Ga0451795_0528729 3300041456 Bacteria 1243
564 Ga0451798_0040090 3300041458 Bacteria 764
565 Ga0451800_0533049 3300041459 Unclassified 624
566 Ga0451802_0306496 3300041460 Bacteria 2895
567 Ga0451806_825822 3300041462 Bacteria 4971
568 Ga0439445_0069270 3300042004 Unclassified 974
569 Ga0439448_0012147 3300042005 Bacteria 2573
570 Ga0439455_0158024 3300042012 Unclassified 647
571 Ga0439458_0004217 3300042157 Bacteria 3321
572 Ga0466970_0790087 3300044765 Unclassified 556
573 Ga0466958_0166480 3300045836 Bacteria 1395
574 Ga0466967_0218723 3300045976 Bacteria 1809
575 Ga0466967_0334679 3300045976 Bacteria 1463
576 Ga0466967_2494192 3300045976 Unclassified 512
577 Ga0495583_0223227 3300046506 Unclassified 761
578 Ga0495606_0345359 3300046507 Bacteria 791
579 Ga0495632_0311089 3300046519 Unclassified 697
580 Ga0495663_0155627 3300046525 Bacteria 782
581 Ga0495669_0007330 3300046684 Bacteria 4621
582 Ga0495669_0088783 3300046684 Bacteria 1425
583 Ga0495649_0264159 3300046694 Bacteria 882
584 Ga0495589_0569291 3300046794 Bacteria 516
585 Ga0495677_0095472 3300047445 Bacteria 1123
586 Ga0495686_0003535 3300047472 Bacteria 13465
587 Ga0496107_0735006 3300048910 Bacteria 725
588 Ga0496116_0283388 3300048919 Bacteria 801
589 Ga0496117_0009632 3300048920 Bacteria 8938
590 Ga0496117_0028171 3300048920 Bacteria 4354
591 Ga0496117_0059419 3300048920 Bacteria 2641
592 Ga0496118_0064135 3300048921 Bacteria 2698
593 Ga0496118_0113465 3300048921 Bacteria 1790
594 Ga0496119_0020335 3300048922 Bacteria 4847
595 Ga0496120_0027266 3300048923 Bacteria 3516
596 Ga0496121_0076177 3300048924 Bacteria 2676
597 Ga0496121_0129618 3300048924 Bacteria 1890
598 Ga0496121_0630996 3300048924 Bacteria 656
599 Ga0496122_0017742 3300048925 Bacteria 6627
600 Ga0496123_0021916 3300048926 Bacteria 4946
601 Ga0496124_0096661 3300048927 Bacteria 2399
602 Ga0496124_0514772 3300048927 Bacteria 799
603 Ga0496124_0809932 3300048927 Unclassified 579
604 Ga0496125_0006169 3300048928 Bacteria 13066
605 Ga0501035_1179084 3300049822 Unclassified 595
606 Ga0500604_0012109 3300053151 Bacteria 2325
607 Ga0500616_0004722 3300053153 Bacteria 9590
608 Ga0500611_001223 3300053727 Unclassified 2756

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005577 Ga0068857_100251458 Ga0068857_1002514582 60
2 3300026116 Ga0207674_10311577 Ga0207674_103115772 60
3 3300001904 JGI24736J21556_1005300 JGI24736J21556_10053003 62
4 3300001915 JGI24741J21665_1009958 JGI24741J21665_10099582 62
5 3300001915 JGI24741J21665_1011557 JGI24741J21665_10115573 62
6 3300001978 JGI24747J21853_1042045 JGI24747J21853_10420452 62
7 3300001979 JGI24740J21852_10003183 JGI24740J21852_100031834 62
8 3300001979 JGI24740J21852_10030262 JGI24740J21852_100302622 62
9 3300001979 JGI24740J21852_10098601 JGI24740J21852_100986012 62
10 3300001979 JGI24740J21852_10105756 JGI24740J21852_101057562 62
11 3300001989 JGI24739J22299_10000035 JGI24739J22299_1000003524 62
12 3300001989 JGI24739J22299_10000226 JGI24739J22299_100002267 62
13 3300001989 JGI24739J22299_10002884 JGI24739J22299_100028847 62
14 3300001989 JGI24739J22299_10009390 JGI24739J22299_100093906 62
15 3300001989 JGI24739J22299_10013219 JGI24739J22299_100132193 62
16 3300001989 JGI24739J22299_10213379 JGI24739J22299_102133792 62
17 3300001989 JGI24739J22299_10221727 JGI24739J22299_102217272 62
18 3300001990 JGI24737J22298_10000020 JGI24737J22298_1000002011 62
19 3300001990 JGI24737J22298_10001654 JGI24737J22298_100016542 62
20 3300001990 JGI24737J22298_10087698 JGI24737J22298_100876982 62
21 3300001990 JGI24737J22298_10174590 JGI24737J22298_101745902 62
22 3300001990 JGI24737J22298_10236500 JGI24737J22298_102365001 62
23 3300001991 JGI24743J22301_10011075 JGI24743J22301_100110753 62
24 3300001991 JGI24743J22301_10088907 JGI24743J22301_100889072 62
25 3300002067 JGI24735J21928_10000410 JGI24735J21928_1000041017 62
26 3300002067 JGI24735J21928_10001761 JGI24735J21928_100017613 62
27 3300002067 JGI24735J21928_10002885 JGI24735J21928_100028857 62
28 3300002067 JGI24735J21928_10005066 JGI24735J21928_100050661 62
29 3300002067 JGI24735J21928_10005516 JGI24735J21928_100055163 62
30 3300002067 JGI24735J21928_10006583 JGI24735J21928_100065834 62
31 3300002067 JGI24735J21928_10019969 JGI24735J21928_100199691 62
32 3300002067 JGI24735J21928_10115648 JGI24735J21928_101156482 62
33 3300002074 JGI24748J21848_1008077 JGI24748J21848_10080771 62
34 3300002075 JGI24738J21930_10000050 JGI24738J21930_1000005015 62
35 3300002075 JGI24738J21930_10004723 JGI24738J21930_100047234 62
36 3300002075 JGI24738J21930_10004991 JGI24738J21930_100049912 62
37 3300002076 JGI24749J21850_1009490 JGI24749J21850_10094901 62
38 3300002077 JGI24744J21845_10000597 JGI24744J21845_100005972 62
39 3300002077 JGI24744J21845_10033763 JGI24744J21845_100337632 62
40 3300002126 JGI24035J26624_1016107 JGI24035J26624_10161072 62
41 3300002155 JGI24033J26618_1054937 JGI24033J26618_10549372 62
42 3300002239 JGI24034J26672_10005517 JGI24034J26672_100055172 62
43 3300002239 JGI24034J26672_10042179 JGI24034J26672_100421791 62
44 3300002772 JGI25164J39214_1011673 JGI25164J39214_10116732 62
45 3300003214 JGI25165J46597_1000043 JGI25165J46597_1000043140 62
46 3300003322 rootL2_10307941 rootL2_103079412 62
47 3300003762 Ga0055542_1006341 Ga0055542_10063415 62
48 3300003763 Ga0055529_1034584 Ga0055529_10345842 62
49 3300005327 Ga0070658_10000105 Ga0070658_1000010532 62
50 3300005327 Ga0070658_10002340 Ga0070658_1000234011 62
51 3300005327 Ga0070658_10010382 Ga0070658_100103827 62
52 3300005327 Ga0070658_10376300 Ga0070658_103763003 62
53 3300005327 Ga0070658_10448517 Ga0070658_104485172 62
54 3300005327 Ga0070658_10615364 Ga0070658_106153642 62
55 3300005327 Ga0070658_10774143 Ga0070658_107741432 62
56 3300005327 Ga0070658_10915381 Ga0070658_109153812 62
57 3300005327 Ga0070658_11751836 Ga0070658_117518362 62
58 3300005327 Ga0070658_11997011 Ga0070658_119970112 62
59 3300005328 Ga0070676_10034535 Ga0070676_100345352 62
60 3300005328 Ga0070676_10150929 Ga0070676_101509292 62
61 3300005328 Ga0070676_10175818 Ga0070676_101758182 62
62 3300005328 Ga0070676_10305685 Ga0070676_103056852 62
63 3300005328 Ga0070676_10330695 Ga0070676_103306952 62
64 3300005328 Ga0070676_11491700 Ga0070676_114917002 62
65 3300005329 Ga0070683_100257604 Ga0070683_1002576043 62
66 3300005330 Ga0070690_101104046 Ga0070690_1011040462 62
67 3300005330 Ga0070690_101249797 Ga0070690_1012497971 62
68 3300005331 Ga0070670_100014177 Ga0070670_1000141775 62
69 3300005331 Ga0070670_100016985 Ga0070670_1000169852 62
70 3300005331 Ga0070670_100153515 Ga0070670_1001535152 62
71 3300005333 Ga0070677_10027489 Ga0070677_100274892 62
72 3300005333 Ga0070677_10340714 Ga0070677_103407141 62
73 3300005333 Ga0070677_10552400 Ga0070677_105524002 62
74 3300005333 Ga0070677_10716467 Ga0070677_107164672 62
75 3300005334 Ga0068869_100000043 Ga0068869_10000004339 62
76 3300005334 Ga0068869_100048853 Ga0068869_1000488533 62
77 3300005334 Ga0068869_100648954 Ga0068869_1006489542 62
78 3300005334 Ga0068869_100686647 Ga0068869_1006866472 62
79 3300005335 Ga0070666_10082256 Ga0070666_100822561 62
80 3300005335 Ga0070666_10138425 Ga0070666_101384253 62
81 3300005335 Ga0070666_10156146 Ga0070666_101561463 62
82 3300005335 Ga0070666_10742320 Ga0070666_107423202 62
83 3300005338 Ga0068868_100000149 Ga0068868_1000001495 62
84 3300005338 Ga0068868_100001402 Ga0068868_1000014027 62
85 3300005338 Ga0068868_100600288 Ga0068868_1006002882 62
86 3300005338 Ga0068868_101928251 Ga0068868_1019282512 62
87 3300005338 Ga0068868_102425121 Ga0068868_1024251211 62
88 3300005339 Ga0070660_100000415 Ga0070660_1000004155 62
89 3300005339 Ga0070660_100000816 Ga0070660_1000008162 62
90 3300005339 Ga0070660_100002945 Ga0070660_1000029457 62
91 3300005339 Ga0070660_100035953 Ga0070660_1000359532 62
92 3300005339 Ga0070660_100037728 Ga0070660_1000377282 62
93 3300005339 Ga0070660_100259556 Ga0070660_1002595563 62
94 3300005339 Ga0070660_100282521 Ga0070660_1002825213 62
95 3300005339 Ga0070660_100431694 Ga0070660_1004316942 62
96 3300005339 Ga0070660_100458177 Ga0070660_1004581772 62
97 3300005339 Ga0070660_100994775 Ga0070660_1009947751 62
98 3300005340 Ga0070689_100047067 Ga0070689_1000470672 62
99 3300005343 Ga0070687_100502791 Ga0070687_1005027912 62
100 3300005344 Ga0070661_100012789 Ga0070661_1000127893 62
101 3300005344 Ga0070661_100023604 Ga0070661_1000236043 62
102 3300005344 Ga0070661_100176000 Ga0070661_1001760002 62
103 3300005344 Ga0070661_100583845 Ga0070661_1005838452 62
104 3300005344 Ga0070661_101513762 Ga0070661_1015137621 62
105 3300005344 Ga0070661_101898358 Ga0070661_1018983581 62
106 3300005347 Ga0070668_100045674 Ga0070668_1000456742 62
107 3300005347 Ga0070668_100155474 Ga0070668_1001554742 62
108 3300005353 Ga0070669_100000209 Ga0070669_10000020926 62
109 3300005353 Ga0070669_100028859 Ga0070669_1000288592 62
110 3300005353 Ga0070669_100554231 Ga0070669_1005542312 62
111 3300005354 Ga0070675_100004052 Ga0070675_1000040528 62
112 3300005354 Ga0070675_100016633 Ga0070675_1000166337 62
113 3300005355 Ga0070671_100016942 Ga0070671_1000169427 62
114 3300005355 Ga0070671_100020598 Ga0070671_1000205984 62
115 3300005355 Ga0070671_100059613 Ga0070671_1000596134 62
116 3300005355 Ga0070671_100077792 Ga0070671_1000777923 62
117 3300005355 Ga0070671_100122151 Ga0070671_1001221511 62
118 3300005355 Ga0070671_100410109 Ga0070671_1004101092 62
119 3300005356 Ga0070674_100034729 Ga0070674_1000347292 62
120 3300005364 Ga0070673_100000006 Ga0070673_10000000667 62
121 3300005364 Ga0070673_100000440 Ga0070673_10000044016 62
122 3300005364 Ga0070673_100047277 Ga0070673_1000472776 62
123 3300005364 Ga0070673_100598642 Ga0070673_1005986422 62
124 3300005364 Ga0070673_100652108 Ga0070673_1006521082 62
125 3300005366 Ga0070659_100000903 Ga0070659_10000090310 62
126 3300005366 Ga0070659_100028621 Ga0070659_1000286214 62
127 3300005366 Ga0070659_100101931 Ga0070659_1001019312 62
128 3300005366 Ga0070659_100129529 Ga0070659_1001295293 62
129 3300005366 Ga0070659_100280577 Ga0070659_1002805775 62
130 3300005366 Ga0070659_100514577 Ga0070659_1005145771 62
131 3300005366 Ga0070659_100522544 Ga0070659_1005225442 62
132 3300005366 Ga0070659_101057472 Ga0070659_1010574721 62
133 3300005366 Ga0070659_101634477 Ga0070659_1016344772 62
134 3300005367 Ga0070667_100002316 Ga0070667_1000023167 62
135 3300005367 Ga0070667_100010891 Ga0070667_10001089110 62
136 3300005367 Ga0070667_100023848 Ga0070667_1000238483 62
137 3300005367 Ga0070667_100127545 Ga0070667_1001275452 62
138 3300005367 Ga0070667_100132042 Ga0070667_1001320423 62
139 3300005367 Ga0070667_100175676 Ga0070667_1001756763 62
140 3300005367 Ga0070667_101011187 Ga0070667_1010111872 62
141 3300005455 Ga0070663_100007148 Ga0070663_1000071483 62
142 3300005455 Ga0070663_100053840 Ga0070663_1000538403 62
143 3300005455 Ga0070663_100108188 Ga0070663_1001081884 62
144 3300005455 Ga0070663_100183657 Ga0070663_1001836572 62
145 3300005455 Ga0070663_100200873 Ga0070663_1002008732 62
146 3300005455 Ga0070663_100396315 Ga0070663_1003963152 62
147 3300005455 Ga0070663_100441267 Ga0070663_1004412672 62
148 3300005455 Ga0070663_100625860 Ga0070663_1006258601 62
149 3300005455 Ga0070663_100720859 Ga0070663_1007208592 62
150 3300005456 Ga0070678_100029246 Ga0070678_1000292464 62
151 3300005456 Ga0070678_100286752 Ga0070678_1002867522 62
152 3300005457 Ga0070662_100000324 Ga0070662_10000032418 62
153 3300005457 Ga0070662_100035356 Ga0070662_1000353563 62
154 3300005457 Ga0070662_100116766 Ga0070662_1001167662 62
155 3300005457 Ga0070662_100444353 Ga0070662_1004443532 62
156 3300005457 Ga0070662_100461994 Ga0070662_1004619941 62
157 3300005457 Ga0070662_100840458 Ga0070662_1008404582 62
158 3300005457 Ga0070662_101403613 Ga0070662_1014036132 62
159 3300005458 Ga0070681_10791254 Ga0070681_107912542 62
160 3300005458 Ga0070681_11966076 Ga0070681_119660762 62
161 3300005459 Ga0068867_100000001 Ga0068867_100000001312 62
162 3300005459 Ga0068867_100001209 Ga0068867_10000120910 62
163 3300005459 Ga0068867_100012453 Ga0068867_1000124537 62
164 3300005530 Ga0070679_100102138 Ga0070679_1001021382 62
165 3300005535 Ga0070684_100198327 Ga0070684_1001983275 62
166 3300005535 Ga0070684_101547806 Ga0070684_1015478062 62
167 3300005539 Ga0068853_100004143 Ga0068853_1000041437 62
168 3300005539 Ga0068853_100078085 Ga0068853_1000780854 62
169 3300005539 Ga0068853_100126163 Ga0068853_1001261633 62
170 3300005539 Ga0068853_100145612 Ga0068853_1001456122 62
171 3300005539 Ga0068853_102466044 Ga0068853_1024660441 62
172 3300005543 Ga0070672_100003604 Ga0070672_1000036044 62
173 3300005543 Ga0070672_100259143 Ga0070672_1002591432 62
174 3300005543 Ga0070672_100427725 Ga0070672_1004277251 62
175 3300005543 Ga0070672_101665019 Ga0070672_1016650192 62
176 3300005546 Ga0070696_100267423 Ga0070696_1002674234 62
177 3300005546 Ga0070696_101529780 Ga0070696_1015297802 62
178 3300005547 Ga0070693_101173023 Ga0070693_1011730232 62
179 3300005548 Ga0070665_100002264 Ga0070665_10000226415 62
180 3300005548 Ga0070665_100022041 Ga0070665_1000220417 62
181 3300005548 Ga0070665_100127195 Ga0070665_1001271956 62
182 3300005548 Ga0070665_100264050 Ga0070665_1002640502 62
183 3300005548 Ga0070665_100513964 Ga0070665_1005139641 62
184 3300005548 Ga0070665_100995054 Ga0070665_1009950542 62
185 3300005548 Ga0070665_101534936 Ga0070665_1015349362 62
186 3300005548 Ga0070665_101748498 Ga0070665_1017484982 62
187 3300005563 Ga0068855_100000780 Ga0068855_10000078021 62
188 3300005563 Ga0068855_100311462 Ga0068855_1003114622 62
189 3300005564 Ga0070664_100112271 Ga0070664_1001122711 62
190 3300005564 Ga0070664_100181918 Ga0070664_1001819184 62
191 3300005564 Ga0070664_100314517 Ga0070664_1003145172 62
192 3300005564 Ga0070664_100544828 Ga0070664_1005448282 62
193 3300005564 Ga0070664_100701453 Ga0070664_1007014532 62
194 3300005564 Ga0070664_101753151 Ga0070664_1017531511 62
195 3300005564 Ga0070664_102124326 Ga0070664_1021243261 62
196 3300005577 Ga0068857_100001963 Ga0068857_10000196314 62
197 3300005577 Ga0068857_100019067 Ga0068857_1000190678 62
198 3300005577 Ga0068857_100260817 Ga0068857_1002608172 62
199 3300005578 Ga0068854_100004099 Ga0068854_1000040995 62
200 3300005578 Ga0068854_100039628 Ga0068854_1000396284 62
201 3300005578 Ga0068854_100057595 Ga0068854_1000575952 62
202 3300005578 Ga0068854_100071113 Ga0068854_1000711135 62
203 3300005578 Ga0068854_100870800 Ga0068854_1008708002 62
204 3300005578 Ga0068854_101486806 Ga0068854_1014868061 62
205 3300005614 Ga0068856_100014359 Ga0068856_1000143595 62
206 3300005614 Ga0068856_100065440 Ga0068856_1000654402 62
207 3300005614 Ga0068856_100097984 Ga0068856_1000979844 62
208 3300005614 Ga0068856_100492521 Ga0068856_1004925212 62
209 3300005616 Ga0068852_100000562 Ga0068852_10000056222 62
210 3300005616 Ga0068852_100116770 Ga0068852_1001167702 62
211 3300005616 Ga0068852_100707891 Ga0068852_1007078912 62
212 3300005616 Ga0068852_101230914 Ga0068852_1012309142 62
213 3300005616 Ga0068852_101301540 Ga0068852_1013015402 62
214 3300005616 Ga0068852_101425013 Ga0068852_1014250132 62
215 3300005617 Ga0068859_100000783 Ga0068859_10000078335 62
216 3300005617 Ga0068859_100000934 Ga0068859_10000093411 62
217 3300005617 Ga0068859_100356512 Ga0068859_1003565122 62
218 3300005617 Ga0068859_100684571 Ga0068859_1006845712 62
219 3300005618 Ga0068864_100000181 Ga0068864_10000018118 62
220 3300005618 Ga0068864_100002274 Ga0068864_10000227418 62
221 3300005618 Ga0068864_100019551 Ga0068864_1000195519 62
222 3300005618 Ga0068864_100125712 Ga0068864_1001257123 62
223 3300005718 Ga0068866_10018207 Ga0068866_100182075 62
224 3300005718 Ga0068866_10323917 Ga0068866_103239172 62
225 3300005719 Ga0068861_100016704 Ga0068861_1000167045 62
226 3300005719 Ga0068861_100110779 Ga0068861_1001107792 62
227 3300005834 Ga0068851_10037597 Ga0068851_100375972 62
228 3300005834 Ga0068851_10078145 Ga0068851_100781452 62
229 3300005834 Ga0068851_10235183 Ga0068851_102351833 62
230 3300005834 Ga0068851_10453301 Ga0068851_104533012 62
231 3300005834 Ga0068851_10913634 Ga0068851_109136342 62
232 3300005840 Ga0068870_10421550 Ga0068870_104215502 62
233 3300005840 Ga0068870_11373404 Ga0068870_113734041 62
234 3300005841 Ga0068863_100001525 Ga0068863_10000152511 62
235 3300005841 Ga0068863_100013287 Ga0068863_1000132872 62
236 3300005841 Ga0068863_100121938 Ga0068863_1001219382 62
237 3300005842 Ga0068858_100002349 Ga0068858_10000234917 62
238 3300005842 Ga0068858_100009036 Ga0068858_10000903614 62
239 3300005842 Ga0068858_100225319 Ga0068858_1002253193 62
240 3300005842 Ga0068858_101029458 Ga0068858_1010294582 62
241 3300005843 Ga0068860_100005988 Ga0068860_10000598812 62
242 3300005843 Ga0068860_100063691 Ga0068860_1000636914 62
243 3300005843 Ga0068860_100160815 Ga0068860_1001608152 62
244 3300005844 Ga0068862_100015334 Ga0068862_1000153347 62
245 3300005844 Ga0068862_100690692 Ga0068862_1006906922 62
246 3300005844 Ga0068862_101288528 Ga0068862_1012885282 62
247 3300005844 Ga0068862_101859369 Ga0068862_1018593692 62
248 3300006177 Ga0075362_10591220 Ga0075362_105912202 62
249 3300006237 Ga0097621_100027264 Ga0097621_1000272642 62
250 3300006237 Ga0097621_102443103 Ga0097621_1024431032 62
251 3300006358 Ga0068871_100060974 Ga0068871_1000609742 62
252 3300006881 Ga0068865_100000003 Ga0068865_10000000351 62
253 3300006881 Ga0068865_100000775 Ga0068865_10000077514 62
254 3300006881 Ga0068865_100543879 Ga0068865_1005438792 62
255 3300006931 Ga0097620_100000783 Ga0097620_1000007834 62
256 3300006931 Ga0097620_100000934 Ga0097620_10000093423 62
257 3300006931 Ga0097620_100356513 Ga0097620_1003565132 62
258 3300006931 Ga0097620_100684518 Ga0097620_1006845182 62
259 3300009092 Ga0105250_10027166 Ga0105250_100271662 62
260 3300009092 Ga0105250_10512887 Ga0105250_105128872 62
261 3300009093 Ga0105240_10036359 Ga0105240_100363595 62
262 3300009098 Ga0105245_10000120 Ga0105245_1000012013 62
263 3300009098 Ga0105245_10106004 Ga0105245_101060042 62
264 3300009101 Ga0105247_10182973 Ga0105247_101829732 62
265 3300009101 Ga0105247_10216856 Ga0105247_102168562 62
266 3300009148 Ga0105243_10029665 Ga0105243_100296652 62
267 3300009148 Ga0105243_10075598 Ga0105243_100755981 62
268 3300009148 Ga0105243_11771821 Ga0105243_117718211 62
269 3300009174 Ga0105241_10099141 Ga0105241_100991413 62
270 3300009174 Ga0105241_10442899 Ga0105241_104428992 62
271 3300009174 Ga0105241_12194235 Ga0105241_121942351 62
272 3300009176 Ga0105242_10002812 Ga0105242_100028123 62
273 3300009176 Ga0105242_10601788 Ga0105242_106017882 62
274 3300009177 Ga0105248_10000256 Ga0105248_1000025628 62
275 3300009177 Ga0105248_10028022 Ga0105248_100280223 62
276 3300009177 Ga0105248_10327279 Ga0105248_103272793 62
277 3300009177 Ga0105248_11007265 Ga0105248_110072652 62
278 3300009177 Ga0105248_11472195 Ga0105248_114721952 62
279 3300009545 Ga0105237_10245525 Ga0105237_102455252 62
280 3300009551 Ga0105238_10128438 Ga0105238_101284382 62
281 3300009551 Ga0105238_10945371 Ga0105238_109453712 62
282 3300009551 Ga0105238_10992963 Ga0105238_109929632 62
283 3300009553 Ga0105249_10043627 Ga0105249_100436277 62
284 3300009553 Ga0105249_10358075 Ga0105249_103580752 62
285 3300009553 Ga0105249_10395917 Ga0105249_103959172 62
286 3300010375 Ga0105239_10090598 Ga0105239_100905983 62
287 3300010375 Ga0105239_12196724 Ga0105239_121967241 62
288 3300011119 Ga0105246_10001420 Ga0105246_100014208 62
289 3300011119 Ga0105246_10033753 Ga0105246_100337534 62
290 3300011119 Ga0105246_10070186 Ga0105246_100701863 62
291 3300013100 Ga0157373_10002630 Ga0157373_100026306 62
292 3300013100 Ga0157373_10059883 Ga0157373_100598836 62
293 3300013100 Ga0157373_10266538 Ga0157373_102665382 62
294 3300013100 Ga0157373_11278801 Ga0157373_112788011 62
295 3300013102 Ga0157371_10023247 Ga0157371_100232473 62
296 3300013102 Ga0157371_10113518 Ga0157371_101135183 62
297 3300013102 Ga0157371_10194020 Ga0157371_101940204 62
298 3300013102 Ga0157371_10380753 Ga0157371_103807532 62
299 3300013104 Ga0157370_10000069 Ga0157370_1000006926 62
300 3300013104 Ga0157370_10349270 Ga0157370_103492702 62
301 3300013105 Ga0157369_10046681 Ga0157369_100466815 62
302 3300013105 Ga0157369_10332080 Ga0157369_103320803 62
303 3300013105 Ga0157369_12689950 Ga0157369_126899502 62
304 3300013296 Ga0157374_10214942 Ga0157374_102149422 62
305 3300013296 Ga0157374_12156187 Ga0157374_121561871 62
306 3300013297 Ga0157378_10274682 Ga0157378_102746822 62
307 3300013297 Ga0157378_13159307 Ga0157378_131593072 62
308 3300013306 Ga0163162_10016313 Ga0163162_100163137 62
309 3300013306 Ga0163162_10101365 Ga0163162_101013653 62
310 3300013306 Ga0163162_10198189 Ga0163162_101981893 62
311 3300013307 Ga0157372_10016779 Ga0157372_100167793 62
312 3300013307 Ga0157372_10069560 Ga0157372_100695603 62
313 3300013307 Ga0157372_10103381 Ga0157372_101033812 62
314 3300013307 Ga0157372_10135847 Ga0157372_101358472 62
315 3300013307 Ga0157372_10279329 Ga0157372_102793292 62
316 3300013307 Ga0157372_10409917 Ga0157372_104099172 62
317 3300013307 Ga0157372_10671516 Ga0157372_106715163 62
318 3300013307 Ga0157372_10785700 Ga0157372_107857003 62
319 3300013307 Ga0157372_11032750 Ga0157372_110327502 62
320 3300013307 Ga0157372_11818059 Ga0157372_118180592 62
321 3300013308 Ga0157375_10003338 Ga0157375_100033384 62
322 3300013308 Ga0157375_11282399 Ga0157375_112823992 62
323 3300013308 Ga0157375_13006601 Ga0157375_130066012 62
324 3300013308 Ga0157375_13159729 Ga0157375_131597292 62
325 3300014325 Ga0163163_10000192 Ga0163163_100001924 62
326 3300014325 Ga0163163_10084563 Ga0163163_100845632 62
327 3300014326 Ga0157380_13439736 Ga0157380_134397361 62
328 3300014745 Ga0157377_10018041 Ga0157377_100180414 62
329 3300014745 Ga0157377_10146491 Ga0157377_101464911 62
330 3300014968 Ga0157379_10004595 Ga0157379_1000459510 62
331 3300014968 Ga0157379_11222280 Ga0157379_112222802 62
332 3300014969 Ga0157376_10001542 Ga0157376_100015425 62
333 3300014969 Ga0157376_12627142 Ga0157376_126271422 62
334 3300025254 Ga0209148_1000870 Ga0209148_100087014 62
335 3300025272 Ga0209455_1000386 Ga0209455_100038618 62
336 3300025315 Ga0207697_10000260 Ga0207697_100002609 62
337 3300025315 Ga0207697_10468182 Ga0207697_104681822 62
338 3300025321 Ga0207656_10505788 Ga0207656_105057881 62
339 3300025711 Ga0207696_1048108 Ga0207696_10481081 62
340 3300025893 Ga0207682_10303354 Ga0207682_103033542 62
341 3300025899 Ga0207642_10096507 Ga0207642_100965072 62
342 3300025900 Ga0207710_10499630 Ga0207710_104996302 62
343 3300025901 Ga0207688_10000225 Ga0207688_1000022514 62
344 3300025901 Ga0207688_10051768 Ga0207688_100517683 62
345 3300025901 Ga0207688_10893955 Ga0207688_108939551 62
346 3300025903 Ga0207680_10026049 Ga0207680_100260492 62
347 3300025903 Ga0207680_10063603 Ga0207680_100636032 62
348 3300025903 Ga0207680_10108768 Ga0207680_101087681 62
349 3300025904 Ga0207647_10000052 Ga0207647_1000005238 62
350 3300025904 Ga0207647_10000261 Ga0207647_100002614 62
351 3300025904 Ga0207647_10012956 Ga0207647_100129563 62
352 3300025904 Ga0207647_10023553 Ga0207647_100235534 62
353 3300025904 Ga0207647_10091150 Ga0207647_100911502 62
354 3300025904 Ga0207647_10171196 Ga0207647_101711963 62
355 3300025907 Ga0207645_10011101 Ga0207645_100111012 62
356 3300025907 Ga0207645_10100868 Ga0207645_101008682 62
357 3300025907 Ga0207645_10143824 Ga0207645_101438243 62
358 3300025908 Ga0207643_10919816 Ga0207643_109198162 62
359 3300025909 Ga0207705_10000022 Ga0207705_1000002265 62
360 3300025909 Ga0207705_10000591 Ga0207705_100005914 62
361 3300025909 Ga0207705_10038135 Ga0207705_100381353 62
362 3300025909 Ga0207705_10360482 Ga0207705_103604821 62
363 3300025909 Ga0207705_10469357 Ga0207705_104693573 62
364 3300025909 Ga0207705_10494925 Ga0207705_104949252 62
365 3300025909 Ga0207705_10660955 Ga0207705_106609552 62
366 3300025909 Ga0207705_11217465 Ga0207705_112174651 62
367 3300025909 Ga0207705_11262416 Ga0207705_112624162 62
368 3300025911 Ga0207654_10052413 Ga0207654_100524133 62
369 3300025912 Ga0207707_11098924 Ga0207707_110989241 62
370 3300025913 Ga0207695_10051333 Ga0207695_100513335 62
371 3300025914 Ga0207671_10136657 Ga0207671_101366574 62
372 3300025918 Ga0207662_10892089 Ga0207662_108920892 62
373 3300025919 Ga0207657_10001207 Ga0207657_100012073 62
374 3300025919 Ga0207657_10002788 Ga0207657_1000278815 62
375 3300025919 Ga0207657_10004059 Ga0207657_100040594 62
376 3300025919 Ga0207657_10007120 Ga0207657_1000712011 62
377 3300025919 Ga0207657_10027835 Ga0207657_100278352 62
378 3300025919 Ga0207657_10036418 Ga0207657_100364184 62
379 3300025919 Ga0207657_10595582 Ga0207657_105955824 62
380 3300025919 Ga0207657_10806690 Ga0207657_108066902 62
381 3300025919 Ga0207657_10956909 Ga0207657_109569091 62
382 3300025920 Ga0207649_10009658 Ga0207649_100096582 62
383 3300025920 Ga0207649_10025729 Ga0207649_100257296 62
384 3300025920 Ga0207649_10142207 Ga0207649_101422072 62
385 3300025920 Ga0207649_10688947 Ga0207649_106889472 62
386 3300025920 Ga0207649_10748748 Ga0207649_107487482 62
387 3300025920 Ga0207649_10808887 Ga0207649_108088871 62
388 3300025920 Ga0207649_10836566 Ga0207649_108365662 62
389 3300025921 Ga0207652_10733461 Ga0207652_107334612 62
390 3300025923 Ga0207681_10002587 Ga0207681_100025878 62
391 3300025923 Ga0207681_10081882 Ga0207681_100818823 62
392 3300025923 Ga0207681_10303548 Ga0207681_103035482 62
393 3300025924 Ga0207694_10147759 Ga0207694_101477593 62
394 3300025924 Ga0207694_11539105 Ga0207694_115391052 62
395 3300025924 Ga0207694_11787363 Ga0207694_117873632 62
396 3300025925 Ga0207650_10006658 Ga0207650_100066588 62
397 3300025925 Ga0207650_10329826 Ga0207650_103298261 62
398 3300025925 Ga0207650_11276749 Ga0207650_112767492 62
399 3300025926 Ga0207659_10041870 Ga0207659_100418704 62
400 3300025926 Ga0207659_10122426 Ga0207659_101224262 62
401 3300025927 Ga0207687_10006406 Ga0207687_100064065 62
402 3300025931 Ga0207644_10010959 Ga0207644_100109592 62
403 3300025931 Ga0207644_10014050 Ga0207644_100140504 62
404 3300025931 Ga0207644_10194660 Ga0207644_101946603 62
405 3300025931 Ga0207644_10335807 Ga0207644_103358072 62
406 3300025931 Ga0207644_10924349 Ga0207644_109243492 62
407 3300025931 Ga0207644_11473298 Ga0207644_114732981 62
408 3300025931 Ga0207644_11783386 Ga0207644_117833861 62
409 3300025932 Ga0207690_10000463 Ga0207690_1000046324 62
410 3300025932 Ga0207690_10018806 Ga0207690_100188062 62
411 3300025932 Ga0207690_10396487 Ga0207690_103964872 62
412 3300025932 Ga0207690_10714145 Ga0207690_107141451 62
413 3300025932 Ga0207690_11023658 Ga0207690_110236581 62
414 3300025933 Ga0207706_10001178 Ga0207706_100011787 62
415 3300025933 Ga0207706_10009206 Ga0207706_100092068 62
416 3300025933 Ga0207706_10009419 Ga0207706_100094193 62
417 3300025933 Ga0207706_10044141 Ga0207706_100441413 62
418 3300025933 Ga0207706_10056717 Ga0207706_100567173 62
419 3300025933 Ga0207706_10127883 Ga0207706_101278834 62
420 3300025934 Ga0207686_10003952 Ga0207686_100039529 62
421 3300025934 Ga0207686_10364344 Ga0207686_103643443 62
422 3300025935 Ga0207709_10012181 Ga0207709_100121815 62
423 3300025935 Ga0207709_10227256 Ga0207709_102272562 62
424 3300025936 Ga0207670_10101714 Ga0207670_101017143 62
425 3300025938 Ga0207704_10000001 Ga0207704_10000001468 62
426 3300025938 Ga0207704_10015412 Ga0207704_100154121 62
427 3300025940 Ga0207691_10035008 Ga0207691_100350084 62
428 3300025940 Ga0207691_10327663 Ga0207691_103276632 62
429 3300025940 Ga0207691_11282061 Ga0207691_112820611 62
430 3300025941 Ga0207711_10004639 Ga0207711_100046397 62
431 3300025941 Ga0207711_10100492 Ga0207711_101004924 62
432 3300025941 Ga0207711_11011740 Ga0207711_110117402 62
433 3300025941 Ga0207711_11261931 Ga0207711_112619312 62
434 3300025942 Ga0207689_10000014 Ga0207689_1000001480 62
435 3300025942 Ga0207689_10009319 Ga0207689_100093193 62
436 3300025942 Ga0207689_10038367 Ga0207689_100383672 62
437 3300025944 Ga0207661_10583436 Ga0207661_105834362 62
438 3300025945 Ga0207679_10023452 Ga0207679_100234524 62
439 3300025945 Ga0207679_10148183 Ga0207679_101481832 62
440 3300025945 Ga0207679_10270068 Ga0207679_102700683 62
441 3300025945 Ga0207679_10394474 Ga0207679_103944742 62
442 3300025945 Ga0207679_10910409 Ga0207679_109104092 62
443 3300025945 Ga0207679_11264249 Ga0207679_112642492 62
444 3300025949 Ga0207667_10029534 Ga0207667_100295345 62
445 3300025949 Ga0207667_10195785 Ga0207667_101957851 62
446 3300025960 Ga0207651_10000002 Ga0207651_10000002137 62
447 3300025960 Ga0207651_10000310 Ga0207651_1000031015 62
448 3300025960 Ga0207651_10006153 Ga0207651_100061532 62
449 3300025960 Ga0207651_10093201 Ga0207651_100932013 62
450 3300025960 Ga0207651_10851434 Ga0207651_108514342 62
451 3300025960 Ga0207651_11393103 Ga0207651_113931032 62
452 3300025961 Ga0207712_10232546 Ga0207712_102325462 62
453 3300025961 Ga0207712_10268883 Ga0207712_102688831 62
454 3300025972 Ga0207668_10488183 Ga0207668_104881832 62
455 3300025981 Ga0207640_10001199 Ga0207640_1000119910 62
456 3300025981 Ga0207640_10033526 Ga0207640_100335265 62
457 3300025981 Ga0207640_10183867 Ga0207640_101838672 62
458 3300025981 Ga0207640_10511030 Ga0207640_105110302 62
459 3300025981 Ga0207640_10758514 Ga0207640_107585142 62
460 3300025981 Ga0207640_11251272 Ga0207640_112512722 62
461 3300025986 Ga0207658_10005035 Ga0207658_100050357 62
462 3300025986 Ga0207658_10005707 Ga0207658_100057075 62
463 3300025986 Ga0207658_10034873 Ga0207658_100348736 62
464 3300025986 Ga0207658_10069179 Ga0207658_100691792 62
465 3300025986 Ga0207658_10107948 Ga0207658_101079484 62
466 3300025986 Ga0207658_10219822 Ga0207658_102198222 62
467 3300025986 Ga0207658_10244640 Ga0207658_102446403 62
468 3300026023 Ga0207677_10000776 Ga0207677_1000077612 62
469 3300026023 Ga0207677_10002094 Ga0207677_100020942 62
470 3300026023 Ga0207677_10690026 Ga0207677_106900263 62
471 3300026023 Ga0207677_11373280 Ga0207677_113732802 62
472 3300026035 Ga0207703_10001172 Ga0207703_1000117214 62
473 3300026035 Ga0207703_10027804 Ga0207703_100278045 62
474 3300026035 Ga0207703_11759504 Ga0207703_117595042 62
475 3300026041 Ga0207639_10004768 Ga0207639_100047688 62
476 3300026041 Ga0207639_10027474 Ga0207639_100274742 62
477 3300026041 Ga0207639_10136429 Ga0207639_101364292 62
478 3300026041 Ga0207639_10200488 Ga0207639_102004883 62
479 3300026041 Ga0207639_10228672 Ga0207639_102286722 62
480 3300026041 Ga0207639_10540011 Ga0207639_105400112 62
481 3300026041 Ga0207639_10715370 Ga0207639_107153702 62
482 3300026041 Ga0207639_11849706 Ga0207639_118497062 62
483 3300026067 Ga0207678_10000354 Ga0207678_100003548 62
484 3300026067 Ga0207678_10008727 Ga0207678_100087272 62
485 3300026067 Ga0207678_10068990 Ga0207678_100689903 62
486 3300026067 Ga0207678_10310959 Ga0207678_103109593 62
487 3300026067 Ga0207678_10943910 Ga0207678_109439102 62
488 3300026067 Ga0207678_10963768 Ga0207678_109637682 62
489 3300026078 Ga0207702_10151789 Ga0207702_101517892 62
490 3300026078 Ga0207702_10279512 Ga0207702_102795122 62
491 3300026078 Ga0207702_10460330 Ga0207702_104603302 62
492 3300026088 Ga0207641_10033991 Ga0207641_100339914 62
493 3300026088 Ga0207641_10105797 Ga0207641_101057974 62
494 3300026088 Ga0207641_10156621 Ga0207641_101566212 62
495 3300026088 Ga0207641_10502534 Ga0207641_105025341 62
496 3300026088 Ga0207641_10548265 Ga0207641_105482652 62
497 3300026088 Ga0207641_10554415 Ga0207641_105544152 62
498 3300026089 Ga0207648_10000001 Ga0207648_10000001137 62
499 3300026089 Ga0207648_10001420 Ga0207648_100014207 62
500 3300026089 Ga0207648_10010858 Ga0207648_100108582 62
501 3300026089 Ga0207648_11619473 Ga0207648_116194732 62
502 3300026095 Ga0207676_10000666 Ga0207676_1000066624 62
503 3300026095 Ga0207676_10065760 Ga0207676_100657604 62
504 3300026095 Ga0207676_10482224 Ga0207676_104822242 62
505 3300026116 Ga0207674_10000139 Ga0207674_1000013950 62
506 3300026116 Ga0207674_10000244 Ga0207674_1000024428 62
507 3300026116 Ga0207674_10004090 Ga0207674_1000409011 62
508 3300026116 Ga0207674_12214480 Ga0207674_122144801 62
509 3300026118 Ga0207675_100068862 Ga0207675_1000688624 62
510 3300026118 Ga0207675_100290115 Ga0207675_1002901152 62
511 3300026118 Ga0207675_100557677 Ga0207675_1005576772 62
512 3300026121 Ga0207683_10013761 Ga0207683_100137612 62
513 3300026121 Ga0207683_10328477 Ga0207683_103284772 62
514 3300026142 Ga0207698_10008014 Ga0207698_100080148 62
515 3300026142 Ga0207698_10175895 Ga0207698_101758953 62
516 3300026142 Ga0207698_11557728 Ga0207698_115577281 62
517 3300026142 Ga0207698_12143158 Ga0207698_121431582 62
518 3300028379 Ga0268266_10001998 Ga0268266_100019987 62
519 3300028379 Ga0268266_10093825 Ga0268266_100938253 62
520 3300028379 Ga0268266_10410457 Ga0268266_104104574 62
521 3300028379 Ga0268266_10510427 Ga0268266_105104271 62
522 3300028380 Ga0268265_10031590 Ga0268265_100315901 62
523 3300028380 Ga0268265_10102357 Ga0268265_101023573 62
524 3300028380 Ga0268265_10224201 Ga0268265_102242013 62
525 3300028380 Ga0268265_10442413 Ga0268265_104424132 62
526 3300028380 Ga0268265_10515553 Ga0268265_105155532 62
527 3300028381 Ga0268264_10003356 Ga0268264_100033567 62
528 3300028381 Ga0268264_10004801 Ga0268264_100048015 62
529 3300028381 Ga0268264_10527383 Ga0268264_105273832 62
530 3300028381 Ga0268264_10907169 Ga0268264_109071692 62
531 3300028381 Ga0268264_11512634 Ga0268264_115126342 62
532 3300031548 Ga0307408_100135068 Ga0307408_1001350684 62
533 3300031731 Ga0307405_10001525 Ga0307405_100015257 62
534 3300031824 Ga0307413_10013408 Ga0307413_100134084 62
535 3300031852 Ga0307410_10007748 Ga0307410_100077484 62
536 3300031911 Ga0307412_10037822 Ga0307412_100378224 62
537 3300031995 Ga0307409_100001492 Ga0307409_1000014926 62
538 3300032002 Ga0307416_100000484 Ga0307416_10000048410 62
539 3300032004 Ga0307414_10007126 Ga0307414_100071264 62
540 3300032005 Ga0307411_10004047 Ga0307411_100040474 62
541 3300032126 Ga0307415_100001486 Ga0307415_1000014867 62
542 3300037312 Ga0395899_0023425 Ga0395899_0023425_917_1105 62
543 3300037312 Ga0395899_0159599 Ga0395899_0159599_849_1037 62
544 3300037312 Ga0395899_0965980 Ga0395899_0965980_176_364 62
545 3300037418 Ga0395900_0278919 Ga0395900_0278919_135_323 62
546 3300037418 Ga0395900_0651483 Ga0395900_0651483_613_801 62
547 3300037466 Ga0395898_0457807 Ga0395898_0457807_583_771 62
548 3300037466 Ga0395898_1018130 Ga0395898_1018130_387_575 62
549 3300037471 Ga0395905_0124998 Ga0395905_0124998_1516_1704 62
550 3300037471 Ga0395905_0900659 Ga0395905_0900659_94_282 62
551 3300037471 Ga0395905_1660352 Ga0395905_1660352_201_389 62
552 3300038443 Ga0395901_0194626 Ga0395901_0194626_1921_2109 62
553 3300038443 Ga0395901_0196194 Ga0395901_0196194_654_842 62
554 3300038443 Ga0395901_0341119 Ga0395901_0341119_100_288 62
555 3300038443 Ga0395901_0423444 Ga0395901_0423444_295_483 62
556 3300038443 Ga0395901_1076457 Ga0395901_1076457_287_475 62
557 3300041413 Ga0439465_0263060 Ga0439465_0263060_34_222 62
558 3300041441 Ga0451787_762348 Ga0451787_762348_286_474 62
559 3300041443 Ga0451789_0823438 Ga0451789_0823438_1200_1388 62
560 3300041443 Ga0451789_1301034 Ga0451789_1301034_11_199 62
561 3300041452 Ga0451793_0299515 Ga0451793_0299515_568_756 62
562 3300041453 Ga0451797_1027370 Ga0451797_1027370_412_600 62
563 3300041456 Ga0451795_0528729 Ga0451795_0528729_936_1124 62
564 3300041458 Ga0451798_0040090 Ga0451798_0040090_459_647 62
565 3300041459 Ga0451800_0533049 Ga0451800_0533049_327_515 62
566 3300041460 Ga0451802_0306496 Ga0451802_0306496_2535_2723 62
567 3300041462 Ga0451806_825822 Ga0451806_825822_2319_2507 62
568 3300042004 Ga0439445_0069270 Ga0439445_0069270_66_254 62
569 3300042005 Ga0439448_0012147 Ga0439448_0012147_1781_1978 62
570 3300042012 Ga0439455_0158024 Ga0439455_0158024_375_572 62
571 3300042157 Ga0439458_0004217 Ga0439458_0004217_2441_2638 62
572 3300044765 Ga0466970_0790087 Ga0466970_0790087_143_331 62
573 3300045836 Ga0466958_0166480 Ga0466958_0166480_1091_1279 62
574 3300045976 Ga0466967_0218723 Ga0466967_0218723_37_225 62
575 3300045976 Ga0466967_0334679 Ga0466967_0334679_223_411 62
576 3300045976 Ga0466967_2494192 Ga0466967_2494192_56_247 62
577 3300046506 Ga0495583_0223227 Ga0495583_0223227_377_565 62
578 3300046507 Ga0495606_0345359 Ga0495606_0345359_401_589 62
579 3300046519 Ga0495632_0311089 Ga0495632_0311089_59_247 62
580 3300046525 Ga0495663_0155627 Ga0495663_0155627_372_560 62
581 3300046684 Ga0495669_0007330 Ga0495669_0007330_688_876 62
582 3300046684 Ga0495669_0088783 Ga0495669_0088783_32_226 62
583 3300046694 Ga0495649_0264159 Ga0495649_0264159_113_301 62
584 3300046794 Ga0495589_0569291 Ga0495589_0569291_317_505 62
585 3300047445 Ga0495677_0095472 Ga0495677_0095472_731_919 62
586 3300047472 Ga0495686_0003535 Ga0495686_0003535_2761_2949 62
587 3300048910 Ga0496107_0735006 Ga0496107_0735006_211_399 62
588 3300048919 Ga0496116_0283388 Ga0496116_0283388_275_463 62
589 3300048920 Ga0496117_0009632 Ga0496117_0009632_265_453 62
590 3300048920 Ga0496117_0028171 Ga0496117_0028171_4130_4318 62
591 3300048920 Ga0496117_0059419 Ga0496117_0059419_2113_2301 62
592 3300048921 Ga0496118_0064135 Ga0496118_0064135_1389_1577 62
593 3300048921 Ga0496118_0113465 Ga0496118_0113465_1280_1468 62
594 3300048922 Ga0496119_0020335 Ga0496119_0020335_3991_4179 62
595 3300048923 Ga0496120_0027266 Ga0496120_0027266_525_713 62
596 3300048924 Ga0496121_0076177 Ga0496121_0076177_883_1071 62
597 3300048924 Ga0496121_0129618 Ga0496121_0129618_871_1059 62
598 3300048924 Ga0496121_0630996 Ga0496121_0630996_282_470 62
599 3300048925 Ga0496122_0017742 Ga0496122_0017742_2354_2542 62
600 3300048926 Ga0496123_0021916 Ga0496123_0021916_1732_1920 62
601 3300048927 Ga0496124_0096661 Ga0496124_0096661_2012_2200 62
602 3300048927 Ga0496124_0514772 Ga0496124_0514772_248_436 62
603 3300048927 Ga0496124_0809932 Ga0496124_0809932_93_281 62
604 3300048928 Ga0496125_0006169 Ga0496125_0006169_6459_6647 62
605 3300049822 Ga0501035_1179084 Ga0501035_1179084_165_353 62
606 3300053151 Ga0500604_0012109 Ga0500604_0012109_124_312 62
607 3300053153 Ga0500616_0004722 Ga0500616_0004722_4577_4774 62
608 3300053727 Ga0500611_001223 Ga0500611_001223_1172_1360 62

Structural Annotation

Top 5 Hits

ID Description Score Start End
3soh-assembly2.cif.gz_D architecture of the flagellar rotor 0.5734 4 42
1fjg-assembly1.cif.gz_T structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin 0.5155 6 61
4dzp-assembly1.cif.gz_B crystal structure of the terminase small subunit gp1 with r48a mutation of the bacterial virus sf6 0.5092 6 61
1fjg-assembly1.cif.gz_T structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin 0.4752 6 61
4dzp-assembly1.cif.gz_B crystal structure of the terminase small subunit gp1 with r48a mutation of the bacterial virus sf6 0.4719 6 61
ID Description Score Start End Superfamily
af_A0A0R0E8I8_44_146_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.6822 6 51 1.10.10.10
af_Q9P1P4_46_332_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.596 23 53 1.20.1070.10
3sohD00 Mainly Alpha;Orthogonal Bundle;Annexin V; domain 1;Flagellar motor switch protein FliG, alpha-alpha superhelical domain 0.5734 4 42 1.10.220.30
af_Q54DM4_857_956_1.10.10.2670 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;E3 ubiquitin-protein ligase 0.531 6 39 1.10.10.2670
af_F1RDB2_113_213_1.10.1240.60 Mainly Alpha;Orthogonal Bundle;Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1; 0.5302 4 60 1.10.1240.60
ID Description Score Start End GO Terms
AF-A0A6J4ML22-F1-model_v4 Uncharacterized protein 0.9817 1 62
AF-A0A7X5YAU5-F1-model_v4 Uncharacterized protein 0.9791 1 62
AF-A0A6J4ML22-F1-model_v4 Uncharacterized protein 0.9662 1 62
AF-A0A2D7ZIN6-F1-model_v4 Uncharacterized protein 0.8795 4 57
AF-A0A4Q3KLV0-F1-model_v4 deleted 0.8713 1 61

Feature Viewer

pLDDT pTM Quality
92.92 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map