F468693

General Info

Members Datasets Scaffolds Average Seq Length
607 339 539 323

Family's Representative Sequence

Representative Sequence 3300025924|Ga0207694_10017930|Ga0207694_100179303
Length 373
Sequence MKKLFALAAIAAAAAGVHAQDFPAGKTVTLVVPFAAGGPTDRVARDLAEAMQKTLGTTIVVDNTAGAGSSIGTAKVARAAPDGYTLLLNHIGMSTMPALYRKLPFNVENDFEYLGMVNEVPMTLIGKPGLPANNYKELTAWIAANKGKINLGNAGLGAASHLCGLLFQSALKVEMTPVPYKGTAPAIADLLGGQIDLLCDQTTNTTSQIEAKKVKAYAVTTSKRLTTPALKDLPTLDESGLKGFEVTIWHGVYAPKGTPAPVLKKLNEAIKAAMKDPGFVKREEALGRGDHDRQAHRAGRAQEVRLGRDRQVGPDHQGGWRVRRLAVARPQAARQSRFRGVPGFEFAEAAVLLRTAAFFVAATSAGWRQPSPG

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2547132374 Acidovorax radicis N35 Isolate Unclassified
3 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
4 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
5 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
6 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
7 2643221570 Acidovorax sp. Root568 Isolate Unclassified
8 2643221596 Acidovorax sp. Root70 Isolate Unclassified
9 2643221609 Acidovorax sp. Root217 Isolate Unclassified
10 2643221611 Acidovorax sp. Root219 Isolate Unclassified
11 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
12 2643221652 Acidovorax sp. Root402 Isolate Unclassified
13 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
14 2643221658 Variovorax sp. Root411 Isolate Unclassified
15 2643221672 Variovorax sp. Root434 Isolate Unclassified
16 2643221683 Variovorax sp. Root473 Isolate Unclassified
17 2643221717 Acidovorax sp. Root267 Isolate Unclassified
18 2738541277 Variovorax sp. GV051 Isolate Unclassified
19 2738541307 Variovorax sp. GV008 Isolate Unclassified
20 2738543012 Acidovorax sp. CF301 Isolate Unclassified
21 2738543019 Variovorax sp. GV040 Isolate Unclassified
22 2816332133 Acidovorax radicis 2721A Isolate Unclassified
23 2818991446 Variovorax sp. 1180 Isolate Unclassified
24 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
25 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
26 2842677519 Variovorax sp. R-72495 Isolate Unclassified
27 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
28 2842747753 Variovorax sp. R-72060 Isolate Unclassified
29 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
30 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
31 2885198086 Variovorax sp. 679 Isolate Unclassified
32 2885211737 Variovorax sp. 553 Isolate Unclassified
33 2899924645 Variovorax sp. 369 Isolate Unclassified
34 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
35 2904456579 Variovorax sp. 2002 Isolate Unclassified
36 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
37 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
38 2928037797 Variovorax sp. 1126 Isolate Unclassified
39 2928044640 Variovorax sp. 1128 Isolate Unclassified
40 2928051484 Variovorax sp. 1133 Isolate Unclassified
41 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
42 2928070936 Variovorax gossypii 1167 Isolate Unclassified
43 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
44 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
45 2929520902 Variovorax beijingensis 502 Isolate Unclassified
46 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
47 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
48 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
49 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
50 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
51 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
52 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
53 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
54 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
55 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
56 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
57 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
58 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
59 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
60 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
61 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
62 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
63 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
64 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
65 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
66 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
67 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
68 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
69 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
70 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
71 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
72 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
73 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
74 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
75 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
76 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
77 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
78 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
79 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
80 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
81 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
82 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
83 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
84 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
85 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
86 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
87 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
88 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
89 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
90 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
91 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
92 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
93 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
94 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
95 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
96 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
97 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
98 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
99 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
100 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
101 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
102 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
103 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
104 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
105 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
106 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
107 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
108 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
109 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
110 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
112 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
113 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
114 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
115 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
116 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
117 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
118 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
119 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
120 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
121 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
122 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
123 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
124 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
125 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
126 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
127 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
128 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
129 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
130 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
131 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
132 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
133 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
134 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
135 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
136 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
137 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
138 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
139 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
143 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
145 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
148 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
151 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
153 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
156 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
199 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
200 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
201 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
202 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
206 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
207 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
208 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
209 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
210 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
211 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
212 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
213 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
214 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
215 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
216 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
217 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
218 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
219 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
220 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
221 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
222 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
223 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
224 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
225 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
226 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
227 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
228 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
229 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
230 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
231 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
232 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
233 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
234 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
235 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
236 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
237 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
238 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
239 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
240 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
241 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
242 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
243 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
244 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
245 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
246 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
247 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
248 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
249 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
250 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
251 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
252 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
253 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
254 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
255 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
256 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
257 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
258 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
259 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
260 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
261 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
262 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
263 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
264 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
265 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
266 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
267 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
268 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
269 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
270 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
271 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
272 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
273 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
274 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
275 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
276 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
277 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
278 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
279 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
280 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
281 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
282 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
283 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
284 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
285 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
286 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
287 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
288 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
289 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
290 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
291 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
292 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
293 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
294 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
295 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
296 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
297 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
298 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
299 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
300 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
301 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
302 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
303 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
304 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
307 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
308 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
309 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
310 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
311 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
312 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
313 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
314 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
315 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
316 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
317 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
318 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
319 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
320 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
321 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
322 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
323 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
324 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
325 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
326 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
327 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
328 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
329 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
330 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
331 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
332 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
333 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
334 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
335 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
336 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
337 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
338 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
339 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.47
Metatranscriptomes 0.49
Isolates 11.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.85
Nodule 0.99
Rhizoplane 2.8
Rhizosphere 57.66
Stem 0
Stem Tuber 0
Unclassified 11.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10038452 3300001979 Bacteria 1468
2 JGI24739J22299_10006667 3300001989 Bacteria 4345
3 JGI24739J22299_10035608 3300001989 Bacteria 1686
4 JGI25151J46595_10003087 3300003187 Bacteria 9388
5 Ga0006562J51391_1110138 3300003578 Bacteria 3620
6 Ga0055535_1001456 3300003761 Bacteria 11948
7 Ga0055542_1000003 3300003762 Bacteria 582721
8 Ga0055537_1001922 3300003773 Bacteria 7437
9 Ga0055536_1002577 3300003781 Bacteria 10092
10 Ga0055536_1010222 3300003781 Bacteria 3754
11 Ga0055534_1000008 3300003784 Bacteria 211098
12 Ga0055528_1000170 3300003790 Bacteria 54883
13 Ga0055530_10000292 3300003791 Bacteria 45623
14 Ga0055530_10007508 3300003791 Bacteria 4574
15 Ga0055540_1001010 3300003792 Bacteria 18032
16 Ga0055540_1002374 3300003792 Bacteria 10048
17 Ga0055540_1005976 3300003792 Bacteria 4941
18 Ga0055540_1007595 3300003792 Bacteria 4057
19 Ga0055531_10001140 3300003794 Bacteria 20572
20 Ga0055531_10001626 3300003794 Bacteria 16291
21 Ga0065714_10003497 3300005288 Bacteria 7102
22 Ga0065714_10009417 3300005288 Bacteria 2778
23 Ga0065704_10125337 3300005289 Bacteria 1704
24 Ga0070676_10001898 3300005328 Bacteria 10623
25 Ga0070676_10008826 3300005328 Bacteria 5442
26 Ga0070676_10013570 3300005328 Bacteria 4466
27 Ga0070676_10212421 3300005328 Bacteria 1274
28 Ga0070670_100055393 3300005331 Bacteria 3404
29 Ga0070677_10010567 3300005333 Bacteria 3161
30 Ga0070677_10018826 3300005333 Bacteria 2493
31 Ga0068869_100003901 3300005334 Bacteria 9200
32 Ga0068869_100012322 3300005334 Bacteria 5648
33 Ga0070666_10046631 3300005335 Bacteria 2907
34 Ga0068868_100107600 3300005338 Bacteria 2263
35 Ga0068868_100232470 3300005338 Bacteria 1547
36 Ga0068868_100344701 3300005338 Bacteria 1275
37 Ga0070689_100107303 3300005340 Bacteria 2217
38 Ga0070661_100206362 3300005344 Bacteria 1503
39 Ga0070675_100003113 3300005354 Bacteria 12541
40 Ga0070675_100130955 3300005354 Bacteria 2138
41 Ga0070671_100028482 3300005355 Bacteria 4599
42 Ga0070671_100054735 3300005355 Bacteria 3318
43 Ga0070674_100001813 3300005356 Bacteria 11593
44 Ga0070673_100004630 3300005364 Bacteria 8723
45 Ga0070673_100322224 3300005364 Bacteria 1365
46 Ga0070667_100006775 3300005367 Bacteria 9512
47 Ga0070667_100031717 3300005367 Bacteria 4404
48 Ga0070663_100005578 3300005455 Bacteria 7493
49 Ga0070663_100052115 3300005455 Bacteria 2918
50 Ga0070662_100017064 3300005457 Bacteria 4886
51 Ga0070662_100139241 3300005457 Bacteria 1879
52 Ga0070662_100184062 3300005457 Bacteria 1648
53 Ga0068867_100029643 3300005459 Bacteria 3943
54 Ga0068867_100059306 3300005459 Bacteria 2837
55 Ga0070672_100005324 3300005543 Bacteria 8521
56 Ga0070672_100006932 3300005543 Bacteria 7659
57 Ga0070672_100033711 3300005543 Bacteria 3880
58 Ga0070672_100073991 3300005543 Bacteria 2716
59 Ga0070665_100020973 3300005548 Bacteria 6568
60 Ga0070665_100174926 3300005548 Bacteria 2147
61 Ga0070665_100259542 3300005548 Bacteria 1739
62 Ga0068855_100452673 3300005563 Bacteria 1400
63 Ga0070664_100029390 3300005564 Bacteria 4582
64 Ga0070664_100238184 3300005564 Bacteria 1633
65 Ga0068857_100005597 3300005577 Bacteria 10734
66 Ga0068857_100025871 3300005577 Bacteria 5168
67 Ga0068857_100052976 3300005577 Bacteria 3600
68 Ga0068854_100133847 3300005578 Bacteria 1896
69 Ga0068852_100085795 3300005616 Bacteria 2805
70 Ga0068852_100094212 3300005616 Bacteria 2686
71 Ga0068859_100090339 3300005617 Bacteria 3114
72 Ga0068864_100002220 3300005618 Bacteria 16047
73 Ga0068864_100102048 3300005618 Bacteria 2545
74 Ga0068851_10000564 3300005834 Bacteria 16153
75 Ga0068863_100027767 3300005841 Bacteria 5401
76 Ga0068860_100005401 3300005843 Bacteria 12967
77 Ga0068860_100170592 3300005843 Bacteria 2101
78 Ga0068860_100273919 3300005843 Bacteria 1648
79 Ga0068862_100030075 3300005844 Bacteria 4576
80 Ga0068862_100058889 3300005844 Bacteria 3296
81 Ga0068862_100326814 3300005844 Bacteria 1417
82 Ga0075365_10008719 3300006038 Bacteria 5779
83 Ga0075368_10001317 3300006042 Bacteria 7857
84 Ga0075368_10011263 3300006042 Bacteria 3251
85 Ga0075363_100003026 3300006048 Bacteria 7036
86 Ga0075363_100012413 3300006048 Bacteria 4106
87 Ga0075363_100012835 3300006048 Bacteria 4045
88 Ga0075364_10000165 3300006051 Bacteria 29462
89 Ga0075364_10007952 3300006051 Bacteria 6317
90 Ga0075364_10011256 3300006051 Bacteria 5431
91 Ga0075364_10017227 3300006051 Bacteria 4510
92 Ga0075432_10003022 3300006058 Bacteria 5673
93 Ga0075432_10006440 3300006058 Bacteria 3995
94 Ga0075362_10005439 3300006177 Bacteria 4660
95 Ga0075362_10043641 3300006177 Bacteria 1985
96 Ga0075367_10005218 3300006178 Bacteria 6420
97 Ga0075369_10003289 3300006186 Bacteria 5870
98 Ga0075366_10000512 3300006195 Bacteria 17914
99 Ga0075366_10001615 3300006195 Bacteria 11295
100 Ga0075366_10007653 3300006195 Bacteria 5977
101 Ga0075366_10020374 3300006195 Bacteria 3848
102 Ga0075366_10045159 3300006195 Bacteria 2611
103 Ga0075366_10182856 3300006195 Bacteria 1273
104 Ga0075370_10000867 3300006353 Bacteria 12306
105 Ga0075370_10002120 3300006353 Bacteria 9052
106 Ga0075370_10003491 3300006353 Bacteria 7490
107 Ga0075370_10014520 3300006353 Bacteria 4203
108 Ga0075370_10033208 3300006353 Bacteria 2888
109 Ga0075370_10033330 3300006353 Bacteria 2883
110 Ga0075370_10145934 3300006353 Bacteria 1385
111 Ga0075370_10155857 3300006353 Bacteria 1339
112 Ga0068871_100059356 3300006358 Bacteria 3117
113 Ga0075430_100039277 3300006846 Bacteria 4008
114 Ga0068865_100004212 3300006881 Bacteria 8668
115 Ga0068865_100045188 3300006881 Bacteria 3018
116 Ga0097620_100090341 3300006931 Bacteria 3114
117 Ga0079104_1025453 3300006946 Bacteria 1544
118 Ga0099826_10000134 3300006948 Bacteria 31806
119 Ga0099826_10000249 3300006948 Bacteria 23710
120 Ga0105244_10001068 3300009036 Bacteria 22905
121 Ga0105240_10094193 3300009093 Bacteria 3654
122 Ga0105245_10024599 3300009098 Bacteria 5289
123 Ga0105245_10249530 3300009098 Bacteria 1724
124 Ga0105243_10002328 3300009148 Bacteria 15901
125 Ga0105243_10006470 3300009148 Bacteria 9059
126 Ga0105243_10006784 3300009148 Bacteria 8829
127 Ga0105243_10051046 3300009148 Bacteria 3269
128 Ga0105242_10198852 3300009176 Bacteria 1779
129 Ga0105248_10037029 3300009177 Bacteria 5456
130 Ga0105248_10063949 3300009177 Bacteria 4130
131 Ga0105237_10000646 3300009545 Bacteria 48623
132 Ga0105237_10023146 3300009545 Bacteria 6369
133 Ga0105238_10080945 3300009551 Bacteria 3237
134 Ga0105249_10021293 3300009553 Bacteria 5805
135 Ga0105249_10024618 3300009553 Bacteria 5411
136 Ga0105239_10002203 3300010375 Bacteria 25060
137 Ga0105239_10226401 3300010375 Bacteria 2098
138 Ga0105246_10066431 3300011119 Bacteria 2525
139 Ga0157347_1001474 3300012502 Bacteria 1853
140 Ga0157370_10001540 3300013104 Bacteria 28519
141 Ga0157369_10101715 3300013105 Bacteria 3062
142 Ga0157369_10177377 3300013105 Bacteria 2243
143 Ga0157374_10042643 3300013296 Bacteria 4186
144 Ga0157378_10474269 3300013297 Bacteria 1246
145 Ga0157378_10507931 3300013297 Bacteria 1205
146 Ga0163162_10006139 3300013306 Bacteria 11629
147 Ga0163162_10169161 3300013306 Bacteria 2310
148 Ga0163162_10175551 3300013306 Bacteria 2268
149 Ga0163162_10282850 3300013306 Bacteria 1791
150 Ga0157372_10014394 3300013307 Bacteria 8460
151 Ga0157375_10010413 3300013308 Bacteria 8188
152 Ga0157375_10016070 3300013308 Bacteria 6714
153 Ga0157380_10294501 3300014326 Bacteria 1492
154 Ga0182008_10004254 3300014497 Bacteria 8391
155 Ga0182008_10009875 3300014497 Bacteria 5131
156 Ga0182008_10078989 3300014497 Bacteria 1619
157 Ga0157376_10000620 3300014969 Bacteria 22978
158 Ga0157376_10017903 3300014969 Bacteria 5417
159 Ga0157376_10054952 3300014969 Bacteria 3321
160 Ga0182006_1004191 3300015261 Bacteria 7151
161 Ga0182006_1006968 3300015261 Bacteria 5201
162 Ga0182006_1043588 3300015261 Bacteria 1753
163 Ga0182007_10001485 3300015262 Bacteria 12546
164 Ga0182007_10002591 3300015262 Bacteria 8899
165 Ga0183362_10007 3300015683 Bacteria 240101
166 Ga0163161_10000105 3300017792 Bacteria 80620
167 Ga0163161_10000657 3300017792 Bacteria 27646
168 Ga0163161_10004139 3300017792 Bacteria 10141
169 Ga0163161_10008072 3300017792 Bacteria 7278
170 Ga0163161_10029066 3300017792 Bacteria 3929
171 Ga0163161_10037658 3300017792 Bacteria 3468
172 Ga0209672_101644 3300025228 Bacteria 7333
173 Ga0209147_100439 3300025229 Bacteria 26588
174 Ga0209258_100015 3300025242 Bacteria 706310
175 Ga0207425_1000234 3300025245 Bacteria 42951
176 Ga0209148_1000028 3300025254 Bacteria 582773
177 Ga0209129_1000049 3300025258 Bacteria 268086
178 Ga0209129_1007065 3300025258 Bacteria 3437
179 Ga0209565_1000042 3300025263 Bacteria 239712
180 Ga0209565_1000108 3300025263 Bacteria 120719
181 Ga0209565_1000337 3300025263 Bacteria 41609
182 Ga0209673_1000071 3300025273 Bacteria 239966
183 Ga0209673_1000193 3300025273 Bacteria 123134
184 Ga0209673_1000477 3300025273 Bacteria 66849
185 Ga0209673_1000817 3300025273 Bacteria 41131
186 Ga0209673_1004323 3300025273 Bacteria 7666
187 Ga0209673_1006959 3300025273 Bacteria 5338
188 Ga0209673_1019620 3300025273 Bacteria 2421
189 Ga0209130_1000267 3300025284 Bacteria 65435
190 Ga0209130_1006443 3300025284 Bacteria 3814
191 Ga0209675_1000041 3300025291 Bacteria 239712
192 Ga0209675_1000163 3300025291 Bacteria 81884
193 Ga0209675_1000398 3300025291 Bacteria 36047
194 Ga0209675_1003589 3300025291 Bacteria 7295
195 Ga0209675_1014431 3300025291 Bacteria 2406
196 Ga0209676_1000137 3300025292 Bacteria 179437
197 Ga0209676_1000173 3300025292 Bacteria 153411
198 Ga0209676_1000903 3300025292 Bacteria 37397
199 Ga0209676_1001273 3300025292 Bacteria 26119
200 Ga0209676_1022273 3300025292 Bacteria 2104
201 Ga0209676_1029668 3300025292 Bacteria 1685
202 Ga0209025_1000409 3300025294 Bacteria 86577
203 Ga0209025_1000481 3300025294 Bacteria 77405
204 Ga0209025_1000707 3300025294 Bacteria 56879
205 Ga0209025_1005325 3300025294 Bacteria 10565
206 Ga0209025_1013704 3300025294 Bacteria 5067
207 Ga0209025_1044238 3300025294 Bacteria 1864
208 Ga0209025_1047275 3300025294 Bacteria 1759
209 Ga0209564_1000232 3300025295 Bacteria 122080
210 Ga0209564_1001382 3300025295 Bacteria 25319
211 Ga0209758_1000135 3300025297 Bacteria 177753
212 Ga0209758_1004899 3300025297 Bacteria 10766
213 Ga0209050_1000015 3300025298 Bacteria 759102
214 Ga0209050_1000936 3300025298 Bacteria 38151
215 Ga0209256_1000129 3300025299 Bacteria 163766
216 Ga0209256_1000604 3300025299 Bacteria 49837
217 Ga0209256_1020864 3300025299 Bacteria 2030
218 Ga0207426_1000171 3300025302 Bacteria 163766
219 Ga0207426_1000185 3300025302 Bacteria 154146
220 Ga0209051_1000010 3300025303 Bacteria 641298
221 Ga0209051_1000137 3300025303 Bacteria 137784
222 Ga0209051_1000172 3300025303 Bacteria 117180
223 Ga0209051_1000282 3300025303 Bacteria 82787
224 Ga0209051_1000556 3300025303 Bacteria 45471
225 Ga0209051_1000940 3300025303 Bacteria 28752
226 Ga0209051_1033120 3300025303 Bacteria 1959
227 Ga0209257_1000015 3300025304 Bacteria 908141
228 Ga0209257_1000026 3300025304 Bacteria 723225
229 Ga0209257_1000108 3300025304 Bacteria 240229
230 Ga0209257_1000205 3300025304 Bacteria 143735
231 Ga0207655_1000800 3300025728 Bacteria 34234
232 Ga0207682_10033531 3300025893 Bacteria 2068
233 Ga0207682_10058074 3300025893 Bacteria 1614
234 Ga0207682_10087063 3300025893 Bacteria 1348
235 Ga0207688_10166059 3300025901 Bacteria 1311
236 Ga0207645_10004343 3300025907 Bacteria 10500
237 Ga0207645_10036430 3300025907 Bacteria 3158
238 Ga0207645_10036921 3300025907 Bacteria 3138
239 Ga0207645_10133303 3300025907 Bacteria 1617
240 Ga0207643_10148821 3300025908 Bacteria 1402
241 Ga0207643_10155001 3300025908 Bacteria 1376
242 Ga0207705_10178452 3300025909 Bacteria 1602
243 Ga0207695_10028147 3300025913 Bacteria 6239
244 Ga0207695_10143317 3300025913 Bacteria 2336
245 Ga0207671_10056167 3300025914 Bacteria 2917
246 Ga0207671_10114799 3300025914 Bacteria 2053
247 Ga0207657_10082967 3300025919 Bacteria 2689
248 Ga0207681_10017900 3300025923 Bacteria 4455
249 Ga0207681_10298678 3300025923 Bacteria 1273
250 Ga0207694_10017930 3300025924 Bacteria 5351
251 Ga0207694_10022957 3300025924 Bacteria 4734
252 Ga0207650_10193322 3300025925 Bacteria 1627
253 Ga0207659_10021020 3300025926 Bacteria 4325
254 Ga0207659_10112316 3300025926 Bacteria 2073
255 Ga0207687_10041056 3300025927 Bacteria 3174
256 Ga0207644_10078424 3300025931 Bacteria 2434
257 Ga0207690_10049213 3300025932 Bacteria 2808
258 Ga0207706_10017095 3300025933 Bacteria 6540
259 Ga0207706_10268549 3300025933 Bacteria 1489
260 Ga0207709_10000285 3300025935 Bacteria 57630
261 Ga0207709_10000461 3300025935 Bacteria 37464
262 Ga0207709_10000947 3300025935 Bacteria 21689
263 Ga0207709_10002463 3300025935 Bacteria 11620
264 Ga0207709_10033346 3300025935 Bacteria 3023
265 Ga0207709_10039546 3300025935 Bacteria 2818
266 Ga0207670_10036817 3300025936 Bacteria 3185
267 Ga0207670_10121864 3300025936 Bacteria 1897
268 Ga0207704_10065099 3300025938 Bacteria 2281
269 Ga0207704_10066918 3300025938 Bacteria 2258
270 Ga0207691_10004921 3300025940 Bacteria 12890
271 Ga0207691_10009917 3300025940 Bacteria 9143
272 Ga0207691_10028236 3300025940 Bacteria 5255
273 Ga0207691_10029522 3300025940 Bacteria 5129
274 Ga0207711_10127826 3300025941 Bacteria 2275
275 Ga0207689_10003961 3300025942 Bacteria 13485
276 Ga0207689_10016702 3300025942 Bacteria 6211
277 Ga0207689_10055180 3300025942 Bacteria 3271
278 Ga0207689_10077267 3300025942 Bacteria 2737
279 Ga0207679_10340450 3300025945 Bacteria 1304
280 Ga0207667_10254641 3300025949 Bacteria 1796
281 Ga0207651_10345335 3300025960 Bacteria 1251
282 Ga0207712_10050226 3300025961 Bacteria 2911
283 Ga0207712_10072717 3300025961 Bacteria 2477
284 Ga0207668_10065118 3300025972 Bacteria 2578
285 Ga0207658_10153403 3300025986 Bacteria 1879
286 Ga0207658_10154700 3300025986 Bacteria 1872
287 Ga0207658_10276019 3300025986 Bacteria 1439
288 Ga0207677_10058419 3300026023 Bacteria 2655
289 Ga0207677_10067003 3300026023 Bacteria 2513
290 Ga0207677_10104078 3300026023 Bacteria 2097
291 Ga0207677_10105653 3300026023 Bacteria 2084
292 Ga0207703_10011615 3300026035 Bacteria 6846
293 Ga0207703_10088027 3300026035 Bacteria 2605
294 Ga0207703_10224897 3300026035 Bacteria 1680
295 Ga0207639_10048548 3300026041 Bacteria 3214
296 Ga0207639_10063026 3300026041 Bacteria 2869
297 Ga0207639_10189606 3300026041 Bacteria 1755
298 Ga0207678_10034625 3300026067 Bacteria 4398
299 Ga0207708_10013465 3300026075 Bacteria 6115
300 Ga0207648_10004164 3300026089 Bacteria 14964
301 Ga0207648_10010452 3300026089 Bacteria 8794
302 Ga0207648_10010854 3300026089 Bacteria 8610
303 Ga0207648_10197131 3300026089 Bacteria 1786
304 Ga0207676_10014655 3300026095 Bacteria 5645
305 Ga0207676_10493655 3300026095 Bacteria 1161
306 Ga0207674_10009080 3300026116 Bacteria 11416
307 Ga0207674_10062409 3300026116 Bacteria 3764
308 Ga0207674_10091279 3300026116 Bacteria 3036
309 Ga0207675_100014546 3300026118 Bacteria 7336
310 Ga0207683_10023567 3300026121 Bacteria 5295
311 Ga0207698_10024342 3300026142 Bacteria 4248
312 Ga0207698_10053831 3300026142 Bacteria 3092
313 Ga0209281_1018037 3300027111 Bacteria 1419
314 Ga0209282_1001604 3300027666 Bacteria 12525
315 Ga0209813_10000936 3300027866 Bacteria 6553
316 Ga0207428_10066176 3300027907 Bacteria 2848
317 Ga0268266_10026929 3300028379 Bacteria 4891
318 Ga0268266_10207934 3300028379 Bacteria 1794
319 Ga0268266_10299215 3300028379 Bacteria 1500
320 Ga0268266_10323096 3300028379 Bacteria 1445
321 Ga0268265_10026846 3300028380 Bacteria 4101
322 Ga0268265_10066913 3300028380 Bacteria 2779
323 Ga0268264_10010530 3300028381 Bacteria 7647
324 Ga0307517_10013720 3300028786 Bacteria 10974
325 Ga0307515_10136841 3300028794 Bacteria 2657
326 Ga0307512_10177253 3300030522 Bacteria 1206
327 Ga0316177_1018459 3300030731 Bacteria 2832
328 Ga0316177_1186399 3300030731 Bacteria 8418
329 Ga0316176_1116172 3300030732 Bacteria 2909
330 Ga0314311_1007245 3300030733 Bacteria 3259
331 Ga0316179_1087037 3300030734 Bacteria 3711
332 Ga0316179_1094680 3300030734 Bacteria 2243
333 Ga0316178_1028671 3300030735 Bacteria 6060
334 Ga0316178_1040279 3300030735 Bacteria 4656
335 Ga0316180_1145328 3300030736 Bacteria 3201
336 Ga0316183_1127478 3300030742 Bacteria 3185
337 Ga0316181_1178495 3300030744 Bacteria 3336
338 Ga0316182_1061027 3300030745 Bacteria 4265
339 Ga0316182_1203815 3300030745 Bacteria 1937
340 Ga0307513_10048430 3300031456 Bacteria 4613
341 Ga0307513_10074516 3300031456 Bacteria 3529
342 Ga0307509_10002279 3300031507 Bacteria 31377
343 Ga0307408_100000107 3300031548 Bacteria 91378
344 Ga0307408_100079691 3300031548 Bacteria 2444
345 Ga0307408_100332050 3300031548 Bacteria 1284
346 Ga0307508_10173327 3300031616 Bacteria 1760
347 Ga0307514_10003232 3300031649 Bacteria 15916
348 Ga0307514_10007285 3300031649 Bacteria 9538
349 Ga0307514_10207142 3300031649 Bacteria 1223
350 Ga0307516_10102694 3300031730 Bacteria 2673
351 Ga0307405_10016902 3300031731 Bacteria 3991
352 Ga0307405_10126774 3300031731 Bacteria 1756
353 Ga0307413_10061787 3300031824 Bacteria 2314
354 Ga0307413_10076246 3300031824 Bacteria 2130
355 Ga0307410_10255742 3300031852 Bacteria 1364
356 Ga0307406_10000661 3300031901 Bacteria 19533
357 Ga0307412_10002986 3300031911 Bacteria 9375
358 Ga0307412_10008062 3300031911 Bacteria 6002
359 Ga0307412_10172074 3300031911 Bacteria 1620
360 Ga0307412_10406759 3300031911 Bacteria 1109
361 Ga0307409_100109085 3300031995 Bacteria 2317
362 Ga0307416_100003175 3300032002 Bacteria 9634
363 Ga0307416_100012183 3300032002 Bacteria 5778
364 Ga0307416_100100327 3300032002 Bacteria 2517
365 Ga0307414_10094954 3300032004 Bacteria 2227
366 Ga0307411_10051507 3300032005 Bacteria 2686
367 Ga0307411_10071529 3300032005 Bacteria 2351
368 Ga0307411_10103365 3300032005 Bacteria 2021
369 Ga0307411_10123207 3300032005 Bacteria 1880
370 Ga0307411_10299804 3300032005 Bacteria 1288
371 Ga0307510_10049948 3300033180 Bacteria 4443
372 Ga0439436_0000461 3300041404 Bacteria 10431
373 Ga0439436_0016572 3300041404 Bacteria 2209
374 Ga0439439_0004279 3300041406 Bacteria 3208
375 Ga0439466_0000370 3300041411 Bacteria 17330
376 Ga0439466_0029204 3300041411 Bacteria 1899
377 Ga0439466_0037424 3300041411 Bacteria 1633
378 Ga0439465_0000199 3300041413 Bacteria 15833
379 Ga0451807_1667229 3300041486 Bacteria 2515
380 Ga0439431_0000478 3300041997 Bacteria 8489
381 Ga0439445_0002298 3300042004 Bacteria 4242
382 Ga0439432_001585 3300042006 Bacteria 8506
383 Ga0439449_0001060 3300042007 Bacteria 10844
384 Ga0439449_0019049 3300042007 Bacteria 2574
385 Ga0439449_0024679 3300042007 Bacteria 2247
386 Ga0439452_001693 3300042010 Bacteria 8662
387 Ga0439452_011220 3300042010 Bacteria 2582
388 Ga0439457_013756 3300042014 Bacteria 1816
389 Ga0439462_0003937 3300042015 Bacteria 3592
390 Ga0450920_008288 3300042122 Bacteria 1897
391 Ga0450923_001454 3300042125 Bacteria 3146
392 Ga0450898_007825 3300042134 Bacteria 1672
393 Ga0450910_000577 3300042147 Bacteria 4347
394 Ga0439446_0000308 3300042156 Bacteria 9302
395 Ga0450908_005075 3300042184 Bacteria 2525
396 Ga0439434_0002154 3300042435 Bacteria 5705
397 Ga0439434_0003511 3300042435 Bacteria 4579
398 Ga0439434_0004467 3300042435 Bacteria 4090
399 Ga0450918_001276 3300042531 Bacteria 5105
400 Ga0450918_002797 3300042531 Bacteria 3275
401 Ga0453683_0000780 3300044673 Bacteria 31494
402 Ga0466965_0015179 3300044683 Bacteria 3658
403 Ga0466957_0075912 3300044842 Bacteria 2086
404 Ga0451576_0009504 3300045051 Bacteria 11268
405 Ga0495627_002946 3300046453 Bacteria 7812
406 Ga0495592_0000517 3300046454 Bacteria 27891
407 Ga0495638_0006974 3300046460 Bacteria 8156
408 Ga0495638_0122453 3300046460 Bacteria 1535
409 Ga0495650_0008538 3300046471 Bacteria 5959
410 Ga0495610_0035017 3300046512 Bacteria 2581
411 Ga0495616_0002046 3300046513 Bacteria 13550
412 Ga0495616_0005573 3300046513 Bacteria 7723
413 Ga0495620_0015248 3300046515 Bacteria 3883
414 Ga0495620_0035368 3300046515 Bacteria 2246
415 Ga0495631_0000427 3300046518 Bacteria 29158
416 Ga0495631_0002961 3300046518 Bacteria 9401
417 Ga0495637_0065529 3300046520 Bacteria 1478
418 Ga0495642_0032268 3300046528 Bacteria 2101
419 Ga0495654_0021356 3300046530 Bacteria 3368
420 Ga0495654_0037385 3300046530 Bacteria 2435
421 Ga0495621_0019335 3300046539 Bacteria 2223
422 Ga0495621_0077047 3300046539 Bacteria 1238
423 Ga0495597_0000481 3300046542 Bacteria 33500
424 Ga0495597_0012490 3300046542 Bacteria 4098
425 Ga0495622_0142163 3300046557 Bacteria 1089
426 Ga0495656_0000049 3300046615 Bacteria 56829
427 Ga0495656_0000085 3300046615 Bacteria 41208
428 Ga0495656_0060099 3300046615 Bacteria 1655
429 Ga0495668_0083353 3300046616 Bacteria 1754
430 Ga0495625_0000510 3300046660 Bacteria 57454
431 Ga0495588_0022932 3300046674 Bacteria 3086
432 Ga0495588_0174797 3300046674 Bacteria 1135
433 Ga0495647_0132851 3300046681 Bacteria 1056
434 Ga0495658_0050677 3300046683 Bacteria 2349
435 Ga0495671_0029485 3300046692 Bacteria 2817
436 Ga0495676_0031109 3300047321 Bacteria 4518
437 Ga0495687_000174 3300047443 Bacteria 95031
438 Ga0495673_0070263 3300047469 Bacteria 1475
439 Ga0495686_0008230 3300047472 Bacteria 7688
440 Ga0495593_0001431 3300047673 Bacteria 14002
441 Ga0495593_0024984 3300047673 Bacteria 3305
442 Ga0495614_0005534 3300048089 Bacteria 5696
443 Ga0495615_0030969 3300048090 Bacteria 1280
444 Ga0496100_0037433 3300048903 Bacteria 3067
445 Ga0496101_0005762 3300048904 Bacteria 7918
446 Ga0496101_0025299 3300048904 Bacteria 4117
447 Ga0496102_0039763 3300048905 Bacteria 4251
448 Ga0496104_0001525 3300048907 Bacteria 19971
449 Ga0496105_0017531 3300048908 Bacteria 5744
450 Ga0496106_0177502 3300048909 Bacteria 1690
451 Ga0496108_0116478 3300048911 Bacteria 2289
452 Ga0496108_0259899 3300048911 Bacteria 1511
453 Ga0496109_0143149 3300048912 Bacteria 2236
454 Ga0496113_0166978 3300048916 Bacteria 1742
455 Ga0496114_0028241 3300048917 Bacteria 4602
456 Ga0496114_0029435 3300048917 Bacteria 4514
457 Ga0496116_0016711 3300048919 Bacteria 5730
458 Ga0496116_0016940 3300048919 Bacteria 5681
459 Ga0496116_0020933 3300048919 Bacteria 4948
460 Ga0496117_0034891 3300048920 Bacteria 3783
461 Ga0496118_0017790 3300048921 Bacteria 6451
462 Ga0496121_0052422 3300048924 Bacteria 3427
463 Ga0496121_0209169 3300048924 Bacteria 1383
464 Ga0496122_0001461 3300048925 Bacteria 38115
465 Ga0496122_0039176 3300048925 Bacteria 3782
466 Ga0496122_0051792 3300048925 Bacteria 3115
467 Ga0496123_0000179 3300048926 Bacteria 127833
468 Ga0496124_0133997 3300048927 Bacteria 1964
469 Ga0496124_0187489 3300048927 Bacteria 1586
470 Ga0496124_0230195 3300048927 Bacteria 1386
471 Ga0496125_0013608 3300048928 Bacteria 7988
472 Ga0496126_0199607 3300048929 Bacteria 1690
473 Ga0501316_010581 3300049532 Bacteria 1051
474 Ga0501320_008749 3300049536 Bacteria 1002
475 Ga0501198_000007 3300049649 Bacteria 129700
476 Ga0501222_000005 3300049662 Bacteria 129724
477 Ga0501249_001358 3300049679 Bacteria 5081
478 Ga0501252_006050 3300049682 Bacteria 1335
479 Ga0501225_0004140 3300049705 Bacteria 4337
480 Ga0501225_0011031 3300049705 Bacteria 2548
481 Ga0501262_000063 3300049759 Bacteria 12833
482 Ga0501265_002659 3300049762 Bacteria 2024
483 nmdc:mga03683_10934_c1 3300050489 Bacteria 3267
484 nmdc:mga03683_27735_c1 3300050489 Bacteria 2246
485 nmdc:mga03683_8009_c1 3300050489 Bacteria 3695
486 nmdc:mga03n38_2482_c1 3300050490 Bacteria 5705
487 nmdc:mga03n38_47634_c1 3300050490 Bacteria 1898
488 nmdc:mga00v17_11115_c2 3300050491 Bacteria 3980
489 nmdc:mga00v17_139184_c1 3300050491 Bacteria 1555
490 nmdc:mga00v17_317_c1 3300050491 Bacteria 27435
491 nmdc:mga00v17_39405_c1 3300050491 Bacteria 2830
492 nmdc:mga0yw44_35681_c1 3300050492 Bacteria 2924
493 nmdc:mga0yw44_94_c1 3300050492 Bacteria 31091
494 nmdc:mga0yw44_9647_c1 3300050492 Bacteria 4897
495 nmdc:mga0k408_1174_c1 3300050493 Bacteria 14328
496 nmdc:mga0k408_16301_c1 3300050493 Bacteria 4121
497 nmdc:mga0k408_22350_c1 3300050493 Bacteria 3561
498 nmdc:mga0k408_33839_c1 3300050493 Bacteria 2924
499 nmdc:mga0k408_39_c1 3300050493 Bacteria 66292
500 nmdc:mga0k408_729_c1 3300050493 Bacteria 18040
501 nmdc:mga0k408_7527_c1 3300050493 Bacteria 5816
502 nmdc:mga0k408_892_c1 3300050493 Bacteria 16353
503 nmdc:mga06z11_2023_c1 3300050494 Bacteria 7683
504 nmdc:mga04h51_20715_c1 3300050495 Bacteria 1968
505 nmdc:mga07m45_1487_c1 3300050496 Bacteria 10762
506 nmdc:mga07m45_2277_c1 3300050496 Bacteria 8971
507 nmdc:mga07m45_2527_c1 3300050496 Bacteria 8588
508 nmdc:mga07m45_25445_c1 3300050496 Bacteria 3245
509 nmdc:mga07m45_28479_c1 3300050496 Bacteria 3084
510 nmdc:mga07m45_4514_c1 3300050496 Bacteria 6816
511 nmdc:mga07m45_7356_c1 3300050496 Bacteria 5622
512 nmdc:mga07m45_75487_c1 3300050496 Bacteria 1921
513 nmdc:mga07m45_85981_c1 3300050496 Bacteria 1798
514 nmdc:mga07m45_8928_c1 3300050496 Bacteria 5176
515 Ga0500610_0021134 3300053079 Bacteria 3188
516 Ga0500578_0023973 3300053086 Bacteria 3919
517 Ga0500643_003877 3300053087 Bacteria 6960
518 Ga0500651_0000167 3300053093 Bacteria 42663
519 Ga0500651_0000674 3300053093 Bacteria 17006
520 Ga0500651_0019730 3300053093 Bacteria 4193
521 Ga0500566_0008966 3300053094 Bacteria 5914
522 Ga0500641_0159562 3300053096 Bacteria 973
523 Ga0500571_000040 3300053110 Bacteria 40510
524 Ga0500593_000457 3300053117 Bacteria 16194
525 Ga0500593_001045 3300053117 Bacteria 10033
526 Ga0500594_0004090 3300053118 Bacteria 3211
527 Ga0500608_052164 3300053122 Bacteria 1964
528 Ga0500655_000054 3300053133 Bacteria 31184
529 Ga0500559_0000558 3300053136 Bacteria 25786
530 Ga0500568_0001897 3300053139 Bacteria 12852
531 Ga0500568_0002834 3300053139 Bacteria 10004
532 Ga0500574_000536 3300053141 Bacteria 4880
533 Ga0500574_001350 3300053141 Bacteria 3618
534 Ga0500616_0051182 3300053153 Bacteria 2177
535 Ga0500622_0002629 3300053156 Bacteria 12769
536 Ga0500627_0001970 3300053158 Bacteria 5914
537 Ga0500627_0023110 3300053158 Bacteria 2530
538 Ga0500638_000197 3300053162 Bacteria 12463
539 Ga0500645_002647 3300053730 Bacteria 7819

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047472 Ga0495686_0008230 Ga0495686_0008230_4559_5527 303
2 3300009553 Ga0105249_10024618 Ga0105249_100246181 305
3 3300049532 Ga0501316_010581 Ga0501316_010581_18_986 306
4 3300005338 Ga0068868_100107600 Ga0068868_1001076002 307
5 3300026023 Ga0207677_10105653 Ga0207677_101056532 307
6 3300005328 Ga0070676_10212421 Ga0070676_102124211 308
7 3300005335 Ga0070666_10046631 Ga0070666_100466312 308
8 3300005354 Ga0070675_100003113 Ga0070675_10000311311 308
9 3300005543 Ga0070672_100033711 Ga0070672_1000337112 308
10 3300005618 Ga0068864_100002220 Ga0068864_1000022202 308
11 3300005843 Ga0068860_100170592 Ga0068860_1001705922 308
12 3300005844 Ga0068862_100058889 Ga0068862_1000588893 308
13 3300006358 Ga0068871_100059356 Ga0068871_1000593562 308
14 3300006881 Ga0068865_100045188 Ga0068865_1000451882 308
15 3300009177 Ga0105248_10037029 Ga0105248_100370294 308
16 3300013296 Ga0157374_10042643 Ga0157374_100426432 308
17 3300013306 Ga0163162_10006139 Ga0163162_100061392 308
18 3300013308 Ga0157375_10016070 Ga0157375_100160708 308
19 3300014969 Ga0157376_10054952 Ga0157376_100549522 308
20 3300017792 Ga0163161_10037658 Ga0163161_100376583 308
21 3300025907 Ga0207645_10133303 Ga0207645_101333032 308
22 3300025908 Ga0207643_10155001 Ga0207643_101550011 308
23 3300025923 Ga0207681_10298678 Ga0207681_102986781 308
24 3300025936 Ga0207670_10036817 Ga0207670_100368173 308
25 3300025938 Ga0207704_10065099 Ga0207704_100650992 308
26 3300025940 Ga0207691_10029522 Ga0207691_100295224 308
27 3300025961 Ga0207712_10072717 Ga0207712_100727173 308
28 3300026023 Ga0207677_10058419 Ga0207677_100584192 308
29 3300026035 Ga0207703_10011615 Ga0207703_100116155 308
30 3300026089 Ga0207648_10197131 Ga0207648_101971312 308
31 3300026095 Ga0207676_10014655 Ga0207676_100146554 308
32 3300026142 Ga0207698_10024342 Ga0207698_100243422 308
33 3300028380 Ga0268265_10066913 Ga0268265_100669132 308
34 3300048912 Ga0496109_0143149 Ga0496109_0143149_1164_2135 308
35 3300010375 Ga0105239_10226401 Ga0105239_102264012 309
36 3300044683 Ga0466965_0015179 Ga0466965_0015179_408_1379 311
37 3300053096 Ga0500641_0159562 Ga0500641_0159562_20_961 311
38 3300046515 Ga0495620_0035368 Ga0495620_0035368_854_1828 313
39 3300046520 Ga0495637_0065529 Ga0495637_0065529_140_1114 313
40 3300046530 Ga0495654_0037385 Ga0495654_0037385_1272_2246 313
41 3300046674 Ga0495588_0022932 Ga0495588_0022932_1259_2233 313
42 3300053117 Ga0500593_001045 Ga0500593_001045_5054_6028 313
43 3300053158 Ga0500627_0001970 Ga0500627_0001970_3749_4723 313
44 3300005328 Ga0070676_10001898 Ga0070676_100018985 315
45 3300005333 Ga0070677_10010567 Ga0070677_100105673 315
46 3300005334 Ga0068869_100003901 Ga0068869_1000039015 315
47 3300005338 Ga0068868_100344701 Ga0068868_1003447011 315
48 3300005340 Ga0070689_100107303 Ga0070689_1001073033 315
49 3300005354 Ga0070675_100130955 Ga0070675_1001309553 315
50 3300005356 Ga0070674_100001813 Ga0070674_1000018139 315
51 3300005364 Ga0070673_100322224 Ga0070673_1003222241 315
52 3300005367 Ga0070667_100006775 Ga0070667_1000067754 315
53 3300005457 Ga0070662_100017064 Ga0070662_1000170644 315
54 3300005543 Ga0070672_100005324 Ga0070672_1000053242 315
55 3300005564 Ga0070664_100029390 Ga0070664_1000293903 315
56 3300005616 Ga0068852_100085795 Ga0068852_1000857952 315
57 3300005617 Ga0068859_100090339 Ga0068859_1000903392 315
58 3300005618 Ga0068864_100102048 Ga0068864_1001020482 315
59 3300005841 Ga0068863_100027767 Ga0068863_1000277674 315
60 3300005843 Ga0068860_100005401 Ga0068860_1000054019 315
61 3300005844 Ga0068862_100030075 Ga0068862_1000300753 315
62 3300006881 Ga0068865_100004212 Ga0068865_1000042122 315
63 3300006931 Ga0097620_100090341 Ga0097620_1000903412 315
64 3300009148 Ga0105243_10006470 Ga0105243_100064703 315
65 3300009177 Ga0105248_10063949 Ga0105248_100639495 315
66 3300009553 Ga0105249_10021293 Ga0105249_100212935 315
67 3300013105 Ga0157369_10177377 Ga0157369_101773772 315
68 3300013306 Ga0163162_10169161 Ga0163162_101691612 315
69 3300013308 Ga0157375_10010413 Ga0157375_100104139 315
70 3300017792 Ga0163161_10008072 Ga0163161_100080724 315
71 3300025893 Ga0207682_10058074 Ga0207682_100580741 315
72 3300025901 Ga0207688_10166059 Ga0207688_101660592 315
73 3300025907 Ga0207645_10004343 Ga0207645_100043437 315
74 3300025923 Ga0207681_10017900 Ga0207681_100179002 315
75 3300025926 Ga0207659_10112316 Ga0207659_101123163 315
76 3300025933 Ga0207706_10017095 Ga0207706_100170954 315
77 3300025933 Ga0207706_10268549 Ga0207706_102685492 315
78 3300025935 Ga0207709_10039546 Ga0207709_100395462 315
79 3300025936 Ga0207670_10121864 Ga0207670_101218642 315
80 3300025940 Ga0207691_10009917 Ga0207691_100099173 315
81 3300025941 Ga0207711_10127826 Ga0207711_101278262 315
82 3300025942 Ga0207689_10003961 Ga0207689_100039615 315
83 3300025945 Ga0207679_10340450 Ga0207679_103404502 315
84 3300025960 Ga0207651_10345335 Ga0207651_103453352 315
85 3300025961 Ga0207712_10050226 Ga0207712_100502263 315
86 3300025972 Ga0207668_10065118 Ga0207668_100651183 315
87 3300025986 Ga0207658_10154700 Ga0207658_101547002 315
88 3300026023 Ga0207677_10067003 Ga0207677_100670032 315
89 3300026035 Ga0207703_10088027 Ga0207703_100880273 315
90 3300026041 Ga0207639_10189606 Ga0207639_101896062 315
91 3300026075 Ga0207708_10013465 Ga0207708_100134655 315
92 3300026089 Ga0207648_10010452 Ga0207648_100104528 315
93 3300026118 Ga0207675_100014546 Ga0207675_1000145464 315
94 3300026121 Ga0207683_10023567 Ga0207683_100235674 315
95 3300026142 Ga0207698_10053831 Ga0207698_100538313 315
96 3300028381 Ga0268264_10010530 Ga0268264_100105302 315
97 3300041486 Ga0451807_1667229 Ga0451807_1667229_1107_2081 315
98 3300046460 Ga0495638_0006974 Ga0495638_0006974_3390_4364 315
99 3300046460 Ga0495638_0122453 Ga0495638_0122453_234_1211 315
100 3300046512 Ga0495610_0035017 Ga0495610_0035017_1447_2421 315
101 3300046513 Ga0495616_0002046 Ga0495616_0002046_5742_6719 315
102 3300046513 Ga0495616_0005573 Ga0495616_0005573_2863_3837 315
103 3300046518 Ga0495631_0000427 Ga0495631_0000427_21030_22007 315
104 3300046518 Ga0495631_0002961 Ga0495631_0002961_3785_4759 315
105 3300046530 Ga0495654_0021356 Ga0495654_0021356_888_1862 315
106 3300046557 Ga0495622_0142163 Ga0495622_0142163_26_1000 315
107 3300046674 Ga0495588_0174797 Ga0495588_0174797_87_1064 315
108 3300046681 Ga0495647_0132851 Ga0495647_0132851_69_1046 315
109 3300046683 Ga0495658_0050677 Ga0495658_0050677_163_1140 315
110 3300047321 Ga0495676_0031109 Ga0495676_0031109_2359_3336 315
111 3300047673 Ga0495593_0001431 Ga0495593_0001431_10030_11007 315
112 3300047673 Ga0495593_0024984 Ga0495593_0024984_1092_2066 315
113 3300048089 Ga0495614_0005534 Ga0495614_0005534_1287_2261 315
114 3300048917 Ga0496114_0029435 Ga0496114_0029435_1283_2260 315
115 3300048925 Ga0496122_0051792 Ga0496122_0051792_398_1372 315
116 3300048929 Ga0496126_0199607 Ga0496126_0199607_322_1299 315
117 3300053087 Ga0500643_003877 Ga0500643_003877_5213_6190 315
118 3300053093 Ga0500651_0000167 Ga0500651_0000167_26115_27092 315
119 3300053093 Ga0500651_0000674 Ga0500651_0000674_4053_5027 315
120 3300053094 Ga0500566_0008966 Ga0500566_0008966_1664_2641 315
121 3300053110 Ga0500571_000040 Ga0500571_000040_26918_27895 315
122 3300053118 Ga0500594_0004090 Ga0500594_0004090_330_1307 315
123 3300053133 Ga0500655_000054 Ga0500655_000054_11087_12064 315
124 3300053139 Ga0500568_0001897 Ga0500568_0001897_1525_2499 315
125 3300053139 Ga0500568_0002834 Ga0500568_0002834_584_1561 315
126 3300053141 Ga0500574_000536 Ga0500574_000536_2674_3648 315
127 3300053141 Ga0500574_001350 Ga0500574_001350_1742_2719 315
128 3300053153 Ga0500616_0051182 Ga0500616_0051182_868_1842 315
129 3300053162 Ga0500638_000197 Ga0500638_000197_148_1125 315
130 3300005328 Ga0070676_10008826 Ga0070676_100088262 316
131 3300005331 Ga0070670_100055393 Ga0070670_1000553933 316
132 3300005333 Ga0070677_10018826 Ga0070677_100188262 316
133 3300005334 Ga0068869_100012322 Ga0068869_1000123222 316
134 3300005355 Ga0070671_100054735 Ga0070671_1000547353 316
135 3300005364 Ga0070673_100004630 Ga0070673_1000046307 316
136 3300005457 Ga0070662_100139241 Ga0070662_1001392413 316
137 3300005459 Ga0068867_100059306 Ga0068867_1000593062 316
138 3300005543 Ga0070672_100006932 Ga0070672_1000069327 316
139 3300025893 Ga0207682_10033531 Ga0207682_100335313 316
140 3300025907 Ga0207645_10036921 Ga0207645_100369214 316
141 3300025908 Ga0207643_10148821 Ga0207643_101488212 316
142 3300025926 Ga0207659_10021020 Ga0207659_100210201 316
143 3300025931 Ga0207644_10078424 Ga0207644_100784243 316
144 3300025938 Ga0207704_10066918 Ga0207704_100669182 316
145 3300025940 Ga0207691_10004921 Ga0207691_100049218 316
146 3300025942 Ga0207689_10016702 Ga0207689_100167022 316
147 3300025986 Ga0207658_10153403 Ga0207658_101534032 316
148 3300026023 Ga0207677_10104078 Ga0207677_101040783 316
149 3300026089 Ga0207648_10004164 Ga0207648_100041647 316
150 iso_pu_bacteria 2643221654 2644301179 316
151 3300005328 Ga0070676_10013570 Ga0070676_100135702 317
152 3300005338 Ga0068868_100232470 Ga0068868_1002324702 317
153 3300005459 Ga0068867_100029643 Ga0068867_1000296434 317
154 3300025907 Ga0207645_10036430 Ga0207645_100364305 317
155 3300025925 Ga0207650_10193322 Ga0207650_101933222 317
156 3300026089 Ga0207648_10010854 Ga0207648_100108547 317
157 3300009148 Ga0105243_10051046 Ga0105243_100510465 318
158 iso_pu_bacteria 2643221596 2643994315 318
159 iso_pu_bacteria 2643221628 2644159183 318
160 iso_pu_bacteria 2643221658 2644327410 318
161 iso_pu_bacteria 2643221683 2644464628 318
162 iso_pu_bacteria 2643221683 2644465498 318
163 iso_pu_bacteria 2842677519 2842677681 318
164 iso_pu_bacteria 2842677519 2842681098 318
165 iso_pu_bacteria 2842747753 2842748285 318
166 iso_pu_bacteria 2881101125 2881102485 318
167 iso_pu_bacteria 2919462493 2919465505 318
168 iso_pu_bacteria 2919462493 2919466853 318
169 iso_pu_bacteria 2990710928 2990714379 318
170 3300005455 Ga0070663_100005578 Ga0070663_1000055788 319
171 3300013297 Ga0157378_10507931 Ga0157378_105079312 319
172 3300025935 Ga0207709_10033346 Ga0207709_100333462 319
173 3300046471 Ga0495650_0008538 Ga0495650_0008538_1587_2555 319
174 3300050489 nmdc:mga03683_8009_c1 nmdc:mga03683_8009_c1_2624_3601 319
175 3300050496 nmdc:mga07m45_75487_c1 nmdc:mga07m45_75487_c1_108_1085 319
176 iso_pu_bacteria 2547132374 2548499496 319
177 iso_pu_bacteria 2643221570 2643866326 319
178 iso_pu_bacteria 2643221609 2644057425 319
179 iso_pu_bacteria 2643221611 2644072486 319
180 iso_pu_bacteria 2643221652 2644293147 319
181 iso_pu_bacteria 2643221717 2644648160 319
182 iso_pu_bacteria 2738543012 2739241696 319
183 iso_pu_bacteria 2816332133 2816470999 319
184 iso_pu_bacteria 2945945610 2945947878 319
185 3300005355 Ga0070671_100028482 Ga0070671_1000284825 320
186 3300005455 Ga0070663_100052115 Ga0070663_1000521152 320
187 3300005548 Ga0070665_100020973 Ga0070665_1000209735 320
188 3300005548 Ga0070665_100174926 Ga0070665_1001749263 320
189 3300005577 Ga0068857_100005597 Ga0068857_1000055976 320
190 3300005843 Ga0068860_100273919 Ga0068860_1002739191 320
191 3300006042 Ga0075368_10001317 Ga0075368_100013176 320
192 3300006042 Ga0075368_10011263 Ga0075368_100112633 320
193 3300006048 Ga0075363_100012413 Ga0075363_1000124132 320
194 3300006051 Ga0075364_10007952 Ga0075364_100079522 320
195 3300006178 Ga0075367_10005218 Ga0075367_100052187 320
196 3300006186 Ga0075369_10003289 Ga0075369_100032892 320
197 3300006195 Ga0075366_10000512 Ga0075366_100005122 320
198 3300006195 Ga0075366_10001615 Ga0075366_1000161511 320
199 3300006353 Ga0075370_10002120 Ga0075370_100021206 320
200 3300006353 Ga0075370_10003491 Ga0075370_100034916 320
201 3300006353 Ga0075370_10014520 Ga0075370_100145204 320
202 3300009093 Ga0105240_10094193 Ga0105240_100941931 320
203 3300009098 Ga0105245_10249530 Ga0105245_102495302 320
204 3300009545 Ga0105237_10000646 Ga0105237_1000064615 320
205 3300009545 Ga0105237_10023146 Ga0105237_100231466 320
206 3300010375 Ga0105239_10002203 Ga0105239_100022039 320
207 3300025893 Ga0207682_10087063 Ga0207682_100870632 320
208 3300025913 Ga0207695_10028147 Ga0207695_100281477 320
209 3300025914 Ga0207671_10056167 Ga0207671_100561673 320
210 3300025914 Ga0207671_10114799 Ga0207671_101147993 320
211 3300025924 Ga0207694_10022957 Ga0207694_100229574 320
212 3300026035 Ga0207703_10224897 Ga0207703_102248972 320
213 3300026041 Ga0207639_10063026 Ga0207639_100630263 320
214 3300026067 Ga0207678_10034625 Ga0207678_100346254 320
215 3300026095 Ga0207676_10493655 Ga0207676_104936551 320
216 3300026116 Ga0207674_10009080 Ga0207674_1000908010 320
217 3300027866 Ga0209813_10000936 Ga0209813_100009362 320
218 3300028379 Ga0268266_10026929 Ga0268266_100269295 320
219 3300028379 Ga0268266_10323096 Ga0268266_103230962 320
220 3300030522 Ga0307512_10177253 Ga0307512_101772532 320
221 3300031507 Ga0307509_10002279 Ga0307509_100022795 320
222 3300033180 Ga0307510_10049948 Ga0307510_100499484 320
223 3300046454 Ga0495592_0000517 Ga0495592_0000517_26377_27348 320
224 3300046542 Ga0495597_0012490 Ga0495597_0012490_1668_2648 320
225 3300046616 Ga0495668_0083353 Ga0495668_0083353_504_1484 320
226 3300047443 Ga0495687_000174 Ga0495687_000174_63689_64669 320
227 3300048924 Ga0496121_0209169 Ga0496121_0209169_139_1110 320
228 3300049536 Ga0501320_008749 Ga0501320_008749_15_983 320
229 3300049649 Ga0501198_000007 Ga0501198_000007_106288_107259 320
230 3300049662 Ga0501222_000005 Ga0501222_000005_22485_23456 320
231 3300049762 Ga0501265_002659 Ga0501265_002659_909_1877 320
232 3300050489 nmdc:mga03683_10934_c1 nmdc:mga03683_10934_c1_91_1071 320
233 3300050490 nmdc:mga03n38_2482_c1 nmdc:mga03n38_2482_c1_1291_2271 320
234 3300050491 nmdc:mga00v17_11115_c2 nmdc:mga00v17_11115_c2_1037_2017 320
235 3300050492 nmdc:mga0yw44_35681_c1 nmdc:mga0yw44_35681_c1_371_1366 320
236 3300050493 nmdc:mga0k408_1174_c1 nmdc:mga0k408_1174_c1_7964_8944 320
237 3300050493 nmdc:mga0k408_16301_c1 nmdc:mga0k408_16301_c1_2499_3470 320
238 3300050493 nmdc:mga0k408_33839_c1 nmdc:mga0k408_33839_c1_471_1451 320
239 3300050493 nmdc:mga0k408_729_c1 nmdc:mga0k408_729_c1_5163_6158 320
240 3300050493 nmdc:mga0k408_892_c1 nmdc:mga0k408_892_c1_4783_5763 320
241 3300050494 nmdc:mga06z11_2023_c1 nmdc:mga06z11_2023_c1_3269_4249 320
242 3300050495 nmdc:mga04h51_20715_c1 nmdc:mga04h51_20715_c1_886_1866 320
243 3300050496 nmdc:mga07m45_2277_c1 nmdc:mga07m45_2277_c1_4990_5970 320
244 3300050496 nmdc:mga07m45_4514_c1 nmdc:mga07m45_4514_c1_1594_2574 320
245 3300050496 nmdc:mga07m45_8928_c1 nmdc:mga07m45_8928_c1_2579_3559 320
246 3300053086 Ga0500578_0023973 Ga0500578_0023973_1702_2673 320
247 3300053093 Ga0500651_0019730 Ga0500651_0019730_1826_2797 320
248 3300053136 Ga0500559_0000558 Ga0500559_0000558_21772_22743 320
249 3300053156 Ga0500622_0002629 Ga0500622_0002629_551_1522 320
250 3300053730 Ga0500645_002647 Ga0500645_002647_5789_6760 320
251 iso_pu_bacteria 2513020051 2513227852 320
252 iso_pu_bacteria 2599185214 2599621986 320
253 iso_pu_bacteria 2599185226 2599676849 320
254 iso_pu_bacteria 2599185227 2599685179 320
255 iso_pu_bacteria 2599185229 2599691496 320
256 iso_pu_bacteria 2643221628 2644161534 320
257 iso_pu_bacteria 2643221658 2644326959 320
258 iso_pu_bacteria 2643221672 2644398759 320
259 iso_pu_bacteria 2643221683 2644466444 320
260 iso_pu_bacteria 2738541277 2738721957 320
261 iso_pu_bacteria 2738541307 2738880195 320
262 iso_pu_bacteria 2738541307 2738882124 320
263 iso_pu_bacteria 2738543019 2739282321 320
264 iso_pu_bacteria 2818991446 2819598056 320
265 iso_pu_bacteria 2831265667 2831269044 320
266 iso_pu_bacteria 2838054893 2838058468 320
267 iso_pu_bacteria 2842677519 2842678372 320
268 iso_pu_bacteria 2842718218 2842722216 320
269 iso_pu_bacteria 2885192300 2885197807 320
270 iso_pu_bacteria 2885198086 2885203786 320
271 iso_pu_bacteria 2885211737 2885217879 320
272 iso_pu_bacteria 2899924645 2899929475 320
273 iso_pu_bacteria 2904449895 2904451037 320
274 iso_pu_bacteria 2904456579 2904457893 320
275 iso_pu_bacteria 2904541872 2904543346 320
276 iso_pu_bacteria 2919462493 2919465749 320
277 iso_pu_bacteria 2928037797 2928040081 320
278 iso_pu_bacteria 2928044640 2928047170 320
279 iso_pu_bacteria 2928051484 2928057627 320
280 iso_pu_bacteria 2928064002 2928065571 320
281 iso_pu_bacteria 2928064002 2928067991 320
282 iso_pu_bacteria 2928070936 2928072566 320
283 iso_pu_bacteria 2928084124 2928085746 320
284 iso_pu_bacteria 2928084124 2928086828 320
285 iso_pu_bacteria 2929160207 2929160578 320
286 iso_pu_bacteria 2929520902 2929523685 320
287 iso_pu_bacteria 2945909444 2945913771 320
288 iso_pu_bacteria 2945909444 2945914924 320
289 iso_pu_bacteria 2945945610 2945951040 320
290 iso_pu_bacteria 2945972063 2945974299 320
291 iso_pu_bacteria 2945984333 2945989672 320
292 iso_pu_bacteria 2945984333 2945990836 320
293 iso_pu_bacteria 2954767861 2954769563 320
294 iso_pu_bacteria 2974320154 2974320879 320
295 3300017792 Ga0163161_10029066 Ga0163161_100290663 321
296 3300001989 JGI24739J22299_10035608 JGI24739J22299_100356082 322
297 3300003781 Ga0055536_1010222 Ga0055536_10102223 322
298 3300003784 Ga0055534_1000008 Ga0055534_1000008109 322
299 3300003790 Ga0055528_1000170 Ga0055528_100017019 322
300 3300003792 Ga0055540_1005976 Ga0055540_10059763 322
301 3300005288 Ga0065714_10003497 Ga0065714_100034979 322
302 3300005367 Ga0070667_100031717 Ga0070667_1000317172 322
303 3300005543 Ga0070672_100073991 Ga0070672_1000739912 322
304 3300005548 Ga0070665_100259542 Ga0070665_1002595422 322
305 3300006038 Ga0075365_10008719 Ga0075365_100087195 322
306 3300006048 Ga0075363_100003026 Ga0075363_1000030263 322
307 3300006051 Ga0075364_10000165 Ga0075364_1000016510 322
308 3300006058 Ga0075432_10006440 Ga0075432_100064405 322
309 3300006177 Ga0075362_10005439 Ga0075362_100054394 322
310 3300006195 Ga0075366_10007653 Ga0075366_100076535 322
311 3300006195 Ga0075366_10045159 Ga0075366_100451591 322
312 3300006353 Ga0075370_10033208 Ga0075370_100332083 322
313 3300006353 Ga0075370_10033330 Ga0075370_100333302 322
314 3300006353 Ga0075370_10145934 Ga0075370_101459341 322
315 3300006353 Ga0075370_10155857 Ga0075370_101558572 322
316 3300006946 Ga0079104_1025453 Ga0079104_10254531 322
317 3300006948 Ga0099826_10000134 Ga0099826_100001348 322
318 3300011119 Ga0105246_10066431 Ga0105246_100664313 322
319 3300013104 Ga0157370_10001540 Ga0157370_1000154011 322
320 3300013306 Ga0163162_10175551 Ga0163162_101755513 322
321 3300014326 Ga0157380_10294501 Ga0157380_102945012 322
322 3300014497 Ga0182008_10078989 Ga0182008_100789892 322
323 3300014969 Ga0157376_10000620 Ga0157376_1000062015 322
324 3300015261 Ga0182006_1043588 Ga0182006_10435882 322
325 3300025263 Ga0209565_1000042 Ga0209565_1000042109 322
326 3300025273 Ga0209673_1000071 Ga0209673_1000071119 322
327 3300025273 Ga0209673_1004323 Ga0209673_10043232 322
328 3300025291 Ga0209675_1000041 Ga0209675_1000041118 322
329 3300025292 Ga0209676_1000173 Ga0209676_100017364 322
330 3300025292 Ga0209676_1029668 Ga0209676_10296682 322
331 3300025294 Ga0209025_1044238 Ga0209025_10442382 322
332 3300025294 Ga0209025_1047275 Ga0209025_10472752 322
333 3300025299 Ga0209256_1020864 Ga0209256_10208642 322
334 3300025303 Ga0209051_1000282 Ga0209051_100028210 322
335 3300025935 Ga0207709_10000285 Ga0207709_1000028544 322
336 3300025940 Ga0207691_10028236 Ga0207691_100282362 322
337 3300025942 Ga0207689_10055180 Ga0207689_100551802 322
338 3300025986 Ga0207658_10276019 Ga0207658_102760192 322
339 3300027111 Ga0209281_1018037 Ga0209281_10180372 322
340 3300028379 Ga0268266_10207934 Ga0268266_102079342 322
341 3300028379 Ga0268266_10299215 Ga0268266_102992152 322
342 3300028786 Ga0307517_10013720 Ga0307517_100137208 322
343 3300028794 Ga0307515_10136841 Ga0307515_101368412 322
344 3300030731 Ga0316177_1018459 Ga0316177_10184593 322
345 3300030731 Ga0316177_1186399 Ga0316177_11863996 322
346 3300030732 Ga0316176_1116172 Ga0316176_11161723 322
347 3300030733 Ga0314311_1007245 Ga0314311_10072452 322
348 3300030734 Ga0316179_1094680 Ga0316179_10946802 322
349 3300030735 Ga0316178_1028671 Ga0316178_10286714 322
350 3300030745 Ga0316182_1061027 Ga0316182_10610274 322
351 3300031456 Ga0307513_10048430 Ga0307513_100484305 322
352 3300031548 Ga0307408_100332050 Ga0307408_1003320501 322
353 3300031616 Ga0307508_10173327 Ga0307508_101733272 322
354 3300031649 Ga0307514_10003232 Ga0307514_1000323213 322
355 3300031730 Ga0307516_10102694 Ga0307516_101026942 322
356 3300031731 Ga0307405_10016902 Ga0307405_100169024 322
357 3300031852 Ga0307410_10255742 Ga0307410_102557422 322
358 3300031911 Ga0307412_10172074 Ga0307412_101720742 322
359 3300032002 Ga0307416_100003175 Ga0307416_1000031758 322
360 3300032005 Ga0307411_10071529 Ga0307411_100715292 322
361 3300032005 Ga0307411_10103365 Ga0307411_101033653 322
362 3300032005 Ga0307411_10299804 Ga0307411_102998042 322
363 3300041411 Ga0439466_0037424 Ga0439466_0037424_167_1144 322
364 3300042184 Ga0450908_005075 Ga0450908_005075_888_1889 322
365 3300042435 Ga0439434_0002154 Ga0439434_0002154_2399_3400 322
366 3300042531 Ga0450918_002797 Ga0450918_002797_208_1209 322
367 3300046528 Ga0495642_0032268 Ga0495642_0032268_957_1934 322
368 3300046539 Ga0495621_0019335 Ga0495621_0019335_939_1916 322
369 3300046539 Ga0495621_0077047 Ga0495621_0077047_46_1023 322
370 3300046615 Ga0495656_0000085 Ga0495656_0000085_14208_15185 322
371 3300046615 Ga0495656_0060099 Ga0495656_0060099_595_1572 322
372 3300047469 Ga0495673_0070263 Ga0495673_0070263_93_1115 322
373 3300048090 Ga0495615_0030969 Ga0495615_0030969_126_1103 322
374 3300048903 Ga0496100_0037433 Ga0496100_0037433_791_1768 322
375 3300048904 Ga0496101_0025299 Ga0496101_0025299_762_1739 322
376 3300048905 Ga0496102_0039763 Ga0496102_0039763_884_1861 322
377 3300048907 Ga0496104_0001525 Ga0496104_0001525_492_1469 322
378 3300048908 Ga0496105_0017531 Ga0496105_0017531_464_1441 322
379 3300048909 Ga0496106_0177502 Ga0496106_0177502_590_1567 322
380 3300048911 Ga0496108_0116478 Ga0496108_0116478_1023_2000 322
381 3300048911 Ga0496108_0259899 Ga0496108_0259899_209_1186 322
382 3300048916 Ga0496113_0166978 Ga0496113_0166978_494_1471 322
383 3300048917 Ga0496114_0028241 Ga0496114_0028241_2835_3812 322
384 3300048925 Ga0496122_0001461 Ga0496122_0001461_22097_23074 322
385 3300048926 Ga0496123_0000179 Ga0496123_0000179_102066_103043 322
386 3300048927 Ga0496124_0230195 Ga0496124_0230195_258_1235 322
387 3300049682 Ga0501252_006050 Ga0501252_006050_217_1194 322
388 3300049705 Ga0501225_0004140 Ga0501225_0004140_356_1333 322
389 3300050490 nmdc:mga03n38_47634_c1 nmdc:mga03n38_47634_c1_607_1584 322
390 3300050491 nmdc:mga00v17_139184_c1 nmdc:mga00v17_139184_c1_18_995 322
391 3300050491 nmdc:mga00v17_317_c1 nmdc:mga00v17_317_c1_21633_22634 322
392 3300050492 nmdc:mga0yw44_94_c1 nmdc:mga0yw44_94_c1_1659_2660 322
393 3300050493 nmdc:mga0k408_39_c1 nmdc:mga0k408_39_c1_25269_26270 322
394 3300050493 nmdc:mga0k408_39_c1 nmdc:mga0k408_39_c1_40023_41024 322
395 3300050496 nmdc:mga07m45_1487_c1 nmdc:mga07m45_1487_c1_853_1830 322
396 3300050496 nmdc:mga07m45_7356_c1 nmdc:mga07m45_7356_c1_4124_5125 322
397 3300003792 Ga0055540_1007595 Ga0055540_10075952 323
398 3300003794 Ga0055531_10001626 Ga0055531_100016267 323
399 3300006846 Ga0075430_100039277 Ga0075430_1000392771 323
400 3300025273 Ga0209673_1006959 Ga0209673_10069592 323
401 3300025303 Ga0209051_1000172 Ga0209051_100017246 323
402 3300025304 Ga0209257_1000015 Ga0209257_1000015541 323
403 3300025304 Ga0209257_1000108 Ga0209257_1000108169 323
404 3300025909 Ga0207705_10178452 Ga0207705_101784522 323
405 3300025913 Ga0207695_10143317 Ga0207695_101433173 323
406 3300044673 Ga0453683_0000780 Ga0453683_0000780_14997_15980 323
407 3300045051 Ga0451576_0009504 Ga0451576_0009504_1712_2695 323
408 3300046615 Ga0495656_0000049 Ga0495656_0000049_29432_30454 323
409 3300001979 JGI24740J21852_10038452 JGI24740J21852_100384521 324
410 3300001989 JGI24739J22299_10006667 JGI24739J22299_100066673 324
411 3300003187 JGI25151J46595_10003087 JGI25151J46595_100030872 324
412 3300003578 Ga0006562J51391_1110138 Ga0006562J51391_11101382 324
413 3300003761 Ga0055535_1001456 Ga0055535_10014562 324
414 3300003762 Ga0055542_1000003 Ga0055542_100000320 324
415 3300003773 Ga0055537_1001922 Ga0055537_10019224 324
416 3300003781 Ga0055536_1002577 Ga0055536_10025777 324
417 3300003791 Ga0055530_10000292 Ga0055530_1000029229 324
418 3300003791 Ga0055530_10007508 Ga0055530_100075082 324
419 3300003792 Ga0055540_1001010 Ga0055540_10010107 324
420 3300003792 Ga0055540_1002374 Ga0055540_10023743 324
421 3300003794 Ga0055531_10001140 Ga0055531_100011409 324
422 3300005288 Ga0065714_10009417 Ga0065714_100094172 324
423 3300005289 Ga0065704_10125337 Ga0065704_101253372 324
424 3300005344 Ga0070661_100206362 Ga0070661_1002063622 324
425 3300005457 Ga0070662_100184062 Ga0070662_1001840622 324
426 3300005563 Ga0068855_100452673 Ga0068855_1004526731 324
427 3300005564 Ga0070664_100238184 Ga0070664_1002381842 324
428 3300005577 Ga0068857_100025871 Ga0068857_1000258713 324
429 3300005577 Ga0068857_100052976 Ga0068857_1000529762 324
430 3300005578 Ga0068854_100133847 Ga0068854_1001338472 324
431 3300005616 Ga0068852_100094212 Ga0068852_1000942122 324
432 3300005834 Ga0068851_10000564 Ga0068851_100005645 324
433 3300005844 Ga0068862_100326814 Ga0068862_1003268141 324
434 3300006048 Ga0075363_100012835 Ga0075363_1000128352 324
435 3300006051 Ga0075364_10011256 Ga0075364_100112562 324
436 3300006051 Ga0075364_10017227 Ga0075364_100172274 324
437 3300006058 Ga0075432_10003022 Ga0075432_100030222 324
438 3300006177 Ga0075362_10043641 Ga0075362_100436412 324
439 3300006195 Ga0075366_10020374 Ga0075366_100203742 324
440 3300006195 Ga0075366_10182856 Ga0075366_101828562 324
441 3300006353 Ga0075370_10000867 Ga0075370_100008673 324
442 3300006948 Ga0099826_10000249 Ga0099826_1000024911 324
443 3300009036 Ga0105244_10001068 Ga0105244_1000106821 324
444 3300009098 Ga0105245_10024599 Ga0105245_100245994 324
445 3300009148 Ga0105243_10002328 Ga0105243_1000232810 324
446 3300009148 Ga0105243_10006784 Ga0105243_100067847 324
447 3300009176 Ga0105242_10198852 Ga0105242_101988522 324
448 3300009551 Ga0105238_10080945 Ga0105238_100809453 324
449 3300012502 Ga0157347_1001474 Ga0157347_10014741 324
450 3300013105 Ga0157369_10101715 Ga0157369_101017152 324
451 3300013297 Ga0157378_10474269 Ga0157378_104742692 324
452 3300013306 Ga0163162_10282850 Ga0163162_102828502 324
453 3300013307 Ga0157372_10014394 Ga0157372_100143945 324
454 3300014497 Ga0182008_10004254 Ga0182008_100042542 324
455 3300014497 Ga0182008_10009875 Ga0182008_100098754 324
456 3300014969 Ga0157376_10017903 Ga0157376_100179032 324
457 3300015261 Ga0182006_1004191 Ga0182006_10041916 324
458 3300015261 Ga0182006_1006968 Ga0182006_10069682 324
459 3300015262 Ga0182007_10001485 Ga0182007_1000148510 324
460 3300015262 Ga0182007_10002591 Ga0182007_100025913 324
461 3300015683 Ga0183362_10007 Ga0183362_1000746 324
462 3300017792 Ga0163161_10000105 Ga0163161_1000010568 324
463 3300017792 Ga0163161_10000657 Ga0163161_1000065725 324
464 3300017792 Ga0163161_10004139 Ga0163161_100041395 324
465 3300025228 Ga0209672_101644 Ga0209672_1016443 324
466 3300025229 Ga0209147_100439 Ga0209147_10043921 324
467 3300025242 Ga0209258_100015 Ga0209258_100015138 324
468 3300025245 Ga0207425_1000234 Ga0207425_100023426 324
469 3300025254 Ga0209148_1000028 Ga0209148_1000028530 324
470 3300025258 Ga0209129_1000049 Ga0209129_1000049144 324
471 3300025258 Ga0209129_1007065 Ga0209129_10070652 324
472 3300025263 Ga0209565_1000108 Ga0209565_10001089 324
473 3300025263 Ga0209565_1000337 Ga0209565_100033720 324
474 3300025273 Ga0209673_1000193 Ga0209673_1000193106 324
475 3300025273 Ga0209673_1000477 Ga0209673_100047733 324
476 3300025273 Ga0209673_1000817 Ga0209673_10008179 324
477 3300025273 Ga0209673_1019620 Ga0209673_10196202 324
478 3300025284 Ga0209130_1000267 Ga0209130_100026733 324
479 3300025284 Ga0209130_1006443 Ga0209130_10064432 324
480 3300025291 Ga0209675_1000163 Ga0209675_100016320 324
481 3300025291 Ga0209675_1000398 Ga0209675_10003984 324
482 3300025291 Ga0209675_1003589 Ga0209675_10035893 324
483 3300025291 Ga0209675_1014431 Ga0209675_10144311 324
484 3300025292 Ga0209676_1000137 Ga0209676_100013736 324
485 3300025292 Ga0209676_1000903 Ga0209676_100090321 324
486 3300025292 Ga0209676_1001273 Ga0209676_100127318 324
487 3300025292 Ga0209676_1022273 Ga0209676_10222732 324
488 3300025294 Ga0209025_1000409 Ga0209025_100040958 324
489 3300025294 Ga0209025_1000481 Ga0209025_100048142 324
490 3300025294 Ga0209025_1000707 Ga0209025_100070733 324
491 3300025294 Ga0209025_1005325 Ga0209025_10053255 324
492 3300025294 Ga0209025_1013704 Ga0209025_10137043 324
493 3300025295 Ga0209564_1000232 Ga0209564_10002329 324
494 3300025295 Ga0209564_1001382 Ga0209564_100138217 324
495 3300025297 Ga0209758_1000135 Ga0209758_100013533 324
496 3300025297 Ga0209758_1004899 Ga0209758_10048992 324
497 3300025298 Ga0209050_1000015 Ga0209050_1000015144 324
498 3300025298 Ga0209050_1000936 Ga0209050_100093621 324
499 3300025299 Ga0209256_1000129 Ga0209256_100012933 324
500 3300025299 Ga0209256_1000604 Ga0209256_100060418 324
501 3300025302 Ga0207426_1000171 Ga0207426_100017133 324
502 3300025302 Ga0207426_1000185 Ga0207426_100018530 324
503 3300025303 Ga0209051_1000010 Ga0209051_1000010144 324
504 3300025303 Ga0209051_1000137 Ga0209051_1000137116 324
505 3300025303 Ga0209051_1000556 Ga0209051_100055625 324
506 3300025303 Ga0209051_1000940 Ga0209051_10009407 324
507 3300025303 Ga0209051_1033120 Ga0209051_10331202 324
508 3300025304 Ga0209257_1000026 Ga0209257_1000026534 324
509 3300025304 Ga0209257_1000205 Ga0209257_1000205119 324
510 3300025728 Ga0207655_1000800 Ga0207655_100080029 324
511 3300025919 Ga0207657_10082967 Ga0207657_100829672 324
512 3300025924 Ga0207694_10017930 Ga0207694_100179303 324
513 3300025927 Ga0207687_10041056 Ga0207687_100410562 324
514 3300025932 Ga0207690_10049213 Ga0207690_100492132 324
515 3300025935 Ga0207709_10000461 Ga0207709_1000046110 324
516 3300025935 Ga0207709_10000947 Ga0207709_1000094720 324
517 3300025935 Ga0207709_10002463 Ga0207709_100024637 324
518 3300025942 Ga0207689_10077267 Ga0207689_100772672 324
519 3300025949 Ga0207667_10254641 Ga0207667_102546411 324
520 3300026041 Ga0207639_10048548 Ga0207639_100485483 324
521 3300026116 Ga0207674_10062409 Ga0207674_100624091 324
522 3300026116 Ga0207674_10091279 Ga0207674_100912791 324
523 3300027666 Ga0209282_1001604 Ga0209282_10016044 324
524 3300027907 Ga0207428_10066176 Ga0207428_100661762 324
525 3300028380 Ga0268265_10026846 Ga0268265_100268462 324
526 3300030734 Ga0316179_1087037 Ga0316179_10870372 324
527 3300030735 Ga0316178_1040279 Ga0316178_10402792 324
528 3300030736 Ga0316180_1145328 Ga0316180_11453282 324
529 3300030742 Ga0316183_1127478 Ga0316183_11274782 324
530 3300030744 Ga0316181_1178495 Ga0316181_11784952 324
531 3300030745 Ga0316182_1203815 Ga0316182_12038152 324
532 3300031456 Ga0307513_10074516 Ga0307513_100745163 324
533 3300031548 Ga0307408_100000107 Ga0307408_10000010764 324
534 3300031548 Ga0307408_100079691 Ga0307408_1000796911 324
535 3300031649 Ga0307514_10007285 Ga0307514_100072856 324
536 3300031649 Ga0307514_10207142 Ga0307514_102071421 324
537 3300031731 Ga0307405_10126774 Ga0307405_101267742 324
538 3300031824 Ga0307413_10061787 Ga0307413_100617872 324
539 3300031824 Ga0307413_10076246 Ga0307413_100762462 324
540 3300031901 Ga0307406_10000661 Ga0307406_100006613 324
541 3300031911 Ga0307412_10002986 Ga0307412_100029863 324
542 3300031911 Ga0307412_10008062 Ga0307412_100080622 324
543 3300031911 Ga0307412_10406759 Ga0307412_104067591 324
544 3300031995 Ga0307409_100109085 Ga0307409_1001090852 324
545 3300032002 Ga0307416_100012183 Ga0307416_1000121833 324
546 3300032002 Ga0307416_100100327 Ga0307416_1001003272 324
547 3300032004 Ga0307414_10094954 Ga0307414_100949542 324
548 3300032005 Ga0307411_10051507 Ga0307411_100515072 324
549 3300032005 Ga0307411_10123207 Ga0307411_101232072 324
550 3300041404 Ga0439436_0000461 Ga0439436_0000461_1225_2199 324
551 3300041404 Ga0439436_0016572 Ga0439436_0016572_573_1547 324
552 3300041406 Ga0439439_0004279 Ga0439439_0004279_1360_2334 324
553 3300041411 Ga0439466_0000370 Ga0439466_0000370_1534_2508 324
554 3300041411 Ga0439466_0029204 Ga0439466_0029204_900_1874 324
555 3300041413 Ga0439465_0000199 Ga0439465_0000199_12343_13317 324
556 3300041997 Ga0439431_0000478 Ga0439431_0000478_1752_2726 324
557 3300042004 Ga0439445_0002298 Ga0439445_0002298_1446_2420 324
558 3300042006 Ga0439432_001585 Ga0439432_001585_2510_3484 324
559 3300042007 Ga0439449_0001060 Ga0439449_0001060_363_1337 324
560 3300042007 Ga0439449_0019049 Ga0439449_0019049_920_1939 324
561 3300042007 Ga0439449_0024679 Ga0439449_0024679_128_1102 324
562 3300042010 Ga0439452_001693 Ga0439452_001693_4160_5134 324
563 3300042010 Ga0439452_011220 Ga0439452_011220_685_1659 324
564 3300042014 Ga0439457_013756 Ga0439457_013756_454_1428 324
565 3300042015 Ga0439462_0003937 Ga0439462_0003937_965_1939 324
566 3300042122 Ga0450920_008288 Ga0450920_008288_443_1420 324
567 3300042125 Ga0450923_001454 Ga0450923_001454_217_1194 324
568 3300042134 Ga0450898_007825 Ga0450898_007825_495_1472 324
569 3300042147 Ga0450910_000577 Ga0450910_000577_3324_4301 324
570 3300042156 Ga0439446_0000308 Ga0439446_0000308_1702_2676 324
571 3300042435 Ga0439434_0003511 Ga0439434_0003511_109_1083 324
572 3300042435 Ga0439434_0004467 Ga0439434_0004467_514_1491 324
573 3300042531 Ga0450918_001276 Ga0450918_001276_2490_3467 324
574 3300044842 Ga0466957_0075912 Ga0466957_0075912_566_1585 324
575 3300046453 Ga0495627_002946 Ga0495627_002946_802_1788 324
576 3300046515 Ga0495620_0015248 Ga0495620_0015248_2626_3609 324
577 3300046542 Ga0495597_0000481 Ga0495597_0000481_29614_30603 324
578 3300046660 Ga0495625_0000510 Ga0495625_0000510_19668_20642 324
579 3300046692 Ga0495671_0029485 Ga0495671_0029485_290_1273 324
580 3300048904 Ga0496101_0005762 Ga0496101_0005762_2784_3758 324
581 3300048919 Ga0496116_0016711 Ga0496116_0016711_3815_4789 324
582 3300048919 Ga0496116_0016940 Ga0496116_0016940_3256_4230 324
583 3300048919 Ga0496116_0020933 Ga0496116_0020933_3503_4489 324
584 3300048920 Ga0496117_0034891 Ga0496117_0034891_2159_3133 324
585 3300048921 Ga0496118_0017790 Ga0496118_0017790_4756_5730 324
586 3300048924 Ga0496121_0052422 Ga0496121_0052422_1795_2769 324
587 3300048925 Ga0496122_0039176 Ga0496122_0039176_1536_2522 324
588 3300048927 Ga0496124_0133997 Ga0496124_0133997_710_1684 324
589 3300048927 Ga0496124_0187489 Ga0496124_0187489_412_1386 324
590 3300048928 Ga0496125_0013608 Ga0496125_0013608_5063_6037 324
591 3300049679 Ga0501249_001358 Ga0501249_001358_3792_4811 324
592 3300049705 Ga0501225_0011031 Ga0501225_0011031_804_1823 324
593 3300049759 Ga0501262_000063 Ga0501262_000063_350_1369 324
594 3300050489 nmdc:mga03683_27735_c1 nmdc:mga03683_27735_c1_384_1358 324
595 3300050491 nmdc:mga00v17_39405_c1 nmdc:mga00v17_39405_c1_352_1326 324
596 3300050492 nmdc:mga0yw44_9647_c1 nmdc:mga0yw44_9647_c1_1505_2479 324
597 3300050493 nmdc:mga0k408_22350_c1 nmdc:mga0k408_22350_c1_2344_3318 324
598 3300050493 nmdc:mga0k408_7527_c1 nmdc:mga0k408_7527_c1_906_1880 324
599 3300050496 nmdc:mga07m45_2527_c1 nmdc:mga07m45_2527_c1_4325_5302 324
600 3300050496 nmdc:mga07m45_25445_c1 nmdc:mga07m45_25445_c1_924_1898 324
601 3300050496 nmdc:mga07m45_28479_c1 nmdc:mga07m45_28479_c1_724_1698 324
602 3300050496 nmdc:mga07m45_85981_c1 nmdc:mga07m45_85981_c1_606_1580 324
603 3300053079 Ga0500610_0021134 Ga0500610_0021134_1063_2046 324
604 3300053117 Ga0500593_000457 Ga0500593_000457_7583_8566 324
605 3300053122 Ga0500608_052164 Ga0500608_052164_411_1385 324
606 3300053158 Ga0500627_0023110 Ga0500627_0023110_1225_2208 324
607 iso_pu_bacteria 2929160207 2929161830 324

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

43

305

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9283 27 320
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.9207 27 324
2f5x-assembly3.cif.gz_C structure of periplasmic binding protein bugd 0.9201 27 322
8hkb-assembly1.cif.gz_A tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d 0.9122 26 324
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.9093 26 324
ID Description Score Start End Superfamily
2f5xC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9483 123 246 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9469 121 246 3.40.190.10
2f5xC01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9408 26 322 3.40.190.150
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9396 121 246 3.40.190.10
2f5xC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9331 123 246 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A261UKM0-F1-model_v4 ABC transporter substrate-binding protein 0.961 26 324
AF-A0A1W1YXE8-F1-model_v4 Tripartite-type tricarboxylate transporter, receptor component TctC 0.96 26 319
AF-A0A520H6B6-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9591 22 324
AF-A0A4Q1HQL1-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9579 27 316
AF-A0A1I5K2F1-F1-model_v4 Tripartite-type tricarboxylate transporter, receptor component TctC 0.956 21 324

Feature Viewer

pLDDT pTM Quality
90.18 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map