F468672

General Info

Members Datasets Scaffolds Average Seq Length
607 356 517 810

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100005335|Ga0075434_1000053352
Length 823
Sequence LKREPNTTGIIALVTTFLIPFLLAAIGPAAAQSVTGTLGAPSATTTIQGDQIPAPDPKFGGVIKEDVKDSKTWWPPRVVPPKGXXNVLLILTDDQGYGVSSTFGGVIPTPSVDRIAKAGLRYTQFHSTALCSPSRAALITGRNHHSVGFGIITELATGYPGYNSIIGSENATVGRILQDNGYATSWFGKNHNTPAFQYGAAGPFDQWPSGMGFQYFYGFQGGETDQWKPYLFRDHTQISPWIGKPGYNLTTDMADEAIRYLKEINSSAPDQPFFLYYATGGTHSPHHPTKEWIDKFKGKFDMGWNVMREQIFANQKRLGVIPQNTQLTPWPDDLKKWDALSADEKKLFAHQAEVFAAYAAYTDYEIGRVIQQVEDMGKLDNTIIIYIVGDNGTSPEGTLVGTPNTWAAYNGVLDIPVAEQLKLYNAWGGPDTAPHMAVGWAWAFDTPFKWSKQVASHFGGTRQGMAISWPARIKDTGGVRSQFHHFIDIVPTVLEAAGIKAPDLVNGIKQKPIEGVSMAYTFDKANANAASTRKTQYFEMISNRGIYSDGWYACTTPPVPPWVLNAKMPVPNDYKWELYNTAEDYSQANDLAAKMPDKLKELQAIFLQEAGKYQVLPLDNSSFARAAAPKPSATAGQTVFSYTGVNAGLPAGNAPSVFGRSYSITAEIQVPQGGGNGMIVTQGGHAGGYGLYLLKGKPVFDYNFLALQHFRWEGTQALSAGKHTIGFDFTYDGPGVAKGGTGVLKVDGKVVATRKIPHTVAFLWPRDETFDVGIDTRTPIQDKDYQVPFAFSGKINKLTFNLGPERMLAEDQEKMRAAALKAD

Samples

Sample ID Description Type Environment
1 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
2 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
3 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
4 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
5 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
6 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
7 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
8 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
9 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
10 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
11 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
12 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
13 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
14 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
15 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
16 2643221557 Ensifer sp. Root558 Isolate Unclassified
17 2643221610 Ensifer sp. Root74 Isolate Unclassified
18 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
19 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
20 2643221668 Ensifer sp. Root423 Isolate Unclassified
21 2643221675 Ensifer sp. Root1298 Isolate Unclassified
22 2643221680 Ensifer sp. Root1312 Isolate Unclassified
23 2643221698 Ensifer sp. Root142 Isolate Unclassified
24 2643221718 Rhizobium sp. Root268 Isolate Unclassified
25 2643221723 Ensifer sp. Root278 Isolate Unclassified
26 2643221726 Ensifer sp. Root954 Isolate Unclassified
27 2738543024 Aminobacter sp. AP02 Isolate Unclassified
28 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
29 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
30 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
31 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
32 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
33 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
34 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
35 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
36 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
37 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
38 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
39 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
40 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
41 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
42 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
43 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
44 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
45 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
46 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
47 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
48 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
49 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
50 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
51 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
52 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
53 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
54 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
55 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
56 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
57 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
58 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
59 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
60 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
61 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
62 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
63 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
64 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
65 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
66 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
67 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
68 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
69 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
70 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
71 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
72 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
73 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
74 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
75 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
76 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
77 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
78 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
79 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
80 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
81 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
82 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
83 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
84 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
85 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
86 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
87 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
88 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
89 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
90 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
91 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
92 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
93 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
94 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
95 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
96 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
97 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
98 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
99 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
100 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
101 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
102 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
103 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
104 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
105 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
106 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
107 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
108 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
109 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
110 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
111 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
112 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
113 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
114 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
115 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
116 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
117 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
118 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
119 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
120 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
121 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
122 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
123 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
124 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
125 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
126 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
127 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
128 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
129 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
130 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
131 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
132 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
133 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
134 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
135 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
136 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
137 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
138 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
139 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
140 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
141 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
142 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
143 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
144 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
145 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
146 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
147 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
148 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
149 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
150 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
151 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
152 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
153 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
154 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
155 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
156 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
157 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
158 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
159 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
160 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
161 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
162 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
163 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
164 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
165 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
166 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
167 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
169 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
171 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
174 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
203 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
204 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
206 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
207 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
208 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
209 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
210 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
211 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
212 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
213 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
214 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
216 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
217 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
218 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
219 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
220 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
221 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
222 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
223 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
224 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
225 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
226 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
227 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
228 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
229 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
230 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
231 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
232 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
233 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
234 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
235 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
236 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
237 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
238 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
239 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
240 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
241 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
242 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
243 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
244 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
245 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
246 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
247 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
248 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
249 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
250 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
251 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
252 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
253 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
254 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
255 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
256 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
257 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
258 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
259 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
260 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
261 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
262 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
263 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
264 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
265 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
266 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
267 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
268 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
269 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
270 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
271 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
272 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
273 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
274 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
275 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
276 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
277 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
278 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
279 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
280 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
281 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
282 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
283 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
284 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
285 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
286 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
287 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
288 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
289 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
290 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
291 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
292 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
293 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
294 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
295 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
296 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
297 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
298 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
299 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
300 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
301 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
302 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
303 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
304 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
305 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
306 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
307 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
308 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
309 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
310 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
311 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
312 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
313 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
314 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
315 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
316 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
322 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
323 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
324 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
325 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
326 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
327 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
328 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
329 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
330 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
331 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
332 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
333 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
334 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
335 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
336 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
337 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
338 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
339 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
340 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
341 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
342 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
343 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
344 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
345 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
346 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
347 8005258706 Rhizobium sp. R693 Isolate Nodule
348 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
349 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
350 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
351 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
352 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
353 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
354 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
355 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
356 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.45
Metatranscriptomes 0
Isolates 14.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.63
Nodule 9.88
Rhizoplane 6.26
Rhizosphere 59.14
Stem 0
Stem Tuber 0
Unclassified 7.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1002046 3300002739 Bacteria 3389
2 JGI25158J39367_1002298 3300002739 Bacteria 3150
3 JGI25152J39213_1000013 3300002773 Bacteria 123999
4 JGI25152J39213_1002854 3300002773 Bacteria 6187
5 JGI25159J45721_1000028 3300002987 Bacteria 111628
6 JGI25159J45721_1000084 3300002987 Bacteria 44908
7 JGI25159J45721_1000096 3300002987 Bacteria 41782
8 JGI25159J45721_1000150 3300002987 Bacteria 32467
9 JGI25151J46595_10010758 3300003187 Bacteria 4234
10 JGI25153J46596_10000068 3300003215 Bacteria 117909
11 JGI25153J46596_10002867 3300003215 Bacteria 9796
12 JGI25153J46596_10006097 3300003215 Bacteria 6187
13 JGI25153J46596_10007865 3300003215 Bacteria 5175
14 rootH1_10099016 3300003323 Bacteria 3273
15 JGI25160J50197_1000024 3300003354 Bacteria 189526
16 JGI25160J50197_1000030 3300003354 Bacteria 177919
17 JGI25160J50197_1000070 3300003354 Bacteria 110748
18 JGI25160J50197_1000747 3300003354 Bacteria 17687
19 JGI25160J50197_1003091 3300003354 Bacteria 7594
20 JGI25161J50226_1000016 3300003374 Bacteria 177919
21 JGI25161J50226_1000026 3300003374 Bacteria 146134
22 JGI25161J50226_1000369 3300003374 Bacteria 22940
23 Ga0055526_1000399 3300003771 Bacteria 35090
24 Ga0055526_1001038 3300003771 Bacteria 20299
25 Ga0055526_1001323 3300003771 Bacteria 17731
26 Ga0055524_1003933 3300003775 Bacteria 7034
27 Ga0055524_1014996 3300003775 Bacteria 2845
28 Ga0055536_1006853 3300003781 Bacteria 5207
29 Ga0055528_1007774 3300003790 Bacteria 4691
30 Ga0055530_10007038 3300003791 Bacteria 4838
31 Ga0055540_1000581 3300003792 Bacteria 26766
32 Ga0055531_10005540 3300003794 Bacteria 7370
33 Ga0055531_10015755 3300003794 Bacteria 3307
34 Ga0055543_1000006 3300004625 Bacteria 214206
35 Ga0055543_1000013 3300004625 Bacteria 179052
36 Ga0055543_1000042 3300004625 Bacteria 117438
37 Ga0065165_1000098 3300005262 Bacteria 144210
38 Ga0065165_1000215 3300005262 Bacteria 100238
39 Ga0065165_1000512 3300005262 Bacteria 59678
40 Ga0070683_100073799 3300005329 Bacteria 3185
41 Ga0070670_100000923 3300005331 Bacteria 23070
42 Ga0070680_100074375 3300005336 Bacteria 2796
43 Ga0070682_100010588 3300005337 Bacteria 5237
44 Ga0068868_100011942 3300005338 Bacteria 6336
45 Ga0070668_100028494 3300005347 Bacteria 4239
46 Ga0070671_100005188 3300005355 Bacteria 10379
47 Ga0070671_100046545 3300005355 Bacteria 3607
48 Ga0070671_100074389 3300005355 Bacteria 2839
49 Ga0070673_100051863 3300005364 Bacteria 3216
50 Ga0070688_100040982 3300005365 Bacteria 2840
51 Ga0070667_100057784 3300005367 Bacteria 3279
52 Ga0070667_100063374 3300005367 Bacteria 3132
53 Ga0070709_10000960 3300005434 Bacteria 16007
54 Ga0070714_100021419 3300005435 Bacteria 5290
55 Ga0070713_100000019 3300005436 Bacteria 110100
56 Ga0070710_10000707 3300005437 Bacteria 15878
57 Ga0070711_100002547 3300005439 Bacteria 10429
58 Ga0070663_100026269 3300005455 Bacteria 3942
59 Ga0070678_100020893 3300005456 Bacteria 4304
60 Ga0070662_100018941 3300005457 Bacteria 4664
61 Ga0070685_10008616 3300005466 Bacteria 5250
62 Ga0070706_100000310 3300005467 Bacteria 59185
63 Ga0070707_100026954 3300005468 Bacteria 5463
64 Ga0070698_100062541 3300005471 Bacteria 3755
65 Ga0070679_100024135 3300005530 Bacteria 5958
66 Ga0068853_100078579 3300005539 Bacteria 2884
67 Ga0070672_100026269 3300005543 Bacteria 4330
68 Ga0070665_100060132 3300005548 Bacteria 3809
69 Ga0068855_100072017 3300005563 Bacteria 4018
70 Ga0068856_100098812 3300005614 Bacteria 2909
71 Ga0068864_100002194 3300005618 Bacteria 16105
72 Ga0068864_100010094 3300005618 Bacteria 7797
73 Ga0068864_100040214 3300005618 Bacteria 4000
74 Ga0068858_100013298 3300005842 Bacteria 7760
75 Ga0068858_100053435 3300005842 Bacteria 3737
76 Ga0081455_10005203 3300005937 Bacteria 14313
77 Ga0081540_1002854 3300005983 Bacteria 13991
78 Ga0081540_1004950 3300005983 Bacteria 10015
79 Ga0075365_10004247 3300006038 Bacteria 7555
80 Ga0075365_10008695 3300006038 Bacteria 5783
81 Ga0075363_100001010 3300006048 Bacteria 10081
82 Ga0075364_10013238 3300006051 Bacteria 5064
83 Ga0070716_100035911 3300006173 Bacteria 2729
84 Ga0075362_10004104 3300006177 Bacteria 5192
85 Ga0075367_10002764 3300006178 Bacteria 8128
86 Ga0075367_10013628 3300006178 Bacteria 4378
87 Ga0075369_10005504 3300006186 Bacteria 4736
88 Ga0075366_10012428 3300006195 Bacteria 4830
89 Ga0097621_100037415 3300006237 Bacteria 3888
90 Ga0075370_10014634 3300006353 Bacteria 4189
91 Ga0068871_100031301 3300006358 Bacteria 4195
92 Ga0075428_100026600 3300006844 Bacteria 6405
93 Ga0075430_100003912 3300006846 Bacteria 12558
94 Ga0075430_100054617 3300006846 Bacteria 3360
95 Ga0075431_100057533 3300006847 Bacteria 4010
96 Ga0075433_10004647 3300006852 Bacteria 10711
97 Ga0075433_10018913 3300006852 Bacteria 5734
98 Ga0075434_100005335 3300006871 Bacteria 11697
99 Ga0075434_100049889 3300006871 Bacteria 4156
100 Ga0075434_100071286 3300006871 Bacteria 3466
101 Ga0075434_100080340 3300006871 Bacteria 3257
102 Ga0075429_100001943 3300006880 Bacteria 17164
103 Ga0068865_100032142 3300006881 Bacteria 3504
104 Ga0075436_100015229 3300006914 Bacteria 5266
105 Ga0111539_10001365 3300009094 Bacteria 32515
106 Ga0111539_10007890 3300009094 Bacteria 13583
107 Ga0111539_10011994 3300009094 Bacteria 10865
108 Ga0114129_10015988 3300009147 Bacteria 10671
109 Ga0114129_10125743 3300009147 Bacteria 3525
110 Ga0105248_10029406 3300009177 Bacteria 6129
111 Ga0105248_10098856 3300009177 Bacteria 3288
112 Ga0105237_10018146 3300009545 Bacteria 7286
113 Ga0105237_10089162 3300009545 Bacteria 3074
114 Ga0105238_10052441 3300009551 Bacteria 4100
115 Ga0105249_10008119 3300009553 Bacteria 9152
116 Ga0105249_10008159 3300009553 Bacteria 9129
117 Ga0105246_10032801 3300011119 Bacteria 3447
118 Ga0157369_10073295 3300013105 Bacteria 3674
119 Ga0171462_1035 3300013250 Bacteria 84676
120 Ga0157374_10044954 3300013296 Bacteria 4085
121 Ga0157374_10079103 3300013296 Bacteria 3115
122 Ga0157378_10001000 3300013297 Bacteria 25901
123 Ga0157378_10018240 3300013297 Bacteria 6160
124 Ga0157375_10010353 3300013308 Bacteria 8210
125 Ga0157375_10032953 3300013308 Bacteria 4918
126 Ga0157375_10104611 3300013308 Bacteria 2920
127 Ga0163163_10001266 3300014325 Bacteria 21327
128 Ga0157379_10033729 3300014968 Bacteria 4566
129 Ga0157379_10067134 3300014968 Bacteria 3207
130 Ga0157376_10025100 3300014969 Bacteria 4691
131 Ga0157376_10025854 3300014969 Bacteria 4629
132 Ga0163161_10024023 3300017792 Bacteria 4302
133 Ga0209436_100036 3300025208 Bacteria 78433
134 Ga0209436_100546 3300025208 Bacteria 16285
135 Ga0207425_1000558 3300025245 Bacteria 22120
136 Ga0207425_1004717 3300025245 Bacteria 4022
137 Ga0209129_1000092 3300025258 Bacteria 173874
138 Ga0209129_1001034 3300025258 Bacteria 16520
139 Ga0209129_1008186 3300025258 Bacteria 2955
140 Ga0209673_1000987 3300025273 Bacteria 34806
141 Ga0209673_1001100 3300025273 Bacteria 30309
142 Ga0209130_1000026 3300025284 Bacteria 334058
143 Ga0209130_1000053 3300025284 Bacteria 214421
144 Ga0209130_1000073 3300025284 Bacteria 174439
145 Ga0209676_1001596 3300025292 Bacteria 20164
146 Ga0209676_1004369 3300025292 Bacteria 7910
147 Ga0209025_1000216 3300025294 Bacteria 138307
148 Ga0209025_1000687 3300025294 Bacteria 58005
149 Ga0209025_1003666 3300025294 Bacteria 14206
150 Ga0209025_1011005 3300025294 Bacteria 6035
151 Ga0209564_1000013 3300025295 Bacteria 775755
152 Ga0209564_1000025 3300025295 Bacteria 520535
153 Ga0209564_1000168 3300025295 Bacteria 158368
154 Ga0209564_1001142 3300025295 Bacteria 31132
155 Ga0209564_1002632 3300025295 Bacteria 13722
156 Ga0209564_1012848 3300025295 Bacteria 3610
157 Ga0209758_1000097 3300025297 Bacteria 230529
158 Ga0209758_1000201 3300025297 Bacteria 132855
159 Ga0209758_1001011 3300025297 Bacteria 37221
160 Ga0209758_1003552 3300025297 Bacteria 14024
161 Ga0209758_1004462 3300025297 Bacteria 11631
162 Ga0209758_1024239 3300025297 Bacteria 2710
163 Ga0209050_1005529 3300025298 Bacteria 7897
164 Ga0209256_1000042 3300025299 Bacteria 341821
165 Ga0209256_1000745 3300025299 Bacteria 42627
166 Ga0209256_1001217 3300025299 Bacteria 28683
167 Ga0209256_1001718 3300025299 Bacteria 21008
168 Ga0209256_1002173 3300025299 Bacteria 16844
169 Ga0207426_1000006 3300025302 Bacteria 1025969
170 Ga0207426_1000054 3300025302 Bacteria 384435
171 Ga0207426_1000140 3300025302 Bacteria 195664
172 Ga0207426_1000422 3300025302 Bacteria 69436
173 Ga0209051_1000922 3300025303 Bacteria 29178
174 Ga0209257_1003319 3300025304 Bacteria 13934
175 Ga0209257_1003613 3300025304 Bacteria 13032
176 Ga0209257_1007517 3300025304 Bacteria 6548
177 Ga0207697_10003332 3300025315 Bacteria 7991
178 Ga0207697_10017888 3300025315 Bacteria 2910
179 Ga0207692_10001398 3300025898 Bacteria 9032
180 Ga0207647_10005165 3300025904 Bacteria 9600
181 Ga0207699_10000740 3300025906 Bacteria 15576
182 Ga0207684_10000086 3300025910 Bacteria 173807
183 Ga0207707_10007529 3300025912 Bacteria 9487
184 Ga0207693_10021115 3300025915 Bacteria 5176
185 Ga0207657_10007376 3300025919 Bacteria 11280
186 Ga0207652_10090454 3300025921 Bacteria 2689
187 Ga0207650_10015851 3300025925 Bacteria 5257
188 Ga0207659_10051860 3300025926 Bacteria 2920
189 Ga0207700_10000832 3300025928 Bacteria 17842
190 Ga0207664_10009868 3300025929 Bacteria 6721
191 Ga0207644_10026133 3300025931 Bacteria 4021
192 Ga0207706_10002082 3300025933 Bacteria 19571
193 Ga0207704_10012628 3300025938 Bacteria 4196
194 Ga0207691_10004168 3300025940 Bacteria 14051
195 Ga0207691_10009787 3300025940 Bacteria 9202
196 Ga0207711_10057396 3300025941 Bacteria 3347
197 Ga0207651_10057087 3300025960 Bacteria 2690
198 Ga0207658_10027552 3300025986 Bacteria 3993
199 Ga0207658_10048056 3300025986 Bacteria 3127
200 Ga0207639_10044436 3300026041 Bacteria 3341
201 Ga0207639_10082242 3300026041 Bacteria 2552
202 Ga0207678_10006428 3300026067 Bacteria 10427
203 Ga0207708_10018120 3300026075 Bacteria 5299
204 Ga0207641_10050039 3300026088 Bacteria 3534
205 Ga0207641_10076581 3300026088 Bacteria 2892
206 Ga0207676_10031202 3300026095 Bacteria 4006
207 Ga0207683_10009340 3300026121 Bacteria 8353
208 Ga0207683_10055858 3300026121 Bacteria 3463
209 Ga0209813_10002631 3300027866 Bacteria 4127
210 Ga0207428_10000295 3300027907 Bacteria 66554
211 Ga0207428_10000617 3300027907 Bacteria 42011
212 Ga0268266_10013089 3300028379 Bacteria 7153
213 Ga0268266_10020437 3300028379 Bacteria 5644
214 Ga0268266_10022040 3300028379 Bacteria 5430
215 Ga0268266_10024482 3300028379 Bacteria 5133
216 Ga0268266_10071330 3300028379 Bacteria 3011
217 Ga0265332_10002582 3300031238 Bacteria 9171
218 Ga0265332_10007407 3300031238 Bacteria 4963
219 Ga0265328_10000008 3300031239 Bacteria 208282
220 Ga0265331_10000677 3300031250 Bacteria 29251
221 Ga0265331_10001549 3300031250 Bacteria 16860
222 Ga0265316_10035969 3300031344 Bacteria 4006
223 Ga0265314_10000180 3300031711 Bacteria 93446
224 Ga0307507_10027504 3300033179 Bacteria 6095
225 Ga0373950_0001379 3300034818 Bacteria 3158
226 Ga0373928_0000205 3300035084 Bacteria 11403
227 Ga0373934_0004006 3300035086 Bacteria 5423
228 Ga0373923_0002711 3300035111 Bacteria 5518
229 Ga0373923_0013338 3300035111 Bacteria 3061
230 Ga0373936_0009011 3300035113 Bacteria 3764
231 Ga0373936_0013811 3300035113 Bacteria 3082
232 Ga0373954_0001334 3300035118 Bacteria 9959
233 Ga0373943_0007985 3300035170 Bacteria 4749
234 Ga0373946_0004801 3300035171 Bacteria 4865
235 Ga0373955_0000697 3300035172 Bacteria 14439
236 Ga0373955_0011352 3300035172 Bacteria 4242
237 Ga0373942_0000855 3300035207 Bacteria 8347
238 Ga0373924_0000297 3300035410 Bacteria 15359
239 Ga0373935_0000530 3300035692 Bacteria 19893
240 Ga0373935_0015913 3300035692 Bacteria 4551
241 Ga0373935_0017301 3300035692 Bacteria 4371
242 Ga0373927_0008161 3300035695 Bacteria 7063
243 Ga0373927_0010378 3300035695 Bacteria 6215
244 Ga0373927_0011463 3300035695 Bacteria 5906
245 Ga0373927_0012137 3300035695 Bacteria 5732
246 Ga0373927_0013159 3300035695 Bacteria 5502
247 Ga0373927_0035362 3300035695 Bacteria 3249
248 Ga0373933_0016324 3300035724 Bacteria 4149
249 Ga0373933_0024958 3300035724 Bacteria 3425
250 Ga0373933_0025655 3300035724 Bacteria 3381
251 Ga0373933_0030307 3300035724 Bacteria 3132
252 Ga0373947_0008557 3300035725 Bacteria 5895
253 Ga0373947_0019090 3300035725 Bacteria 3951
254 Ga0373947_0019673 3300035725 Bacteria 3893
255 Ga0373937_0000212 3300036401 Bacteria 55966
256 Ga0373937_0017964 3300036401 Bacteria 6310
257 Ga0373937_0026718 3300036401 Bacteria 5216
258 Ga0373937_0037204 3300036401 Bacteria 4435
259 Ga0373937_0048967 3300036401 Bacteria 3869
260 Ga0373937_0057422 3300036401 Bacteria 3575
261 Ga0373925_0000002 3300037068 Bacteria 368879
262 Ga0373925_0010354 3300037068 Bacteria 6766
263 Ga0373925_0013980 3300037068 Bacteria 5810
264 Ga0439435_0001707 3300042436 Bacteria 4156
265 Ga0495617_001237 3300046452 Bacteria 11483
266 Ga0495617_011632 3300046452 Bacteria 3001
267 Ga0495592_0000265 3300046454 Bacteria 44816
268 Ga0495592_0006181 3300046454 Bacteria 8904
269 Ga0495592_0036151 3300046454 Bacteria 3720
270 Ga0495592_0046575 3300046454 Bacteria 3232
271 Ga0495592_0069374 3300046454 Bacteria 2570
272 Ga0495603_0001888 3300046455 Bacteria 12365
273 Ga0495603_0002303 3300046455 Bacteria 11201
274 Ga0495603_0015277 3300046455 Bacteria 4645
275 Ga0495629_0003568 3300046459 Bacteria 11757
276 Ga0495629_0003923 3300046459 Bacteria 11192
277 Ga0495629_0005037 3300046459 Bacteria 9890
278 Ga0495629_0005264 3300046459 Bacteria 9667
279 Ga0495638_0017476 3300046460 Bacteria 4778
280 Ga0495638_0021610 3300046460 Bacteria 4238
281 Ga0495641_0007689 3300046461 Bacteria 6688
282 Ga0495651_0009124 3300046462 Bacteria 7613
283 Ga0495651_0022384 3300046462 Bacteria 4911
284 Ga0495651_0042031 3300046462 Bacteria 3550
285 Ga0495653_0000006 3300046463 Bacteria 363285
286 Ga0495653_0004185 3300046463 Bacteria 11679
287 Ga0495653_0010838 3300046463 Bacteria 7461
288 Ga0495653_0014196 3300046463 Bacteria 6494
289 Ga0495580_0047627 3300046472 Bacteria 3038
290 Ga0495582_0000872 3300046473 Bacteria 16728
291 Ga0495582_0003363 3300046473 Bacteria 8998
292 Ga0495605_0020467 3300046474 Bacteria 3515
293 Ga0495639_0000050 3300046475 Bacteria 52004
294 Ga0495639_0002172 3300046475 Bacteria 8642
295 Ga0495664_0000002 3300046477 Bacteria 625183
296 Ga0495664_0000950 3300046477 Bacteria 14867
297 Ga0495664_0001919 3300046477 Bacteria 11064
298 Ga0495664_0029321 3300046477 Bacteria 3217
299 Ga0495585_0000002 3300046492 Bacteria 529316
300 Ga0495585_0014605 3300046492 Bacteria 4570
301 Ga0495594_0000188 3300046499 Bacteria 30049
302 Ga0495594_0005188 3300046499 Bacteria 6694
303 Ga0495594_0025224 3300046499 Bacteria 3196
304 Ga0495594_0026764 3300046499 Bacteria 3104
305 Ga0495607_0028572 3300046501 Bacteria 3440
306 Ga0495606_0009716 3300046507 Bacteria 8094
307 Ga0495608_0000006 3300046511 Bacteria 324334
308 Ga0495608_0002502 3300046511 Bacteria 13180
309 Ga0495610_0026877 3300046512 Bacteria 3067
310 Ga0495616_0000435 3300046513 Bacteria 31918
311 Ga0495618_0003968 3300046514 Bacteria 9121
312 Ga0495620_0015854 3300046515 Bacteria 3794
313 Ga0495628_0000002 3300046516 Bacteria 589399
314 Ga0495628_0000947 3300046516 Bacteria 26620
315 Ga0495628_0009155 3300046516 Bacteria 8466
316 Ga0495628_0070846 3300046516 Bacteria 2717
317 Ga0495630_0001748 3300046517 Bacteria 15160
318 Ga0495630_0004873 3300046517 Bacteria 9425
319 Ga0495630_0022073 3300046517 Bacteria 4703
320 Ga0495632_0005365 3300046519 Bacteria 8486
321 Ga0495632_0022507 3300046519 Bacteria 3377
322 Ga0495643_0004425 3300046522 Bacteria 9830
323 Ga0495643_0021984 3300046522 Bacteria 3647
324 Ga0495648_0000027 3300046524 Bacteria 228881
325 Ga0495666_0008910 3300046526 Bacteria 5023
326 Ga0495666_0014738 3300046526 Bacteria 3890
327 Ga0495652_0000004 3300046529 Bacteria 588877
328 Ga0495652_0017613 3300046529 Bacteria 6373
329 Ga0495665_0000633 3300046531 Bacteria 17923
330 Ga0495640_0000007 3300046533 Bacteria 265481
331 Ga0495640_0019774 3300046533 Bacteria 4967
332 Ga0495587_0000031 3300046536 Bacteria 126721
333 Ga0495587_0002337 3300046536 Bacteria 12681
334 Ga0495597_0016242 3300046542 Bacteria 3517
335 Ga0495645_0000003 3300046543 Bacteria 570133
336 Ga0495645_0001020 3300046543 Bacteria 19062
337 Ga0495645_0011042 3300046543 Bacteria 6347
338 Ga0495622_0007507 3300046557 Bacteria 5057
339 Ga0495667_0000002 3300046559 Bacteria 437535
340 Ga0495667_0003031 3300046559 Bacteria 11259
341 Ga0495667_0023602 3300046559 Bacteria 4142
342 Ga0495667_0057081 3300046559 Bacteria 2567
343 Ga0495668_0028076 3300046616 Bacteria 3184
344 Ga0495668_0033273 3300046616 Bacteria 2897
345 Ga0495634_0000110 3300046642 Bacteria 68101
346 Ga0495634_0004421 3300046642 Bacteria 11043
347 Ga0495634_0015185 3300046642 Bacteria 5536
348 Ga0495634_0016980 3300046642 Bacteria 5199
349 Ga0495634_0018629 3300046642 Bacteria 4939
350 Ga0495625_0012872 3300046660 Bacteria 6760
351 Ga0495625_0033102 3300046660 Bacteria 3825
352 Ga0495635_0000022 3300046663 Bacteria 160907
353 Ga0495635_0006695 3300046663 Bacteria 8051
354 Ga0495635_0017839 3300046663 Bacteria 4958
355 Ga0495635_0032096 3300046663 Bacteria 3645
356 Ga0495657_0017770 3300046675 Bacteria 5160
357 Ga0495657_0028945 3300046675 Bacteria 3889
358 Ga0495599_0000001 3300046678 Bacteria 537563
359 Ga0495599_0001370 3300046678 Bacteria 13928
360 Ga0495623_0000898 3300046679 Bacteria 20166
361 Ga0495623_0004031 3300046679 Bacteria 9670
362 Ga0495623_0018438 3300046679 Bacteria 4508
363 Ga0495623_0032994 3300046679 Bacteria 3324
364 Ga0495646_0000007 3300046680 Bacteria 236764
365 Ga0495646_0008837 3300046680 Bacteria 6397
366 Ga0495646_0009206 3300046680 Bacteria 6266
367 Ga0495646_0009994 3300046680 Bacteria 6033
368 Ga0495647_0005827 3300046681 Bacteria 4053
369 Ga0495658_0002136 3300046683 Bacteria 10008
370 Ga0495658_0002208 3300046683 Bacteria 9833
371 Ga0495658_0038430 3300046683 Bacteria 2651
372 Ga0495613_0003912 3300046689 Bacteria 11148
373 Ga0495613_0012480 3300046689 Bacteria 6314
374 Ga0495613_0019573 3300046689 Bacteria 5045
375 Ga0495613_0047848 3300046689 Bacteria 3159
376 Ga0495624_0043348 3300046690 Bacteria 2871
377 Ga0495670_0011974 3300046691 Bacteria 4268
378 Ga0495649_0025500 3300046694 Bacteria 3293
379 Ga0495600_0000125 3300046809 Bacteria 42880
380 Ga0495600_0001803 3300046809 Bacteria 11979
381 Ga0495600_0003788 3300046809 Bacteria 8953
382 Ga0495581_0000795 3300047315 Bacteria 16747
383 Ga0495581_0001958 3300047315 Bacteria 11534
384 Ga0495581_0014167 3300047315 Bacteria 4622
385 Ga0495604_0000005 3300047317 Bacteria 424516
386 Ga0495604_0007075 3300047317 Bacteria 8897
387 Ga0495674_0000003 3300047319 Bacteria 562126
388 Ga0495674_0002358 3300047319 Bacteria 18511
389 Ga0495674_0015624 3300047319 Bacteria 7088
390 Ga0495674_0039982 3300047319 Bacteria 4198
391 Ga0495674_0040605 3300047319 Bacteria 4160
392 Ga0495674_0041981 3300047319 Bacteria 4083
393 Ga0495674_0069898 3300047319 Bacteria 3035
394 Ga0495676_0068223 3300047321 Bacteria 2749
395 Ga0495680_0000091 3300047322 Bacteria 81622
396 Ga0495680_0004150 3300047322 Bacteria 13926
397 Ga0495680_0014800 3300047322 Bacteria 6745
398 Ga0495680_0047607 3300047322 Bacteria 3371
399 Ga0495683_0007912 3300047323 Bacteria 5705
400 Ga0495683_0018885 3300047323 Bacteria 3559
401 Ga0495687_015779 3300047443 Bacteria 3825
402 Ga0495687_019926 3300047443 Bacteria 3279
403 Ga0495675_0000133 3300047444 Bacteria 52544
404 Ga0495675_0000296 3300047444 Bacteria 35737
405 Ga0495684_0000035 3300047471 Bacteria 107768
406 Ga0495684_0000802 3300047471 Bacteria 25504
407 Ga0495684_0004284 3300047471 Bacteria 11135
408 Ga0495684_0052708 3300047471 Bacteria 3104
409 Ga0495686_0006603 3300047472 Bacteria 8844
410 Ga0495593_0000019 3300047673 Bacteria 74042
411 Ga0495593_0000746 3300047673 Bacteria 18929
412 Ga0495593_0006779 3300047673 Bacteria 6705
413 Ga0495593_0007459 3300047673 Bacteria 6398
414 Ga0495593_0013724 3300047673 Bacteria 4614
415 Ga0495602_0000029 3300048088 Bacteria 142344
416 Ga0495602_0000841 3300048088 Bacteria 29570
417 Ga0495602_0007519 3300048088 Bacteria 11395
418 Ga0496101_0040511 3300048904 Bacteria 3317
419 Ga0496102_0004518 3300048905 Bacteria 11754
420 Ga0496102_0019986 3300048905 Bacteria 5908
421 Ga0496102_0073494 3300048905 Bacteria 3142
422 Ga0496103_0018879 3300048906 Bacteria 4140
423 Ga0496104_0055904 3300048907 Bacteria 3731
424 Ga0496105_0003969 3300048908 Bacteria 11068
425 Ga0496105_0019114 3300048908 Bacteria 5522
426 Ga0496105_0040965 3300048908 Bacteria 3817
427 Ga0496105_0044584 3300048908 Bacteria 3658
428 Ga0496106_0004225 3300048909 Bacteria 10690
429 Ga0496106_0005089 3300048909 Bacteria 9734
430 Ga0496106_0047652 3300048909 Bacteria 3226
431 Ga0496108_0003134 3300048911 Bacteria 13290
432 Ga0496108_0009850 3300048911 Bacteria 7743
433 Ga0496108_0041025 3300048911 Bacteria 3861
434 Ga0496108_0092643 3300048911 Bacteria 2570
435 Ga0496109_0001422 3300048912 Bacteria 19864
436 Ga0496109_0036600 3300048912 Bacteria 4430
437 Ga0496110_0003153 3300048913 Bacteria 12538
438 Ga0496110_0006506 3300048913 Bacteria 9270
439 Ga0496110_0033371 3300048913 Bacteria 4452
440 Ga0496111_0021181 3300048914 Bacteria 4536
441 Ga0496111_0027292 3300048914 Bacteria 4038
442 Ga0496112_0019401 3300048915 Bacteria 6418
443 Ga0496112_0019691 3300048915 Bacteria 6377
444 Ga0496112_0026604 3300048915 Bacteria 5571
445 Ga0496113_0013051 3300048916 Bacteria 5609
446 Ga0496113_0015645 3300048916 Bacteria 5223
447 Ga0496113_0028267 3300048916 Bacteria 4031
448 Ga0496114_0047564 3300048917 Bacteria 3568
449 Ga0496115_0001086 3300048918 Bacteria 19681
450 Ga0496115_0004676 3300048918 Bacteria 9921
451 Ga0496115_0005104 3300048918 Bacteria 9545
452 Ga0496115_0012357 3300048918 Bacteria 6422
453 Ga0496115_0040353 3300048918 Bacteria 3710
454 Ga0496115_0042964 3300048918 Bacteria 3603
455 Ga0496116_0010501 3300048919 Bacteria 7750
456 Ga0496117_0034954 3300048920 Bacteria 3780
457 Ga0496118_0009186 3300048921 Bacteria 10037
458 Ga0496119_0004579 3300048922 Bacteria 13664
459 Ga0496119_0008582 3300048922 Bacteria 8954
460 Ga0496119_0010170 3300048922 Bacteria 7943
461 Ga0496121_0014946 3300048924 Bacteria 8177
462 Ga0496121_0018669 3300048924 Bacteria 6980
463 Ga0496121_0022894 3300048924 Bacteria 6038
464 Ga0496122_0001001 3300048925 Bacteria 50171
465 Ga0496122_0062000 3300048925 Bacteria 2740
466 Ga0496123_0001664 3300048926 Bacteria 29821
467 Ga0496123_0013783 3300048926 Bacteria 6750
468 Ga0496124_0012606 3300048927 Bacteria 8320
469 Ga0496125_0015046 3300048928 Bacteria 7512
470 Ga0496125_0019843 3300048928 Bacteria 6324
471 Ga0496126_0011403 3300048929 Bacteria 9205
472 Ga0496126_0017772 3300048929 Bacteria 7078
473 Ga0496126_0027718 3300048929 Bacteria 5406
474 Ga0501031_0004898 3300049568 Bacteria 8701
475 Ga0501037_0028130 3300049573 Bacteria 4152
476 Ga0501043_0015956 3300049579 Bacteria 5888
477 Ga0501046_0035925 3300049580 Bacteria 3990
478 Ga0501035_0013041 3300049822 Bacteria 7669
479 Ga0501044_0054427 3300049823 Bacteria 4113
480 nmdc:mga03n38_10051_c1 3300050490 Bacteria 3466
481 nmdc:mga00v17_12514_c1 3300050491 Bacteria 4684
482 nmdc:mga0yw44_4960_c1 3300050492 Bacteria 4371
483 nmdc:mga0yw44_5572_c1 3300050492 Bacteria 5974
484 nmdc:mga0k408_14578_c1 3300050493 Bacteria 4335
485 nmdc:mga05p37_1811_c1 3300050507 Bacteria 24908
486 nmdc:mga09592_1420_c1 3300050508 Bacteria 19222
487 nmdc:mga0qj67_36388_c1 3300050509 Bacteria 3851
488 nmdc:mga0qj67_52263_c1 3300050509 Bacteria 3233
489 nmdc:mga06r32_47426_c1 3300050510 Bacteria 4104
490 nmdc:mga08y16_2249_c1 3300050511 Bacteria 19797
491 nmdc:mga0n895_105170_c1 3300050512 Bacteria 2835
492 nmdc:mga0n895_3688_c1 3300050512 Bacteria 12376
493 nmdc:mga0n895_49864_c1 3300050512 Bacteria 4104
494 nmdc:mga0rr50_187_c1 3300050513 Bacteria 33900
495 nmdc:mga0sz30_15256_c1 3300050516 Bacteria 3034
496 Ga0495601_0000008 3300053077 Bacteria 362152
497 Ga0495601_0018776 3300053077 Bacteria 4210
498 Ga0495601_0021516 3300053077 Bacteria 3950
499 Ga0495612_0002930 3300053078 Bacteria 7077
500 Ga0495595_0000024 3300053084 Bacteria 108008
501 Ga0495595_0001058 3300053084 Bacteria 10640
502 Ga0495619_0000002 3300053085 Bacteria 530226
503 Ga0495619_0000897 3300053085 Bacteria 19498
504 Ga0495619_0001133 3300053085 Bacteria 17513
505 Ga0495619_0003483 3300053085 Bacteria 10158
506 Ga0495619_0003580 3300053085 Bacteria 10014
507 Ga0495619_0014391 3300053085 Bacteria 4995
508 Ga0495619_0042965 3300053085 Bacteria 2962
509 Ga0500578_0028264 3300053086 Bacteria 3603
510 Ga0500651_0011414 3300053093 Bacteria 5355
511 Ga0500562_004388 3300053108 Bacteria 3570
512 Ga0500595_010772 3300053119 Bacteria 3614
513 Ga0500658_0000130 3300053134 Bacteria 35446
514 Ga0500658_0008142 3300053134 Bacteria 3876
515 Ga0500577_0007034 3300053142 Bacteria 3137
516 Ga0500622_0000228 3300053156 Bacteria 58436
517 Ga0501082_0071868 3300060353 Bacteria 2980

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005842 Ga0068858_100013298 Ga0068858_1000132986 670
2 3300009147 Ga0114129_10015988 Ga0114129_100159886 705
3 3300046559 Ga0495667_0057081 Ga0495667_0057081_46_2280 708
4 3300048911 Ga0496108_0092643 Ga0496108_0092643_248_2533 708
5 3300005436 Ga0070713_100000019 Ga0070713_10000001995 711
6 3300025928 Ga0207700_10000832 Ga0207700_1000083214 711
7 3300005618 Ga0068864_100040214 Ga0068864_1000402143 715
8 3300014969 Ga0157376_10025100 Ga0157376_100251002 715
9 3300028379 Ga0268266_10024482 Ga0268266_100244823 715
10 3300035695 Ga0373927_0012137 Ga0373927_0012137_2302_4590 717
11 3300046459 Ga0495629_0005264 Ga0495629_0005264_2856_5144 717
12 3300046683 Ga0495658_0002208 Ga0495658_0002208_3988_6276 717
13 3300046689 Ga0495613_0003912 Ga0495613_0003912_8543_10831 717
14 3300047673 Ga0495593_0006779 Ga0495593_0006779_3811_6099 717
15 3300053085 Ga0495619_0001133 Ga0495619_0001133_10157_12445 717
16 3300047319 Ga0495674_0069898 Ga0495674_0069898_612_2969 725
17 3300042436 Ga0439435_0001707 Ga0439435_0001707_496_3015 735
18 3300035086 Ga0373934_0004006 Ga0373934_0004006_162_2663 737
19 3300025921 Ga0207652_10090454 Ga0207652_100904541 739
20 3300026067 Ga0207678_10006428 Ga0207678_100064283 739
21 3300026075 Ga0207708_10018120 Ga0207708_100181205 739
22 3300034818 Ga0373950_0001379 Ga0373950_0001379_384_2828 739
23 3300048914 Ga0496111_0021181 Ga0496111_0021181_894_3338 739
24 3300025912 Ga0207707_10007529 Ga0207707_100075292 741
25 3300053156 Ga0500622_0000228 Ga0500622_0000228_2260_4719 741
26 iso_pu_bacteria 2849076700 2849079304 741
27 3300025938 Ga0207704_10012628 Ga0207704_100126281 742
28 3300005983 Ga0081540_1004950 Ga0081540_10049507 743
29 3300046501 Ga0495607_0028572 Ga0495607_0028572_240_2681 743
30 3300046515 Ga0495620_0015854 Ga0495620_0015854_337_2778 743
31 3300046522 Ga0495643_0021984 Ga0495643_0021984_309_2750 743
32 3300046542 Ga0495597_0016242 Ga0495597_0016242_383_2824 743
33 3300046683 Ga0495658_0038430 Ga0495658_0038430_110_2539 743
34 3300046694 Ga0495649_0025500 Ga0495649_0025500_525_2966 743
35 3300047323 Ga0495683_0018885 Ga0495683_0018885_221_2662 743
36 3300047443 Ga0495687_015779 Ga0495687_015779_1023_3464 743
37 3300009147 Ga0114129_10125743 Ga0114129_101257433 744
38 3300035724 Ga0373933_0024958 Ga0373933_0024958_140_2509 745
39 3300035113 Ga0373936_0013811 Ga0373936_0013811_199_2739 747
40 3300035172 Ga0373955_0011352 Ga0373955_0011352_1274_3814 747
41 3300035692 Ga0373935_0017301 Ga0373935_0017301_402_2942 747
42 3300035725 Ga0373947_0019090 Ga0373947_0019090_1340_3880 747
43 3300046454 Ga0495592_0006181 Ga0495592_0006181_438_2972 747
44 3300046642 Ga0495634_0016980 Ga0495634_0016980_1345_3885 747
45 3300046690 Ga0495624_0043348 Ga0495624_0043348_262_2796 747
46 3300025258 Ga0209129_1008186 Ga0209129_10081862 748
47 3300025297 Ga0209758_1003552 Ga0209758_100355210 748
48 3300035111 Ga0373923_0002711 Ga0373923_0002711_610_3150 748
49 3300046474 Ga0495605_0020467 Ga0495605_0020467_1035_3476 748
50 3300046519 Ga0495632_0005365 Ga0495632_0005365_3959_6400 748
51 3300046522 Ga0495643_0004425 Ga0495643_0004425_1042_3483 748
52 3300046660 Ga0495625_0012872 Ga0495625_0012872_3283_5724 748
53 3300047443 Ga0495687_019926 Ga0495687_019926_115_2556 748
54 3300047472 Ga0495686_0006603 Ga0495686_0006603_441_2882 748
55 3300053119 Ga0500595_010772 Ga0500595_010772_1012_3549 748
56 3300053134 Ga0500658_0000130 Ga0500658_0000130_25656_28097 748
57 3300009553 Ga0105249_10008119 Ga0105249_100081195 749
58 3300036401 Ga0373937_0037204 Ga0373937_0037204_1639_4071 749
59 3300048914 Ga0496111_0027292 Ga0496111_0027292_301_2838 749
60 3300048921 Ga0496118_0009186 Ga0496118_0009186_5129_7525 749
61 3300005338 Ga0068868_100011942 Ga0068868_1000119424 750
62 3300005347 Ga0070668_100028494 Ga0070668_1000284943 750
63 3300005355 Ga0070671_100046545 Ga0070671_1000465452 750
64 3300005367 Ga0070667_100063374 Ga0070667_1000633742 750
65 3300005456 Ga0070678_100020893 Ga0070678_1000208932 750
66 3300005457 Ga0070662_100018941 Ga0070662_1000189414 750
67 3300005543 Ga0070672_100026269 Ga0070672_1000262692 750
68 3300005614 Ga0068856_100098812 Ga0068856_1000988121 750
69 3300005983 Ga0081540_1002854 Ga0081540_10028543 750
70 3300006358 Ga0068871_100031301 Ga0068871_1000313014 750
71 3300009177 Ga0105248_10029406 Ga0105248_100294063 750
72 3300009545 Ga0105237_10018146 Ga0105237_100181462 750
73 3300017792 Ga0163161_10024023 Ga0163161_100240232 750
74 3300025904 Ga0207647_10005165 Ga0207647_100051655 750
75 3300025933 Ga0207706_10002082 Ga0207706_100020823 750
76 3300025940 Ga0207691_10004168 Ga0207691_100041686 750
77 3300025960 Ga0207651_10057087 Ga0207651_100570871 750
78 3300026041 Ga0207639_10082242 Ga0207639_100822421 750
79 3300026121 Ga0207683_10009340 Ga0207683_100093408 750
80 3300035695 Ga0373927_0035362 Ga0373927_0035362_776_3205 750
81 3300036401 Ga0373937_0057422 Ga0373937_0057422_207_2876 750
82 3300048918 Ga0496115_0042964 Ga0496115_0042964_993_3425 750
83 3300049568 Ga0501031_0004898 Ga0501031_0004898_2836_5370 750
84 3300013308 Ga0157375_10104611 Ga0157375_101046111 751
85 3300025986 Ga0207658_10048056 Ga0207658_100480562 751
86 3300026088 Ga0207641_10076581 Ga0207641_100765811 751
87 3300046454 Ga0495592_0046575 Ga0495592_0046575_477_2936 751
88 3300046462 Ga0495651_0022384 Ga0495651_0022384_273_2708 751
89 3300046463 Ga0495653_0014196 Ga0495653_0014196_504_2939 751
90 3300046516 Ga0495628_0000947 Ga0495628_0000947_1581_4016 751
91 3300046536 Ga0495587_0002337 Ga0495587_0002337_9680_12115 751
92 3300046559 Ga0495667_0023602 Ga0495667_0023602_1431_3866 751
93 3300047444 Ga0495675_0000296 Ga0495675_0000296_3746_6181 751
94 3300047471 Ga0495684_0052708 Ga0495684_0052708_238_2697 751
95 3300048924 Ga0496121_0022894 Ga0496121_0022894_1901_4438 751
96 3300048929 Ga0496126_0027718 Ga0496126_0027718_1483_4020 751
97 3300053085 Ga0495619_0042965 Ga0495619_0042965_120_2579 751
98 3300035695 Ga0373927_0011463 Ga0373927_0011463_2431_4968 752
99 3300035725 Ga0373947_0008557 Ga0373947_0008557_1492_4029 752
100 3300046455 Ga0495603_0001888 Ga0495603_0001888_3643_6180 752
101 3300046459 Ga0495629_0003923 Ga0495629_0003923_2456_4993 752
102 3300046473 Ga0495582_0000872 Ga0495582_0000872_8008_10545 752
103 3300046475 Ga0495639_0000050 Ga0495639_0000050_43186_45723 752
104 3300046499 Ga0495594_0000188 Ga0495594_0000188_6184_8721 752
105 3300046526 Ga0495666_0014738 Ga0495666_0014738_833_3370 752
106 3300046531 Ga0495665_0000633 Ga0495665_0000633_5923_8460 752
107 3300046642 Ga0495634_0004421 Ga0495634_0004421_1334_3871 752
108 3300046683 Ga0495658_0002136 Ga0495658_0002136_1229_3766 752
109 3300047315 Ga0495581_0000795 Ga0495581_0000795_5298_7835 752
110 3300047319 Ga0495674_0002358 Ga0495674_0002358_6166_8703 752
111 3300047673 Ga0495593_0000019 Ga0495593_0000019_2188_4725 752
112 3300048924 Ga0496121_0018669 Ga0496121_0018669_3830_6352 752
113 3300025295 Ga0209564_1012848 Ga0209564_10128482 753
114 3300005355 Ga0070671_100005188 Ga0070671_1000051882 754
115 3300006844 Ga0075428_100026600 Ga0075428_1000266005 754
116 3300009094 Ga0111539_10001365 Ga0111539_100013658 754
117 3300009553 Ga0105249_10008159 Ga0105249_100081593 754
118 3300027907 Ga0207428_10000617 Ga0207428_100006178 754
119 3300035725 Ga0373947_0019673 Ga0373947_0019673_504_3014 754
120 3300046455 Ga0495603_0002303 Ga0495603_0002303_6348_8858 754
121 3300046459 Ga0495629_0005037 Ga0495629_0005037_4743_7253 754
122 3300046472 Ga0495580_0047627 Ga0495580_0047627_41_2551 754
123 3300046473 Ga0495582_0003363 Ga0495582_0003363_487_2997 754
124 3300046499 Ga0495594_0005188 Ga0495594_0005188_1029_3539 754
125 3300046557 Ga0495622_0007507 Ga0495622_0007507_2338_4848 754
126 3300046689 Ga0495613_0012480 Ga0495613_0012480_2558_5068 754
127 3300047315 Ga0495581_0001958 Ga0495581_0001958_2495_5005 754
128 3300047321 Ga0495676_0068223 Ga0495676_0068223_188_2698 754
129 3300047673 Ga0495593_0007459 Ga0495593_0007459_346_2856 754
130 3300005337 Ga0070682_100010588 Ga0070682_1000105881 755
131 3300005365 Ga0070688_100040982 Ga0070688_1000409822 755
132 3300005466 Ga0070685_10008616 Ga0070685_100086161 755
133 3300005530 Ga0070679_100024135 Ga0070679_1000241354 755
134 3300025315 Ga0207697_10003332 Ga0207697_100033327 755
135 3300025919 Ga0207657_10007376 Ga0207657_100073766 755
136 3300025940 Ga0207691_10009787 Ga0207691_1000978712 755
137 3300031238 Ga0265332_10007407 Ga0265332_100074072 755
138 3300035084 Ga0373928_0000205 Ga0373928_0000205_8835_11279 755
139 3300046499 Ga0495594_0025224 Ga0495594_0025224_306_2756 755
140 3300046543 Ga0495645_0011042 Ga0495645_0011042_3859_6309 755
141 3300046642 Ga0495634_0015185 Ga0495634_0015185_880_3327 755
142 3300048905 Ga0496102_0073494 Ga0496102_0073494_194_2638 755
143 3300050492 nmdc:mga0yw44_4960_c1 nmdc:mga0yw44_4960_c1_559_3111 755
144 3300006237 Ga0097621_100037415 Ga0097621_1000374153 756
145 3300006846 Ga0075430_100054617 Ga0075430_1000546172 756
146 3300006852 Ga0075433_10018913 Ga0075433_100189131 756
147 3300006871 Ga0075434_100005335 Ga0075434_1000053352 756
148 3300035118 Ga0373954_0001334 Ga0373954_0001334_2151_4583 756
149 3300035724 Ga0373933_0025655 Ga0373933_0025655_874_3342 756
150 3300050509 nmdc:mga0qj67_52263_c1 nmdc:mga0qj67_52263_c1_751_3159 756
151 3300003187 JGI25151J46595_10010758 JGI25151J46595_100107582 757
152 3300003354 JGI25160J50197_1000747 JGI25160J50197_100074714 757
153 3300003354 JGI25160J50197_1003091 JGI25160J50197_10030914 757
154 3300003771 Ga0055526_1001323 Ga0055526_10013239 757
155 3300003794 Ga0055531_10005540 Ga0055531_100055403 757
156 3300006186 Ga0075369_10005504 Ga0075369_100055042 757
157 3300025292 Ga0209676_1001596 Ga0209676_100159615 757
158 3300025294 Ga0209025_1000687 Ga0209025_100068717 757
159 3300025295 Ga0209564_1000025 Ga0209564_100002554 757
160 3300025298 Ga0209050_1005529 Ga0209050_10055292 757
161 3300025299 Ga0209256_1001217 Ga0209256_100121724 757
162 3300025302 Ga0207426_1000422 Ga0207426_100042238 757
163 3300025304 Ga0209257_1003319 Ga0209257_10033198 757
164 3300048928 Ga0496125_0019843 Ga0496125_0019843_1198_3642 757
165 3300005329 Ga0070683_100073799 Ga0070683_1000737991 758
166 3300005336 Ga0070680_100074375 Ga0070680_1000743751 758
167 3300025315 Ga0207697_10017888 Ga0207697_100178881 758
168 3300026121 Ga0207683_10055858 Ga0207683_100558582 758
169 3300028379 Ga0268266_10022040 Ga0268266_100220403 758
170 3300035171 Ga0373946_0004801 Ga0373946_0004801_2136_4568 758
171 3300035172 Ga0373955_0000697 Ga0373955_0000697_11215_13647 758
172 3300035410 Ga0373924_0000297 Ga0373924_0000297_9280_11712 758
173 3300035692 Ga0373935_0000530 Ga0373935_0000530_12665_15097 758
174 3300036401 Ga0373937_0000212 Ga0373937_0000212_38108_40540 758
175 3300037068 Ga0373925_0000002 Ga0373925_0000002_85872_88304 758
176 3300046454 Ga0495592_0000265 Ga0495592_0000265_4238_6670 758
177 3300046463 Ga0495653_0000006 Ga0495653_0000006_86020_88452 758
178 3300046477 Ga0495664_0000002 Ga0495664_0000002_121654_124086 758
179 3300046511 Ga0495608_0000006 Ga0495608_0000006_90460_92892 758
180 3300046516 Ga0495628_0000002 Ga0495628_0000002_86039_88471 758
181 3300046517 Ga0495630_0001748 Ga0495630_0001748_12121_14553 758
182 3300046529 Ga0495652_0000004 Ga0495652_0000004_500412_502844 758
183 3300046533 Ga0495640_0000007 Ga0495640_0000007_38146_40578 758
184 3300046536 Ga0495587_0000031 Ga0495587_0000031_86039_88471 758
185 3300046543 Ga0495645_0000003 Ga0495645_0000003_67290_69722 758
186 3300046559 Ga0495667_0000002 Ga0495667_0000002_349252_351684 758
187 3300046642 Ga0495634_0000110 Ga0495634_0000110_30128_32560 758
188 3300046663 Ga0495635_0000022 Ga0495635_0000022_56322_58754 758
189 3300046678 Ga0495599_0000001 Ga0495599_0000001_224717_227149 758
190 3300046679 Ga0495623_0000898 Ga0495623_0000898_13875_16307 758
191 3300046680 Ga0495646_0000007 Ga0495646_0000007_9656_12088 758
192 3300046689 Ga0495613_0047848 Ga0495613_0047848_41_2473 758
193 3300046809 Ga0495600_0000125 Ga0495600_0000125_2328_4760 758
194 3300047317 Ga0495604_0000005 Ga0495604_0000005_111683_114115 758
195 3300047319 Ga0495674_0000003 Ga0495674_0000003_473655_476087 758
196 3300047322 Ga0495680_0000091 Ga0495680_0000091_11997_14429 758
197 3300047444 Ga0495675_0000133 Ga0495675_0000133_12024_14456 758
198 3300047471 Ga0495684_0000035 Ga0495684_0000035_67192_69624 758
199 3300047673 Ga0495593_0000746 Ga0495593_0000746_10693_13125 758
200 3300048088 Ga0495602_0000029 Ga0495602_0000029_67182_69614 758
201 3300048909 Ga0496106_0005089 Ga0496106_0005089_1620_4124 758
202 3300048912 Ga0496109_0001422 Ga0496109_0001422_1018_3522 758
203 3300048913 Ga0496110_0006506 Ga0496110_0006506_3573_6077 758
204 3300048915 Ga0496112_0019691 Ga0496112_0019691_238_2742 758
205 3300053077 Ga0495601_0000008 Ga0495601_0000008_234271_236703 758
206 3300053084 Ga0495595_0000024 Ga0495595_0000024_67299_69731 758
207 3300053085 Ga0495619_0000002 Ga0495619_0000002_86042_88474 758
208 3300003215 JGI25153J46596_10002867 JGI25153J46596_100028673 760
209 3300003323 rootH1_10099016 rootH1_100990161 760
210 3300006173 Ga0070716_100035911 Ga0070716_1000359111 760
211 3300025295 Ga0209564_1002632 Ga0209564_10026328 760
212 3300025297 Ga0209758_1004462 Ga0209758_10044624 760
213 3300050492 nmdc:mga0yw44_5572_c1 nmdc:mga0yw44_5572_c1_3214_5622 760
214 iso_pu_bacteria 2643221637 2644207777 760
215 iso_pu_bacteria 2643221718 2644651866 760
216 iso_pu_bacteria 2996336353 2996340887 760
217 3300009177 Ga0105248_10098856 Ga0105248_100988561 761
218 3300013297 Ga0157378_10018240 Ga0157378_100182403 761
219 3300046454 Ga0495592_0069374 Ga0495592_0069374_77_2500 761
220 3300046459 Ga0495629_0003568 Ga0495629_0003568_3574_6030 761
221 3300046663 Ga0495635_0006695 Ga0495635_0006695_4210_6666 761
222 3300046675 Ga0495657_0028945 Ga0495657_0028945_54_2510 761
223 3300047317 Ga0495604_0007075 Ga0495604_0007075_1276_3732 761
224 3300048908 Ga0496105_0019114 Ga0496105_0019114_178_2634 761
225 3300048922 Ga0496119_0010170 Ga0496119_0010170_5395_7851 761
226 3300048929 Ga0496126_0017772 Ga0496126_0017772_1801_4257 761
227 iso_pu_bacteria 2513237095 2513652455 761
228 iso_pu_bacteria 2515154113 2515638879 761
229 iso_pu_bacteria 2515154114 2515645676 761
230 iso_pu_bacteria 2767802442 2770200167 761
231 iso_pu_bacteria 2816332527 2818236845 761
232 iso_pu_bacteria 2842217011 2842221039 761
233 iso_pu_bacteria 2888378607 2888385768 761
234 iso_pu_bacteria 639633055 639647029 761
235 3300002773 JGI25152J39213_1000013 JGI25152J39213_100001358 763
236 3300002987 JGI25159J45721_1000096 JGI25159J45721_100009622 763
237 3300002987 JGI25159J45721_1000150 JGI25159J45721_10001509 763
238 3300003215 JGI25153J46596_10007865 JGI25153J46596_100078654 763
239 3300003354 JGI25160J50197_1000070 JGI25160J50197_100007045 763
240 3300003374 JGI25161J50226_1000026 JGI25161J50226_1000026155 763
241 3300003771 Ga0055526_1000399 Ga0055526_10003996 763
242 3300003775 Ga0055524_1003933 Ga0055524_10039332 763
243 3300003775 Ga0055524_1014996 Ga0055524_10149961 763
244 3300003790 Ga0055528_1007774 Ga0055528_10077742 763
245 3300003792 Ga0055540_1000581 Ga0055540_10005812 763
246 3300004625 Ga0055543_1000042 Ga0055543_1000042100 763
247 3300005262 Ga0065165_1000512 Ga0065165_100051210 763
248 3300013297 Ga0157378_10001000 Ga0157378_1000100016 763
249 3300025208 Ga0209436_100036 Ga0209436_10003697 763
250 3300025245 Ga0207425_1000558 Ga0207425_100055810 763
251 3300025258 Ga0209129_1000092 Ga0209129_1000092120 763
252 3300025273 Ga0209673_1000987 Ga0209673_100098711 763
253 3300025273 Ga0209673_1001100 Ga0209673_100110014 763
254 3300025284 Ga0209130_1000073 Ga0209130_1000073100 763
255 3300025295 Ga0209564_1000168 Ga0209564_100016847 763
256 3300025295 Ga0209564_1001142 Ga0209564_100114214 763
257 3300025297 Ga0209758_1000201 Ga0209758_100020171 763
258 3300025299 Ga0209256_1001718 Ga0209256_100171814 763
259 3300025299 Ga0209256_1002173 Ga0209256_10021736 763
260 3300025302 Ga0207426_1000140 Ga0207426_1000140151 763
261 3300025303 Ga0209051_1000922 Ga0209051_10009221 763
262 3300025304 Ga0209257_1003613 Ga0209257_10036132 763
263 3300025926 Ga0207659_10051860 Ga0207659_100518602 763
264 3300028379 Ga0268266_10020437 Ga0268266_100204373 763
265 3300035111 Ga0373923_0013338 Ga0373923_0013338_507_3008 763
266 3300046460 Ga0495638_0017476 Ga0495638_0017476_1410_3851 763
267 3300046507 Ga0495606_0009716 Ga0495606_0009716_3657_6080 763
268 3300048908 Ga0496105_0003969 Ga0496105_0003969_3613_6054 763
269 3300048913 Ga0496110_0033371 Ga0496110_0033371_1143_3584 763
270 3300048919 Ga0496116_0010501 Ga0496116_0010501_1327_3768 763
271 3300048922 Ga0496119_0004579 Ga0496119_0004579_7706_10147 763
272 3300048926 Ga0496123_0013783 Ga0496123_0013783_40_2481 763
273 3300048927 Ga0496124_0012606 Ga0496124_0012606_2415_4856 763
274 3300048928 Ga0496125_0015046 Ga0496125_0015046_3405_5846 763
275 3300060353 Ga0501082_0071868 Ga0501082_0071868_80_2521 763
276 iso_pu_bacteria 2510917030 2511196668 763
277 iso_pu_bacteria 2513237085 2513575324 763
278 iso_pu_bacteria 2515154134 2515739023 763
279 iso_pu_bacteria 2516653085 2517075970 763
280 iso_pu_bacteria 2582581299 2585230396 763
281 iso_pu_bacteria 2585427526 2585528115 763
282 iso_pu_bacteria 2585427590 2585819374 763
283 iso_pu_bacteria 2643221634 2644192524 763
284 iso_pu_bacteria 2838686498 2838689045 763
285 iso_pu_bacteria 2838729681 2838730380 763
286 iso_pu_bacteria 2838742623 2838743321 763
287 iso_pu_bacteria 2841851746 2841854992 763
288 iso_pu_bacteria 2842156927 2842157854 763
289 iso_pu_bacteria 2842163707 2842165070 763
290 iso_pu_bacteria 2842180545 2842180562 763
291 iso_pu_bacteria 2842229732 2842236289 763
292 iso_pu_bacteria 2842243621 2842244499 763
293 iso_pu_bacteria 2842257432 2842258312 763
294 iso_pu_bacteria 2842271015 2842273065 763
295 iso_pu_bacteria 2842304105 2842309454 763
296 iso_pu_bacteria 2844454524 2844459601 763
297 iso_pu_bacteria 2933570622 2933575772 763
298 iso_pu_bacteria 2935901341 2935904905 763
299 iso_pu_bacteria 8005307578 8005314624 763
300 iso_pu_bacteria 8023680758 8023680909 763
301 3300005331 Ga0070670_100000923 Ga0070670_10000092313 764
302 3300005539 Ga0068853_100078579 Ga0068853_1000785791 764
303 3300005618 Ga0068864_100002194 Ga0068864_1000021949 764
304 3300006881 Ga0068865_100032142 Ga0068865_1000321422 764
305 3300009551 Ga0105238_10052441 Ga0105238_100524411 764
306 3300013296 Ga0157374_10044954 Ga0157374_100449543 764
307 3300013296 Ga0157374_10079103 Ga0157374_100791032 764
308 3300014325 Ga0163163_10001266 Ga0163163_1000126622 764
309 3300025925 Ga0207650_10015851 Ga0207650_100158514 764
310 3300026041 Ga0207639_10044436 Ga0207639_100444362 764
311 3300026088 Ga0207641_10050039 Ga0207641_100500391 764
312 3300026095 Ga0207676_10031202 Ga0207676_100312023 764
313 3300035207 Ga0373942_0000855 Ga0373942_0000855_2470_4914 764
314 3300047319 Ga0495674_0040605 Ga0495674_0040605_37_2475 764
315 3300048911 Ga0496108_0003134 Ga0496108_0003134_10764_13223 764
316 3300048915 Ga0496112_0019401 Ga0496112_0019401_2746_5205 764
317 3300048916 Ga0496113_0013051 Ga0496113_0013051_440_2899 764
318 3300049580 Ga0501046_0035925 Ga0501046_0035925_590_3112 764
319 iso_pu_bacteria 2738543024 2739310483 764
320 iso_pu_bacteria 2906610324 2906618782 764
321 3300005548 Ga0070665_100060132 Ga0070665_1000601324 765
322 3300005937 Ga0081455_10005203 Ga0081455_100052038 765
323 3300006038 Ga0075365_10008695 Ga0075365_100086953 765
324 3300028379 Ga0268266_10013089 Ga0268266_100130898 765
325 3300046463 Ga0495653_0010838 Ga0495653_0010838_3384_5843 765
326 3300046477 Ga0495664_0029321 Ga0495664_0029321_449_2908 765
327 3300046517 Ga0495630_0004873 Ga0495630_0004873_2339_4798 765
328 3300046809 Ga0495600_0001803 Ga0495600_0001803_2462_4921 765
329 3300047319 Ga0495674_0039982 Ga0495674_0039982_917_3376 765
330 3300047322 Ga0495680_0004150 Ga0495680_0004150_5670_8129 765
331 3300047471 Ga0495684_0000802 Ga0495684_0000802_17933_20392 765
332 3300053077 Ga0495601_0021516 Ga0495601_0021516_249_2708 765
333 3300053084 Ga0495595_0001058 Ga0495595_0001058_382_2841 765
334 3300053085 Ga0495619_0003580 Ga0495619_0003580_6762_9221 765
335 iso_pu_bacteria 2513237159 2513996929 765
336 iso_pu_bacteria 2524023228 2524536925 765
337 iso_pu_bacteria 2643221698 2644539981 765
338 iso_pu_bacteria 2842521101 2842522832 765
339 iso_pu_bacteria 8006933436 8006941426 765
340 iso_pu_bacteria 8006973647 8006981137 765
341 3300005367 Ga0070667_100057784 Ga0070667_1000577842 766
342 3300005455 Ga0070663_100026269 Ga0070663_1000262692 766
343 3300005467 Ga0070706_100000310 Ga0070706_10000031038 766
344 3300006048 Ga0075363_100001010 Ga0075363_1000010104 766
345 3300006051 Ga0075364_10013238 Ga0075364_100132383 766
346 3300006177 Ga0075362_10004104 Ga0075362_100041043 766
347 3300006178 Ga0075367_10013628 Ga0075367_100136283 766
348 3300006195 Ga0075366_10012428 Ga0075366_100124283 766
349 3300006353 Ga0075370_10014634 Ga0075370_100146342 766
350 3300009094 Ga0111539_10011994 Ga0111539_100119947 766
351 3300011119 Ga0105246_10032801 Ga0105246_100328012 766
352 3300025304 Ga0209257_1007517 Ga0209257_10075173 766
353 3300025910 Ga0207684_10000086 Ga0207684_10000086177 766
354 3300025986 Ga0207658_10027552 Ga0207658_100275522 766
355 3300028379 Ga0268266_10071330 Ga0268266_100713302 766
356 3300046452 Ga0495617_001237 Ga0495617_001237_2181_4607 766
357 3300046492 Ga0495585_0000002 Ga0495585_0000002_160293_162719 766
358 3300046513 Ga0495616_0000435 Ga0495616_0000435_23989_26415 766
359 3300046524 Ga0495648_0000027 Ga0495648_0000027_160295_162721 766
360 3300046616 Ga0495668_0033273 Ga0495668_0033273_358_2865 766
361 3300047323 Ga0495683_0007912 Ga0495683_0007912_128_2635 766
362 3300048905 Ga0496102_0004518 Ga0496102_0004518_8569_11028 766
363 3300048915 Ga0496112_0026604 Ga0496112_0026604_2726_5185 766
364 3300048916 Ga0496113_0028267 Ga0496113_0028267_787_3246 766
365 3300048920 Ga0496117_0034954 Ga0496117_0034954_1302_3761 766
366 3300048922 Ga0496119_0008582 Ga0496119_0008582_4770_7211 766
367 3300048925 Ga0496122_0001001 Ga0496122_0001001_771_3221 766
368 3300048925 Ga0496122_0062000 Ga0496122_0062000_44_2503 766
369 3300048926 Ga0496123_0001664 Ga0496123_0001664_23473_25923 766
370 3300050493 nmdc:mga0k408_14578_c1 nmdc:mga0k408_14578_c1_289_2748 766
371 iso_pu_bacteria 2513237104 2513717634 766
372 iso_pu_bacteria 2517093001 2517107661 766
373 iso_pu_bacteria 2582581294 2585204913 766
374 iso_pu_bacteria 2643221557 2643803353 766
375 iso_pu_bacteria 2643221610 2644063720 766
376 iso_pu_bacteria 2643221668 2644374997 766
377 iso_pu_bacteria 2643221675 2644414483 766
378 iso_pu_bacteria 2643221680 2644448011 766
379 iso_pu_bacteria 2643221723 2644676324 766
380 iso_pu_bacteria 2643221726 2644690484 766
381 iso_pu_bacteria 2824609381 2824613536 766
382 iso_pu_bacteria 2824661429 2824667014 766
383 iso_pu_bacteria 2841957949 2841963238 766
384 iso_pu_bacteria 2879099564 2879105644 766
385 iso_pu_bacteria 2894652903 2894654824 766
386 iso_pu_bacteria 2906626472 2906634343 766
387 iso_pu_bacteria 2929615660 2929620438 766
388 iso_pu_bacteria 2929624759 2929626331 766
389 iso_pu_bacteria 2932809354 2932809829 766
390 iso_pu_bacteria 2932828146 2932828632 766
391 iso_pu_bacteria 2933577622 2933582356 766
392 iso_pu_bacteria 2935638405 2935638929 766
393 iso_pu_bacteria 2935665750 2935666220 766
394 iso_pu_bacteria 2935675223 2935676735 766
395 iso_pu_bacteria 2935694250 2935694812 766
396 iso_pu_bacteria 2935703347 2935703935 766
397 iso_pu_bacteria 2935713505 2935713676 766
398 iso_pu_bacteria 2935722832 2935724296 766
399 iso_pu_bacteria 2935732158 2935733346 766
400 iso_pu_bacteria 2935741537 2935742725 766
401 iso_pu_bacteria 2935750917 2935751088 766
402 iso_pu_bacteria 2935760218 2935760389 766
403 iso_pu_bacteria 2935810662 2935810840 766
404 iso_pu_bacteria 2935827899 2935828423 766
405 iso_pu_bacteria 2936002035 2936002652 766
406 iso_pu_bacteria 2936037263 2936037740 766
407 iso_pu_bacteria 2940556831 2940558109 766
408 iso_pu_bacteria 3005409236 3005412133 766
409 iso_pu_bacteria 8016583857 8016593557 766
410 iso_pu_bacteria 8017057580 8017064737 766
411 iso_pu_bacteria 8019597564 8019599421 766
412 iso_pu_bacteria 8019608314 8019608939 766
413 iso_pu_bacteria 8055742211 8055745300 766
414 3300005468 Ga0070707_100026954 Ga0070707_1000269543 767
415 3300005471 Ga0070698_100062541 Ga0070698_1000625412 767
416 3300005842 Ga0068858_100053435 Ga0068858_1000534353 767
417 3300006871 Ga0075434_100071286 Ga0075434_1000712862 767
418 3300013308 Ga0157375_10010353 Ga0157375_100103532 767
419 3300014968 Ga0157379_10067134 Ga0157379_100671343 767
420 3300035724 Ga0373933_0030307 Ga0373933_0030307_34_2532 767
421 3300046462 Ga0495651_0042031 Ga0495651_0042031_565_3063 767
422 3300046516 Ga0495628_0009155 Ga0495628_0009155_1949_4447 767
423 3300046529 Ga0495652_0017613 Ga0495652_0017613_2369_4867 767
424 3300046678 Ga0495599_0001370 Ga0495599_0001370_3991_6489 767
425 3300046679 Ga0495623_0004031 Ga0495623_0004031_3440_5938 767
426 3300046680 Ga0495646_0008837 Ga0495646_0008837_3421_5919 767
427 3300047319 Ga0495674_0015624 Ga0495674_0015624_897_3395 767
428 3300048909 Ga0496106_0047652 Ga0496106_0047652_314_2806 767
429 3300048929 Ga0496126_0011403 Ga0496126_0011403_3172_5628 767
430 3300050512 nmdc:mga0n895_105170_c1 nmdc:mga0n895_105170_c1_55_2523 767
431 3300053077 Ga0495601_0018776 Ga0495601_0018776_91_2589 767
432 3300005434 Ga0070709_10000960 Ga0070709_100009609 768
433 3300005435 Ga0070714_100021419 Ga0070714_1000214192 768
434 3300005437 Ga0070710_10000707 Ga0070710_1000070711 768
435 3300005439 Ga0070711_100002547 Ga0070711_1000025476 768
436 3300006914 Ga0075436_100015229 Ga0075436_1000152294 768
437 3300025898 Ga0207692_10001398 Ga0207692_100013983 768
438 3300025906 Ga0207699_10000740 Ga0207699_100007404 768
439 3300025929 Ga0207664_10009868 Ga0207664_100098682 768
440 3300046460 Ga0495638_0021610 Ga0495638_0021610_33_2489 768
441 3300048918 Ga0496115_0012357 Ga0496115_0012357_3094_5613 768
442 3300049573 Ga0501037_0028130 Ga0501037_0028130_638_3172 768
443 3300049579 Ga0501043_0015956 Ga0501043_0015956_3025_5559 768
444 3300049822 Ga0501035_0013041 Ga0501035_0013041_4536_7070 768
445 3300049823 Ga0501044_0054427 Ga0501044_0054427_590_3124 768
446 iso_pu_bacteria 8005258706 8005260555 768
447 3300002773 JGI25152J39213_1002854 JGI25152J39213_10028546 769
448 3300003215 JGI25153J46596_10006097 JGI25153J46596_100060976 769
449 3300005355 Ga0070671_100074389 Ga0070671_1000743892 769
450 3300005618 Ga0068864_100010094 Ga0068864_1000100942 769
451 3300006038 Ga0075365_10004247 Ga0075365_100042476 769
452 3300006178 Ga0075367_10002764 Ga0075367_100027642 769
453 3300006846 Ga0075430_100003912 Ga0075430_10000391214 769
454 3300006847 Ga0075431_100057533 Ga0075431_1000575334 769
455 3300006852 Ga0075433_10004647 Ga0075433_100046476 769
456 3300006871 Ga0075434_100049889 Ga0075434_1000498894 769
457 3300006880 Ga0075429_100001943 Ga0075429_1000019431 769
458 3300009094 Ga0111539_10007890 Ga0111539_1000789013 769
459 3300009545 Ga0105237_10089162 Ga0105237_100891622 769
460 3300013105 Ga0157369_10073295 Ga0157369_100732952 769
461 3300013308 Ga0157375_10032953 Ga0157375_100329532 769
462 3300014968 Ga0157379_10033729 Ga0157379_100337294 769
463 3300014969 Ga0157376_10025854 Ga0157376_100258541 769
464 3300025245 Ga0207425_1004717 Ga0207425_10047172 769
465 3300025258 Ga0209129_1001034 Ga0209129_100103411 769
466 3300025294 Ga0209025_1003666 Ga0209025_100366613 769
467 3300025297 Ga0209758_1001011 Ga0209758_100101129 769
468 3300025299 Ga0209256_1000042 Ga0209256_1000042276 769
469 3300025931 Ga0207644_10026133 Ga0207644_100261331 769
470 3300025941 Ga0207711_10057396 Ga0207711_100573961 769
471 3300027866 Ga0209813_10002631 Ga0209813_100026312 769
472 3300027907 Ga0207428_10000295 Ga0207428_1000029511 769
473 3300031238 Ga0265332_10002582 Ga0265332_100025823 769
474 3300031250 Ga0265331_10000677 Ga0265331_1000067722 769
475 3300036401 Ga0373937_0026718 Ga0373937_0026718_2660_5107 769
476 3300036401 Ga0373937_0048967 Ga0373937_0048967_1110_3563 769
477 3300046452 Ga0495617_011632 Ga0495617_011632_53_2590 769
478 3300046455 Ga0495603_0015277 Ga0495603_0015277_360_2897 769
479 3300046477 Ga0495664_0000950 Ga0495664_0000950_5529_7982 769
480 3300046492 Ga0495585_0014605 Ga0495585_0014605_1834_4371 769
481 3300046512 Ga0495610_0026877 Ga0495610_0026877_455_2992 769
482 3300046519 Ga0495632_0022507 Ga0495632_0022507_457_2994 769
483 3300046543 Ga0495645_0001020 Ga0495645_0001020_302_2755 769
484 3300046616 Ga0495668_0028076 Ga0495668_0028076_144_2681 769
485 3300046660 Ga0495625_0033102 Ga0495625_0033102_583_3120 769
486 3300046663 Ga0495635_0017839 Ga0495635_0017839_2477_4930 769
487 3300046691 Ga0495670_0011974 Ga0495670_0011974_1254_3791 769
488 3300047319 Ga0495674_0041981 Ga0495674_0041981_1442_3895 769
489 3300047322 Ga0495680_0014800 Ga0495680_0014800_1441_3948 769
490 3300048088 Ga0495602_0000841 Ga0495602_0000841_307_2760 769
491 3300048904 Ga0496101_0040511 Ga0496101_0040511_544_3000 769
492 3300048905 Ga0496102_0019986 Ga0496102_0019986_2995_5451 769
493 3300048906 Ga0496103_0018879 Ga0496103_0018879_286_2742 769
494 3300048907 Ga0496104_0055904 Ga0496104_0055904_523_2979 769
495 3300048908 Ga0496105_0040965 Ga0496105_0040965_638_3094 769
496 3300048909 Ga0496106_0004225 Ga0496106_0004225_3476_5932 769
497 3300048911 Ga0496108_0009850 Ga0496108_0009850_100_2556 769
498 3300048912 Ga0496109_0036600 Ga0496109_0036600_1622_4078 769
499 3300048913 Ga0496110_0003153 Ga0496110_0003153_4089_6545 769
500 3300048916 Ga0496113_0015645 Ga0496113_0015645_2489_4945 769
501 3300048917 Ga0496114_0047564 Ga0496114_0047564_608_3064 769
502 3300048918 Ga0496115_0004676 Ga0496115_0004676_1180_3687 769
503 3300048918 Ga0496115_0005104 Ga0496115_0005104_4893_7349 769
504 3300050490 nmdc:mga03n38_10051_c1 nmdc:mga03n38_10051_c1_414_2903 769
505 3300050491 nmdc:mga00v17_12514_c1 nmdc:mga00v17_12514_c1_2179_4668 769
506 3300050507 nmdc:mga05p37_1811_c1 nmdc:mga05p37_1811_c1_11557_14001 769
507 3300050508 nmdc:mga09592_1420_c1 nmdc:mga09592_1420_c1_14703_17147 769
508 3300050509 nmdc:mga0qj67_36388_c1 nmdc:mga0qj67_36388_c1_84_2528 769
509 3300050510 nmdc:mga06r32_47426_c1 nmdc:mga06r32_47426_c1_1452_3896 769
510 3300050511 nmdc:mga08y16_2249_c1 nmdc:mga08y16_2249_c1_11682_14126 769
511 3300050512 nmdc:mga0n895_49864_c1 nmdc:mga0n895_49864_c1_722_3445 769
512 3300050513 nmdc:mga0rr50_187_c1 nmdc:mga0rr50_187_c1_11040_13484 769
513 3300050516 nmdc:mga0sz30_15256_c1 nmdc:mga0sz30_15256_c1_145_2685 769
514 3300053078 Ga0495612_0002930 Ga0495612_0002930_3843_6296 769
515 3300053085 Ga0495619_0000897 Ga0495619_0000897_16492_18999 769
516 3300053085 Ga0495619_0003483 Ga0495619_0003483_4744_7251 769
517 3300053086 Ga0500578_0028264 Ga0500578_0028264_376_2973 769
518 3300053093 Ga0500651_0011414 Ga0500651_0011414_1132_3669 769
519 3300053108 Ga0500562_004388 Ga0500562_004388_661_3198 769
520 3300053134 Ga0500658_0008142 Ga0500658_0008142_482_3019 769
521 3300053142 Ga0500577_0007034 Ga0500577_0007034_552_3089 769
522 3300002739 JGI25158J39367_1002046 JGI25158J39367_10020462 770
523 3300002739 JGI25158J39367_1002298 JGI25158J39367_10022982 770
524 3300002987 JGI25159J45721_1000028 JGI25159J45721_100002893 770
525 3300002987 JGI25159J45721_1000084 JGI25159J45721_100008427 770
526 3300003215 JGI25153J46596_10000068 JGI25153J46596_1000006860 770
527 3300003354 JGI25160J50197_1000024 JGI25160J50197_100002494 770
528 3300003354 JGI25160J50197_1000030 JGI25160J50197_100003045 770
529 3300003374 JGI25161J50226_1000016 JGI25161J50226_100001645 770
530 3300003374 JGI25161J50226_1000369 JGI25161J50226_100036919 770
531 3300003771 Ga0055526_1001038 Ga0055526_10010385 770
532 3300003781 Ga0055536_1006853 Ga0055536_10068532 770
533 3300003791 Ga0055530_10007038 Ga0055530_100070381 770
534 3300003794 Ga0055531_10015755 Ga0055531_100157552 770
535 3300004625 Ga0055543_1000006 Ga0055543_1000006130 770
536 3300004625 Ga0055543_1000013 Ga0055543_100001380 770
537 3300005262 Ga0065165_1000098 Ga0065165_1000098121 770
538 3300005262 Ga0065165_1000215 Ga0065165_100021574 770
539 3300005364 Ga0070673_100051863 Ga0070673_1000518631 770
540 3300005563 Ga0068855_100072017 Ga0068855_1000720172 770
541 3300006871 Ga0075434_100080340 Ga0075434_1000803402 770
542 3300013250 Ga0171462_1035 Ga0171462_103539 770
543 3300025208 Ga0209436_100546 Ga0209436_1005464 770
544 3300025284 Ga0209130_1000026 Ga0209130_1000026116 770
545 3300025284 Ga0209130_1000053 Ga0209130_1000053123 770
546 3300025292 Ga0209676_1004369 Ga0209676_10043692 770
547 3300025294 Ga0209025_1000216 Ga0209025_1000216144 770
548 3300025294 Ga0209025_1011005 Ga0209025_10110054 770
549 3300025295 Ga0209564_1000013 Ga0209564_1000013408 770
550 3300025297 Ga0209758_1000097 Ga0209758_1000097153 770
551 3300025297 Ga0209758_1024239 Ga0209758_10242392 770
552 3300025299 Ga0209256_1000745 Ga0209256_100074514 770
553 3300025302 Ga0207426_1000006 Ga0207426_1000006780 770
554 3300025302 Ga0207426_1000054 Ga0207426_1000054292 770
555 3300025915 Ga0207693_10021115 Ga0207693_100211153 770
556 3300031239 Ga0265328_10000008 Ga0265328_1000000829 770
557 3300031250 Ga0265331_10001549 Ga0265331_100015495 770
558 3300031344 Ga0265316_10035969 Ga0265316_100359693 770
559 3300031711 Ga0265314_10000180 Ga0265314_1000018028 770
560 3300033179 Ga0307507_10027504 Ga0307507_100275043 770
561 3300035113 Ga0373936_0009011 Ga0373936_0009011_458_2917 770
562 3300035170 Ga0373943_0007985 Ga0373943_0007985_2189_4648 770
563 3300035692 Ga0373935_0015913 Ga0373935_0015913_2057_4516 770
564 3300035695 Ga0373927_0008161 Ga0373927_0008161_3686_6175 770
565 3300035695 Ga0373927_0010378 Ga0373927_0010378_2264_4723 770
566 3300035695 Ga0373927_0013159 Ga0373927_0013159_2730_5186 770
567 3300035724 Ga0373933_0016324 Ga0373933_0016324_1561_4020 770
568 3300036401 Ga0373937_0017964 Ga0373937_0017964_2635_5094 770
569 3300037068 Ga0373925_0010354 Ga0373925_0010354_2790_5246 770
570 3300037068 Ga0373925_0013980 Ga0373925_0013980_1423_3882 770
571 3300046454 Ga0495592_0036151 Ga0495592_0036151_70_2529 770
572 3300046461 Ga0495641_0007689 Ga0495641_0007689_3743_6202 770
573 3300046462 Ga0495651_0009124 Ga0495651_0009124_203_2662 770
574 3300046463 Ga0495653_0004185 Ga0495653_0004185_4035_6494 770
575 3300046475 Ga0495639_0002172 Ga0495639_0002172_2051_4510 770
576 3300046477 Ga0495664_0001919 Ga0495664_0001919_1860_4319 770
577 3300046499 Ga0495594_0026764 Ga0495594_0026764_237_2696 770
578 3300046511 Ga0495608_0002502 Ga0495608_0002502_3960_6419 770
579 3300046514 Ga0495618_0003968 Ga0495618_0003968_5178_7637 770
580 3300046516 Ga0495628_0070846 Ga0495628_0070846_104_2563 770
581 3300046517 Ga0495630_0022073 Ga0495630_0022073_815_3274 770
582 3300046526 Ga0495666_0008910 Ga0495666_0008910_2068_4527 770
583 3300046533 Ga0495640_0019774 Ga0495640_0019774_1751_4210 770
584 3300046559 Ga0495667_0003031 Ga0495667_0003031_206_2665 770
585 3300046642 Ga0495634_0018629 Ga0495634_0018629_1936_4395 770
586 3300046663 Ga0495635_0032096 Ga0495635_0032096_576_3032 770
587 3300046675 Ga0495657_0017770 Ga0495657_0017770_839_3298 770
588 3300046679 Ga0495623_0018438 Ga0495623_0018438_671_3130 770
589 3300046679 Ga0495623_0032994 Ga0495623_0032994_300_2756 770
590 3300046680 Ga0495646_0009206 Ga0495646_0009206_867_3323 770
591 3300046680 Ga0495646_0009994 Ga0495646_0009994_1186_3645 770
592 3300046681 Ga0495647_0005827 Ga0495647_0005827_346_2805 770
593 3300046689 Ga0495613_0019573 Ga0495613_0019573_2402_4861 770
594 3300046809 Ga0495600_0003788 Ga0495600_0003788_5232_7691 770
595 3300047315 Ga0495581_0014167 Ga0495581_0014167_1809_4268 770
596 3300047322 Ga0495680_0047607 Ga0495680_0047607_202_2661 770
597 3300047471 Ga0495684_0004284 Ga0495684_0004284_6003_8459 770
598 3300047673 Ga0495593_0013724 Ga0495593_0013724_783_3242 770
599 3300048088 Ga0495602_0007519 Ga0495602_0007519_209_2668 770
600 3300048908 Ga0496105_0044584 Ga0496105_0044584_853_3378 770
601 3300048911 Ga0496108_0041025 Ga0496108_0041025_908_3433 770
602 3300048918 Ga0496115_0001086 Ga0496115_0001086_7962_10421 770
603 3300048918 Ga0496115_0040353 Ga0496115_0040353_1049_3499 770
604 3300048924 Ga0496121_0014946 Ga0496121_0014946_2959_5496 770
605 3300050512 nmdc:mga0n895_3688_c1 nmdc:mga0n895_3688_c1_1158_3611 770
606 3300053085 Ga0495619_0014391 Ga0495619_0014391_1058_3517 770
607 iso_pu_bacteria 2922425934 2922428376 770

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00884

Sulfatase

Sulfatase

85

499

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7all-assembly1.cif.gz_AAA a single sulfatase is required for metabolism of colonic mucin o-glycans and intestinal colonization by a symbiotic human gut bacterium (bt4683-s1_4) 0.8636 62 574
4cxu-assembly2.cif.gz_B g4 mutant of pas, arylsulfatase from pseudomonas aeruginosa, in complex with 3-br-phenolphenylphosphonate 0.8142 57 569
4cys-assembly1.cif.gz_A g6 mutant of pas, arylsulfatase from pseudomonas aeruginosa, in complex with phenylphosphonic acid 0.8112 62 569
5aj9-assembly2.cif.gz_B g7 mutant of pas, arylsulfatase from pseudomonas aeruginosa 0.8109 49 569
4cxs-assembly1.cif.gz_A g4 mutant of pas, arylsulfatase from pseudomonas aeruginosa, in complex with phenylphosphonic acid 0.8092 57 569
ID Description Score Start End Superfamily
af_O65931_763_970_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.9237 590 769 2.60.120.200
af_O65931_209_662_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.9158 62 477 3.40.720.10
af_P95059_35_492_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.9117 61 476 3.40.720.10
af_I6XVW9_41_489_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.8805 50 482 3.40.720.10
af_I6XVW9_490_582_3.30.1120.10 Alpha Beta;2-Layer Sandwich;Arylsulfatase, C-terminal domain; 0.8582 483 576 3.30.1120.10
ID Description Score Start End GO Terms
AF-A0A354UZ51-F1-model_v4 Arylsulfatase 0.9898 584 766
AF-A0A354UZ51-F1-model_v4 Arylsulfatase 0.9739 584 766
AF-A0A849EZL6-F1-model_v4 Arylsulfatase 0.9693 600 767
AF-Q1MH11-F1-model_v4 Arylsulfatase (EC 3.1.6.1) 0.9478 51 767 GO:0004065
AF-A0A529U481-F1-model_v4 Arylsulfatase 0.946 51 765 GO:0016787

Feature Viewer

pLDDT pTM Quality
76.59 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map