F468571

General Info

Members Datasets Scaffolds Average Seq Length
606 253 606 179

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_100441043|Ga0068863_1004410432
Length 204
Sequence MKIVIVGCGRVGSVLADAFDTGGHDVVVLDLSTRAFDRLPPEFRGQAVRGDGTDEDVLRRVGAAGADVFLALTEGDNRNVMAAQIAAENLGVGRAVAKINDPVRAAAYAELGIATICRTTMLSDAIQSYLGLAPSGIPAIISPVAPHHEGGHRGHVVSVKTGTGSATASGASHPGSASGVIGADIAAGPGGFAVGPSTYIGRGS

Samples

Sample ID Description Type Environment
1 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
143 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
153 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
154 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
155 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
161 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
162 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
163 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
164 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
165 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
166 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
167 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
168 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
169 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
170 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
171 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
172 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
173 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
174 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
175 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
176 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
178 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
179 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
180 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
181 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
182 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
183 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
184 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
185 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
186 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
187 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
188 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
189 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
190 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
191 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
192 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
223 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
224 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
225 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
226 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
227 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
228 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
229 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
230 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
231 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
232 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
233 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
236 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
238 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
241 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
242 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
243 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
244 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
245 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
246 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
247 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
248 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
249 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
250 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
251 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
252 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
253 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.17
Nodule 0
Rhizoplane 10.23
Rhizosphere 88.94
Stem 0
Stem Tuber 0
Unclassified 0.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24033J26618_1043090 3300002155 Bacteria 634
2 rootH2_10207323 3300003320 Bacteria 1212
3 Ga0065712_10310632 3300005290 Bacteria 844
4 Ga0070683_100064436 3300005329 Bacteria 3411
5 Ga0070683_100103595 3300005329 Bacteria 2682
6 Ga0070683_100137670 3300005329 Bacteria 2313
7 Ga0070690_100062959 3300005330 Bacteria 2393
8 Ga0070690_100081815 3300005330 Bacteria 2114
9 Ga0070670_100066032 3300005331 Bacteria 3104
10 Ga0068869_100090240 3300005334 Bacteria 2303
11 Ga0068869_100178432 3300005334 Bacteria 1664
12 Ga0070666_10105858 3300005335 Bacteria 1943
13 Ga0070666_10147333 3300005335 Bacteria 1641
14 Ga0070666_10158427 3300005335 Bacteria 1582
15 Ga0070680_100000134 3300005336 Bacteria 44837
16 Ga0068868_100094516 3300005338 Bacteria 2412
17 Ga0070660_100142006 3300005339 Bacteria 1927
18 Ga0070689_100052797 3300005340 Bacteria 3144
19 Ga0070691_10047426 3300005341 Bacteria 2043
20 Ga0070691_10206828 3300005341 Bacteria 1034
21 Ga0070687_100044368 3300005343 Bacteria 2264
22 Ga0070687_100136247 3300005343 Bacteria 1424
23 Ga0070661_100052224 3300005344 Bacteria 2992
24 Ga0070692_10070762 3300005345 Bacteria 1858
25 Ga0070668_100060988 3300005347 Bacteria 2922
26 Ga0070668_100399613 3300005347 Unclassified 1173
27 Ga0070675_100029483 3300005354 Bacteria 4426
28 Ga0070675_100065348 3300005354 Bacteria 3007
29 Ga0070671_100516905 3300005355 Bacteria 1028
30 Ga0070674_100002297 3300005356 Bacteria 10555
31 Ga0070674_100029435 3300005356 Bacteria 3618
32 Ga0070674_101205706 3300005356 Bacteria 672
33 Ga0070673_100220038 3300005364 Bacteria 1643
34 Ga0070673_100424277 3300005364 Bacteria 1193
35 Ga0070688_100028645 3300005365 Bacteria 3327
36 Ga0070688_100136398 3300005365 Bacteria 1662
37 Ga0070659_100107774 3300005366 Bacteria 2247
38 Ga0070659_100430448 3300005366 Bacteria 1117
39 Ga0070667_100144574 3300005367 Bacteria 2085
40 Ga0070667_100915633 3300005367 Bacteria 816
41 Ga0070713_101522688 3300005436 Bacteria 649
42 Ga0070701_10031190 3300005438 Bacteria 2643
43 Ga0070701_10249210 3300005438 Bacteria 1072
44 Ga0070705_100003133 3300005440 Bacteria 8133
45 Ga0070705_100094532 3300005440 Bacteria 1872
46 Ga0070705_100209235 3300005440 Unclassified 1343
47 Ga0070705_100517526 3300005440 Unclassified 909
48 Ga0070705_100530750 3300005440 Bacteria 899
49 Ga0070700_100032112 3300005441 Bacteria 3153
50 Ga0070700_100371532 3300005441 Bacteria 1067
51 Ga0070700_100541110 3300005441 Unclassified 903
52 Ga0070694_100142946 3300005444 Bacteria 1740
53 Ga0070694_100249423 3300005444 Bacteria 1342
54 Ga0070694_100360603 3300005444 Bacteria 1129
55 Ga0070694_100374560 3300005444 Bacteria 1109
56 Ga0070708_100091190 3300005445 Bacteria 2775
57 Ga0070663_100341494 3300005455 Bacteria 1210
58 Ga0070678_100051942 3300005456 Bacteria 2974
59 Ga0070678_100712803 3300005456 Bacteria 905
60 Ga0070678_101186919 3300005456 Bacteria 707
61 Ga0070662_100130990 3300005457 Bacteria 1933
62 Ga0070662_101027549 3300005457 Bacteria 706
63 Ga0068867_100035743 3300005459 Bacteria 3604
64 Ga0068867_100527744 3300005459 Archaea 1019
65 Ga0068867_100761677 3300005459 Bacteria 860
66 Ga0070685_10032323 3300005466 Bacteria 2930
67 Ga0070685_10347410 3300005466 Unclassified 1013
68 Ga0070706_100030262 3300005467 Bacteria 4987
69 Ga0070706_100281590 3300005467 Bacteria 1552
70 Ga0070706_100310277 3300005467 Bacteria 1471
71 Ga0070706_100882344 3300005467 Bacteria 826
72 Ga0070707_100011609 3300005468 Bacteria 8220
73 Ga0070707_100050041 3300005468 Bacteria 4006
74 Ga0070698_100017220 3300005471 Bacteria 7614
75 Ga0070698_100036854 3300005471 Bacteria 5047
76 Ga0070698_100065056 3300005471 Bacteria 3672
77 Ga0070698_100255838 3300005471 Bacteria 1683
78 Ga0070698_100348786 3300005471 Bacteria 1412
79 Ga0070699_100003754 3300005518 Bacteria 13418
80 Ga0070699_100015507 3300005518 Bacteria 6550
81 Ga0070699_100151924 3300005518 Bacteria 2048
82 Ga0070699_100176520 3300005518 Bacteria 1894
83 Ga0070699_100185896 3300005518 Bacteria 1845
84 Ga0070699_100224972 3300005518 Bacteria 1672
85 Ga0070679_100336819 3300005530 Unclassified 1457
86 Ga0070679_100336869 3300005530 Bacteria 1457
87 Ga0070684_100007895 3300005535 Bacteria 8302
88 Ga0070697_100188744 3300005536 Bacteria 1749
89 Ga0070697_100327810 3300005536 Bacteria 1319
90 Ga0070697_100510676 3300005536 Bacteria 1051
91 Ga0070672_101658258 3300005543 Bacteria 574
92 Ga0070686_100019781 3300005544 Bacteria 3973
93 Ga0070695_100007766 3300005545 Bacteria 6354
94 Ga0070695_100021196 3300005545 Bacteria 3973
95 Ga0070695_100036123 3300005545 Bacteria 3108
96 Ga0070695_100438942 3300005545 Bacteria 998
97 Ga0070696_100001444 3300005546 Bacteria 15551
98 Ga0070696_100016959 3300005546 Bacteria 4912
99 Ga0070696_100044409 3300005546 Bacteria 3077
100 Ga0070696_100063837 3300005546 Bacteria 2580
101 Ga0070696_100162227 3300005546 Bacteria 1647
102 Ga0070693_100030766 3300005547 Bacteria 2937
103 Ga0070693_100134014 3300005547 Bacteria 1552
104 Ga0070704_100051727 3300005549 Bacteria 2895
105 Ga0070704_100092410 3300005549 Unclassified 2259
106 Ga0070704_100918778 3300005549 Bacteria 788
107 Ga0070664_100028977 3300005564 Bacteria 4612
108 Ga0070664_100081220 3300005564 Bacteria 2793
109 Ga0068857_100079008 3300005577 Bacteria 2937
110 Ga0068857_100120634 3300005577 Bacteria 2360
111 Ga0068854_100186395 3300005578 Bacteria 1624
112 Ga0068854_100292859 3300005578 Unclassified 1314
113 Ga0068854_100377908 3300005578 Bacteria 1167
114 Ga0068854_100468983 3300005578 Unclassified 1055
115 Ga0070702_100020277 3300005615 Bacteria 3479
116 Ga0070702_100058743 3300005615 Bacteria 2229
117 Ga0070702_100352072 3300005615 Bacteria 1037
118 Ga0070702_100623450 3300005615 Bacteria 812
119 Ga0070702_100635603 3300005615 Unclassified 805
120 Ga0070702_101061753 3300005615 Bacteria 645
121 Ga0068852_100127979 3300005616 Bacteria 2335
122 Ga0068859_100122105 3300005617 Bacteria 2672
123 Ga0068859_100130071 3300005617 Bacteria 2589
124 Ga0068859_100386817 3300005617 Bacteria 1494
125 Ga0068864_100055123 3300005618 Bacteria 3432
126 Ga0068864_100136550 3300005618 Bacteria 2208
127 Ga0068864_100407001 3300005618 Bacteria 1294
128 Ga0068864_100642633 3300005618 Unclassified 1032
129 Ga0068861_100155266 3300005719 Bacteria 1882
130 Ga0068870_10317247 3300005840 Archaea 989
131 Ga0068863_100441043 3300005841 Bacteria 1277
132 Ga0068858_100110747 3300005842 Bacteria 2564
133 Ga0068858_100166459 3300005842 Bacteria 2077
134 Ga0068858_100368171 3300005842 Bacteria 1378
135 Ga0068860_100066580 3300005843 Bacteria 3422
136 Ga0068860_100377112 3300005843 Bacteria 1400
137 Ga0068860_100478649 3300005843 Bacteria 1241
138 Ga0081538_10058578 3300005981 Bacteria 2232
139 Ga0075428_100000081 3300006844 Bacteria 80139
140 Ga0075433_10027393 3300006852 Bacteria 4833
141 Ga0075433_10162650 3300006852 Bacteria 1987
142 Ga0075433_10175246 3300006852 Bacteria 1908
143 Ga0075433_10580392 3300006852 Unclassified 985
144 Ga0075434_100189333 3300006871 Bacteria 2078
145 Ga0075434_100434777 3300006871 Bacteria 1333
146 Ga0075434_101355402 3300006871 Unclassified 722
147 Ga0068865_100034661 3300006881 Bacteria 3388
148 Ga0068865_100268411 3300006881 Bacteria 1354
149 Ga0068865_101107214 3300006881 Bacteria 698
150 Ga0075436_100124453 3300006914 Bacteria 1806
151 Ga0097620_100122105 3300006931 Bacteria 2672
152 Ga0097620_100130064 3300006931 Bacteria 2589
153 Ga0097620_100386817 3300006931 Bacteria 1494
154 Ga0075435_100198867 3300007076 Bacteria 1698
155 Ga0075435_100230734 3300007076 Bacteria 1573
156 Ga0075435_100283074 3300007076 Bacteria 1416
157 Ga0105240_11398120 3300009093 Unclassified 736
158 Ga0111539_10075232 3300009094 Bacteria 3979
159 Ga0111539_10167123 3300009094 Bacteria 2571
160 Ga0111539_10180335 3300009094 Bacteria 2467
161 Ga0111539_10206461 3300009094 Bacteria 2290
162 Ga0111539_10640243 3300009094 Bacteria 1238
163 Ga0105245_10065283 3300009098 Bacteria 3291
164 Ga0105245_10219520 3300009098 Bacteria 1834
165 Ga0105245_10300560 3300009098 Archaea 1575
166 Ga0105245_10306333 3300009098 Bacteria 1560
167 Ga0105245_10552256 3300009098 Bacteria 1174
168 Ga0105245_11093589 3300009098 Bacteria 843
169 Ga0105247_10079062 3300009101 Bacteria 2069
170 Ga0105247_10490050 3300009101 Bacteria 894
171 Ga0114129_10000286 3300009147 Bacteria 58249
172 Ga0114129_10059198 3300009147 Bacteria 5356
173 Ga0114129_10112316 3300009147 Bacteria 3758
174 Ga0114129_10227632 3300009147 Bacteria 2512
175 Ga0114129_10427475 3300009147 Bacteria 1741
176 Ga0105243_10103364 3300009148 Bacteria 2369
177 Ga0105243_10331590 3300009148 Bacteria 1390
178 Ga0105243_10400705 3300009148 Bacteria 1274
179 Ga0105242_10040949 3300009176 Bacteria 3734
180 Ga0105242_10174326 3300009176 Bacteria 1892
181 Ga0105242_10920577 3300009176 Unclassified 876
182 Ga0105248_10347350 3300009177 Bacteria 1670
183 Ga0105249_10016351 3300009553 Bacteria 6581
184 Ga0105249_10310654 3300009553 Bacteria 1585
185 Ga0105249_10786594 3300009553 Bacteria 1015
186 Ga0105239_10064710 3300010375 Bacteria 4014
187 Ga0105239_10117374 3300010375 Bacteria 2953
188 Ga0105239_10226337 3300010375 Bacteria 2098
189 Ga0105239_10263175 3300010375 Bacteria 1938
190 Ga0105246_10968191 3300011119 Archaea 768
191 Ga0157374_10197069 3300013296 Bacteria 1971
192 Ga0157374_10359075 3300013296 Bacteria 1448
193 Ga0157374_10440776 3300013296 Bacteria 1303
194 Ga0157378_10020444 3300013297 Bacteria 5820
195 Ga0157378_10117992 3300013297 Bacteria 2442
196 Ga0157378_10126946 3300013297 Bacteria 2357
197 Ga0163162_10285585 3300013306 Bacteria 1782
198 Ga0163162_10293228 3300013306 Bacteria 1758
199 Ga0157372_11037979 3300013307 Unclassified 949
200 Ga0157375_10100546 3300013308 Bacteria 2973
201 Ga0157375_10239640 3300013308 Bacteria 1973
202 Ga0163163_10029494 3300014325 Bacteria 5278
203 Ga0163163_10192559 3300014325 Bacteria 2087
204 Ga0163163_10413938 3300014325 Bacteria 1407
205 Ga0157380_10052058 3300014326 Bacteria 3241
206 Ga0157380_10123663 3300014326 Bacteria 2196
207 Ga0157380_10468457 3300014326 Unclassified 1215
208 Ga0157380_10667330 3300014326 Bacteria 1040
209 Ga0157377_10001869 3300014745 Bacteria 9218
210 Ga0157379_10100475 3300014968 Bacteria 2596
211 Ga0157379_10271208 3300014968 Bacteria 1543
212 Ga0157376_10267104 3300014969 Unclassified 1605
213 Ga0157376_10302259 3300014969 Bacteria 1515
214 Ga0163161_10032714 3300017792 Bacteria 3715
215 Ga0163161_10084468 3300017792 Bacteria 2341
216 Ga0207642_10162570 3300025899 Unclassified 1200
217 Ga0207710_10188032 3300025900 Bacteria 1016
218 Ga0207688_10041112 3300025901 Bacteria 2570
219 Ga0207680_10239073 3300025903 Bacteria 1251
220 Ga0207647_10491508 3300025904 Bacteria 685
221 Ga0207645_10211078 3300025907 Unclassified 1279
222 Ga0207645_10515822 3300025907 Bacteria 810
223 Ga0207643_10013222 3300025908 Bacteria 4466
224 Ga0207643_10296911 3300025908 Bacteria 1005
225 Ga0207684_10026076 3300025910 Bacteria 4982
226 Ga0207684_10032815 3300025910 Bacteria 4415
227 Ga0207684_10373721 3300025910 Bacteria 1226
228 Ga0207684_10529101 3300025910 Archaea 1009
229 Ga0207660_10000003 3300025917 Bacteria 675759
230 Ga0207660_10038715 3300025917 Bacteria 3329
231 Ga0207660_10221634 3300025917 Bacteria 1485
232 Ga0207662_10004376 3300025918 Bacteria 7422
233 Ga0207662_10013277 3300025918 Bacteria 4605
234 Ga0207662_10197463 3300025918 Bacteria 1301
235 Ga0207662_10238478 3300025918 Bacteria 1190
236 Ga0207657_10038787 3300025919 Bacteria 4237
237 Ga0207657_10288103 3300025919 Bacteria 1303
238 Ga0207649_10153341 3300025920 Bacteria 1589
239 Ga0207652_11309259 3300025921 Bacteria 627
240 Ga0207646_10019084 3300025922 Bacteria 6379
241 Ga0207646_10053500 3300025922 Bacteria 3611
242 Ga0207681_10849101 3300025923 Bacteria 764
243 Ga0207650_10077144 3300025925 Bacteria 2518
244 Ga0207659_10032745 3300025926 Bacteria 3571
245 Ga0207659_10035808 3300025926 Bacteria 3434
246 Ga0207687_10018276 3300025927 Bacteria 4626
247 Ga0207687_10053690 3300025927 Bacteria 2817
248 Ga0207687_10077918 3300025927 Bacteria 2385
249 Ga0207687_10454604 3300025927 Unclassified 1063
250 Ga0207644_10624973 3300025931 Bacteria 895
251 Ga0207690_10047921 3300025932 Bacteria 2838
252 Ga0207690_10115899 3300025932 Bacteria 1937
253 Ga0207690_10177968 3300025932 Bacteria 1599
254 Ga0207706_10128590 3300025933 Bacteria 2228
255 Ga0207706_10497484 3300025933 Bacteria 1052
256 Ga0207706_10549884 3300025933 Bacteria 994
257 Ga0207706_10830141 3300025933 Bacteria 784
258 Ga0207686_10149658 3300025934 Bacteria 1623
259 Ga0207686_10163013 3300025934 Bacteria 1565
260 Ga0207686_10333246 3300025934 Bacteria 1137
261 Ga0207686_10659442 3300025934 Bacteria 828
262 Ga0207709_10095031 3300025935 Bacteria 1958
263 Ga0207709_10595435 3300025935 Bacteria 875
264 Ga0207670_10089705 3300025936 Bacteria 2170
265 Ga0207670_10654469 3300025936 Bacteria 866
266 Ga0207669_10006962 3300025937 Bacteria 5202
267 Ga0207669_10082158 3300025937 Bacteria 2067
268 Ga0207669_10520165 3300025937 Bacteria 955
269 Ga0207704_10125313 3300025938 Bacteria 1767
270 Ga0207704_10347697 3300025938 Bacteria 1153
271 Ga0207704_11293995 3300025938 Unclassified 623
272 Ga0207665_10149488 3300025939 Bacteria 1672
273 Ga0207691_10607353 3300025940 Bacteria 926
274 Ga0207661_10057431 3300025944 Bacteria 3129
275 Ga0207661_10318641 3300025944 Bacteria 1397
276 Ga0207679_10041494 3300025945 Bacteria 3300
277 Ga0207679_10137652 3300025945 Bacteria 1968
278 Ga0207651_10151420 3300025960 Unclassified 1806
279 Ga0207651_10204713 3300025960 Bacteria 1584
280 Ga0207712_10016523 3300025961 Bacteria 4782
281 Ga0207712_10248658 3300025961 Unclassified 1436
282 Ga0207712_10728292 3300025961 Bacteria 867
283 Ga0207668_10016757 3300025972 Bacteria 4581
284 Ga0207640_10119471 3300025981 Unclassified 1885
285 Ga0207640_10143857 3300025981 Bacteria 1742
286 Ga0207640_10182175 3300025981 Unclassified 1576
287 Ga0207640_10367279 3300025981 Bacteria 1162
288 Ga0207640_10467679 3300025981 Unclassified 1043
289 Ga0207658_10337393 3300025986 Bacteria 1309
290 Ga0207677_10166417 3300026023 Bacteria 1719
291 Ga0207677_10445396 3300026023 Bacteria 1108
292 Ga0207677_10585810 3300026023 Bacteria 977
293 Ga0207703_10039077 3300026035 Bacteria 3791
294 Ga0207703_10179464 3300026035 Bacteria 1868
295 Ga0207703_10233372 3300026035 Bacteria 1650
296 Ga0207703_10238115 3300026035 Bacteria 1635
297 Ga0207703_10259901 3300026035 Bacteria 1569
298 Ga0207639_10052867 3300026041 Bacteria 3097
299 Ga0207678_10009134 3300026067 Bacteria 8730
300 Ga0207708_10020062 3300026075 Bacteria 5039
301 Ga0207708_10192731 3300026075 Bacteria 1623
302 Ga0207708_10447363 3300026075 Bacteria 1075
303 Ga0207708_10468849 3300026075 Bacteria 1051
304 Ga0207708_10489307 3300026075 Bacteria 1030
305 Ga0207641_10607110 3300026088 Bacteria 1072
306 Ga0207648_10027240 3300026089 Bacteria 5076
307 Ga0207648_10448162 3300026089 Bacteria 1175
308 Ga0207648_10745271 3300026089 Bacteria 909
309 Ga0207676_10046017 3300026095 Bacteria 3374
310 Ga0207676_10226715 3300026095 Bacteria 1668
311 Ga0207676_10429308 3300026095 Bacteria 1241
312 Ga0207674_10103007 3300026116 Bacteria 2834
313 Ga0207674_10163409 3300026116 Bacteria 2181
314 Ga0207675_100135988 3300026118 Bacteria 2332
315 Ga0207675_100816390 3300026118 Bacteria 946
316 Ga0207683_10059592 3300026121 Bacteria 3353
317 Ga0207683_10082807 3300026121 Bacteria 2851
318 Ga0207683_10101982 3300026121 Bacteria 2562
319 Ga0207683_10776000 3300026121 Bacteria 889
320 Ga0207698_10086979 3300026142 Bacteria 2544
321 Ga0207698_10941219 3300026142 Bacteria 873
322 Ga0207698_11557966 3300026142 Bacteria 676
323 Ga0209970_1015682 3300027614 Bacteria 1261
324 Ga0209974_10031044 3300027876 Bacteria 1769
325 Ga0209974_10125852 3300027876 Bacteria 911
326 Ga0207428_10136644 3300027907 Bacteria 1874
327 Ga0268264_10204597 3300028381 Bacteria 1808
328 Ga0268264_10838524 3300028381 Bacteria 920
329 Ga0265319_1031935 3300028563 Bacteria 1829
330 Ga0265318_10030041 3300028577 Bacteria 2115
331 Ga0265318_10082705 3300028577 Bacteria 1185
332 Ga0307405_10006860 3300031731 Bacteria 5646
333 Ga0307410_10275799 3300031852 Bacteria 1317
334 Ga0307406_10734946 3300031901 Unclassified 827
335 Ga0307407_10241213 3300031903 Bacteria 1233
336 Ga0307412_10055787 3300031911 Bacteria 2630
337 Ga0307409_100056392 3300031995 Bacteria 3038
338 Ga0307409_100196417 3300031995 Bacteria 1801
339 Ga0307416_100008438 3300032002 Bacteria 6650
340 Ga0307415_100000485 3300032126 Bacteria 17218
341 Ga0316583_10054123 3300032133 Bacteria 1411
342 Ga0373938_0037889 3300034957 Unclassified 1061
343 Ga0373951_0037198 3300035091 Bacteria 1164
344 Ga0373936_0174989 3300035113 Bacteria 940
345 Ga0373937_0494551 3300036401 Bacteria 1162
346 Ga0373925_0028631 3300037068 Bacteria 4082
347 Ga0395900_0193037 3300037418 Bacteria 2065
348 Ga0395901_0258517 3300038443 Bacteria 1813
349 Ga0436365_0424093 3300039437 Bacteria 2251
350 Ga0439438_046608 3300041405 Bacteria 1113
351 Ga0439465_0057052 3300041413 Unclassified 1288
352 Ga0439465_0082078 3300041413 Bacteria 1094
353 Ga0451853_1213754 3300041512 Bacteria 647
354 Ga0451853_3877138 3300041512 Unclassified 1262
355 Ga0450911_020949 3300042115 Bacteria 853
356 Ga0450915_001242 3300042119 Unclassified 1150
357 Ga0450920_029980 3300042122 Bacteria 1069
358 Ga0450910_008348 3300042147 Unclassified 1455
359 Ga0453683_0158171 3300044673 Bacteria 1433
360 Ga0466960_0657101 3300044901 Bacteria 626
361 Ga0495592_0549053 3300046454 Unclassified 711
362 Ga0495603_0284019 3300046455 Bacteria 951
363 Ga0495629_0201271 3300046459 Bacteria 1377
364 Ga0495651_0047296 3300046462 Bacteria 3327
365 Ga0495664_0192875 3300046477 Bacteria 1235
366 Ga0495608_0152425 3300046511 Bacteria 1473
367 Ga0495618_0508301 3300046514 Unclassified 726
368 Ga0495630_0053962 3300046517 Bacteria 3011
369 Ga0495630_0777716 3300046517 Bacteria 731
370 Ga0495631_0199061 3300046518 Unclassified 857
371 Ga0495652_0347776 3300046529 Bacteria 1063
372 Ga0495640_0040555 3300046533 Bacteria 3260
373 Ga0495587_0494275 3300046536 Unclassified 677
374 Ga0495656_0067581 3300046615 Bacteria 1578
375 Ga0495635_0235747 3300046663 Bacteria 1235
376 Ga0495657_0209464 3300046675 Unclassified 1185
377 Ga0495599_0089943 3300046678 Bacteria 1916
378 Ga0495658_0154799 3300046683 Bacteria 1410
379 Ga0495613_0456666 3300046689 Bacteria 865
380 Ga0495604_0308538 3300047317 Unclassified 1061
381 Ga0495674_0039941 3300047319 Bacteria 4201
382 Ga0495676_0297437 3300047321 Bacteria 1089
383 Ga0495680_0142532 3300047322 Bacteria 1752
384 Ga0495684_0440179 3300047471 Bacteria 908
385 Ga0496100_0142595 3300048903 Unclassified 1700
386 Ga0496101_0070103 3300048904 Bacteria 2566
387 Ga0496101_0090494 3300048904 Bacteria 2276
388 Ga0496101_0281032 3300048904 Bacteria 1301
389 Ga0496101_0394618 3300048904 Bacteria 1089
390 Ga0496102_0102003 3300048905 Bacteria 2667
391 Ga0496102_0117047 3300048905 Bacteria 2487
392 Ga0496102_0171552 3300048905 Bacteria 2042
393 Ga0496102_0217576 3300048905 Bacteria 1800
394 Ga0496102_0309375 3300048905 Bacteria 1489
395 Ga0496102_0395383 3300048905 Bacteria 1300
396 Ga0496102_0406828 3300048905 Unclassified 1279
397 Ga0496103_0107972 3300048906 Bacteria 1766
398 Ga0496103_0154369 3300048906 Bacteria 1471
399 Ga0496104_0014646 3300048907 Bacteria 7085
400 Ga0496104_0244608 3300048907 Bacteria 1706
401 Ga0496105_0010353 3300048908 Bacteria 7332
402 Ga0496105_0012161 3300048908 Bacteria 6816
403 Ga0496105_0164536 3300048908 Bacteria 1820
404 Ga0496105_0256949 3300048908 Bacteria 1414
405 Ga0496106_0029255 3300048909 Bacteria 4105
406 Ga0496106_0070989 3300048909 Bacteria 2661
407 Ga0496106_0140947 3300048909 Archaea 1896
408 Ga0496106_0379419 3300048909 Bacteria 1136
409 Ga0496107_0045040 3300048910 Bacteria 3173
410 Ga0496107_0093075 3300048910 Bacteria 2204
411 Ga0496107_0184924 3300048910 Unclassified 1548
412 Ga0496107_0281039 3300048910 Bacteria 1239
413 Ga0496108_0006475 3300048911 Bacteria 9498
414 Ga0496108_0011005 3300048911 Bacteria 7347
415 Ga0496108_0052532 3300048911 Bacteria 3415
416 Ga0496108_0102209 3300048911 Bacteria 2446
417 Ga0496108_0126390 3300048911 Bacteria 2195
418 Ga0496108_0129818 3300048911 Bacteria 2166
419 Ga0496108_0271642 3300048911 Bacteria 1476
420 Ga0496108_0576704 3300048911 Unclassified 981
421 Ga0496108_0583406 3300048911 Bacteria 974
422 Ga0496109_0014960 3300048912 Bacteria 6753
423 Ga0496109_0022099 3300048912 Bacteria 5630
424 Ga0496109_0092920 3300048912 Bacteria 2790
425 Ga0496109_0332416 3300048912 Unclassified 1435
426 Ga0496109_1143428 3300048912 Bacteria 715
427 Ga0496110_0001806 3300048913 Bacteria 15766
428 Ga0496110_0057303 3300048913 Bacteria 3430
429 Ga0496110_0178401 3300048913 Bacteria 1928
430 Ga0496111_0012580 3300048914 Bacteria 5735
431 Ga0496111_0014039 3300048914 Bacteria 5463
432 Ga0496111_0182853 3300048914 Bacteria 1558
433 Ga0496111_0281756 3300048914 Bacteria 1233
434 Ga0496112_0038239 3300048915 Bacteria 4686
435 Ga0496112_0053720 3300048915 Bacteria 3957
436 Ga0496112_1029318 3300048915 Bacteria 743
437 Ga0496113_0006477 3300048916 Bacteria 7428
438 Ga0496113_0006880 3300048916 Bacteria 7256
439 Ga0496113_0151054 3300048916 Bacteria 1832
440 Ga0496113_0153732 3300048916 Unclassified 1816
441 Ga0496113_0226107 3300048916 Bacteria 1492
442 Ga0496114_0003659 3300048917 Bacteria 11828
443 Ga0496114_0055700 3300048917 Bacteria 3298
444 Ga0496114_0306903 3300048917 Bacteria 1401
445 Ga0496114_0312005 3300048917 Bacteria 1389
446 Ga0496114_0682866 3300048917 Bacteria 901
447 Ga0501031_0011173 3300049568 Bacteria 5851
448 Ga0501031_0116706 3300049568 Bacteria 1744
449 Ga0501031_0226065 3300049568 Bacteria 1218
450 Ga0501032_0114856 3300049569 Bacteria 1780
451 Ga0501032_0305233 3300049569 Bacteria 1029
452 Ga0501033_0020094 3300049570 Bacteria 5050
453 Ga0501033_0368178 3300049570 Bacteria 1005
454 Ga0501034_0398710 3300049571 Bacteria 1299
455 Ga0501036_0045777 3300049572 Bacteria 3705
456 Ga0501036_0080425 3300049572 Bacteria 2755
457 Ga0501036_0845709 3300049572 Bacteria 752
458 Ga0501037_0059061 3300049573 Bacteria 2798
459 Ga0501037_0379183 3300049573 Unclassified 972
460 Ga0501038_0046990 3300049574 Bacteria 3740
461 Ga0501038_0473903 3300049574 Unclassified 960
462 Ga0501039_0033869 3300049575 Bacteria 3941
463 Ga0501039_0038276 3300049575 Bacteria 3704
464 Ga0501039_0041137 3300049575 Bacteria 3569
465 Ga0501039_0127359 3300049575 Bacteria 1998
466 Ga0501039_0226855 3300049575 Bacteria 1468
467 Ga0501040_0036607 3300049576 Bacteria 3331
468 Ga0501040_0195231 3300049576 Bacteria 1437
469 Ga0501040_0406533 3300049576 Bacteria 978
470 Ga0501040_0638028 3300049576 Unclassified 770
471 Ga0501041_0030262 3300049577 Bacteria 3267
472 Ga0501041_0070533 3300049577 Bacteria 2145
473 Ga0501041_0165902 3300049577 Bacteria 1381
474 Ga0501041_0300635 3300049577 Bacteria 1011
475 Ga0501041_0499807 3300049577 Bacteria 774
476 Ga0501042_0006802 3300049578 Bacteria 7455
477 Ga0501042_0014139 3300049578 Bacteria 5443
478 Ga0501042_0101600 3300049578 Bacteria 2068
479 Ga0501042_0232769 3300049578 Bacteria 1329
480 Ga0501042_0269550 3300049578 Bacteria 1229
481 Ga0501043_0034388 3300049579 Bacteria 3986
482 Ga0501043_0234766 3300049579 Bacteria 1416
483 Ga0501046_0008570 3300049580 Bacteria 8900
484 Ga0501046_0057418 3300049580 Bacteria 3053
485 Ga0501046_0071021 3300049580 Bacteria 2706
486 Ga0501046_0485416 3300049580 Bacteria 886
487 Ga0501048_0041492 3300049582 Bacteria 3295
488 Ga0501048_0051271 3300049582 Bacteria 2938
489 Ga0501048_0079344 3300049582 Bacteria 2316
490 Ga0501048_0221811 3300049582 Bacteria 1341
491 Ga0501048_0288852 3300049582 Unclassified 1166
492 Ga0501048_0303129 3300049582 Unclassified 1137
493 Ga0501067_0004598 3300049583 Bacteria 7637
494 Ga0501067_0005790 3300049583 Bacteria 6860
495 Ga0501068_0031266 3300049584 Bacteria 3161
496 Ga0501068_0036470 3300049584 Bacteria 2940
497 Ga0501069_0013770 3300049585 Bacteria 4315
498 Ga0501069_0101002 3300049585 Bacteria 1637
499 Ga0501069_0210864 3300049585 Bacteria 1127
500 Ga0501070_0655658 3300049586 Bacteria 833
501 Ga0501071_0049051 3300049587 Bacteria 3038
502 Ga0501071_0305443 3300049587 Bacteria 1206
503 Ga0501072_0048206 3300049588 Bacteria 3355
504 Ga0501072_0049552 3300049588 Bacteria 3306
505 Ga0501072_0094579 3300049588 Bacteria 2374
506 Ga0501072_0110187 3300049588 Bacteria 2191
507 Ga0501072_0341827 3300049588 Bacteria 1189
508 Ga0501072_0726942 3300049588 Bacteria 779
509 Ga0501073_0089665 3300049589 Bacteria 2138
510 Ga0501073_0094558 3300049589 Bacteria 2076
511 Ga0501074_0025446 3300049590 Bacteria 4298
512 Ga0501074_0052080 3300049590 Bacteria 2955
513 Ga0501074_0111028 3300049590 Bacteria 1962
514 Ga0501074_0138837 3300049590 Bacteria 1739
515 Ga0501074_0275086 3300049590 Bacteria 1197
516 Ga0501074_0398974 3300049590 Bacteria 975
517 Ga0501075_0021921 3300049591 Unclassified 4662
518 Ga0501075_0039532 3300049591 Bacteria 3530
519 Ga0501075_0085279 3300049591 Bacteria 2393
520 Ga0501075_0106284 3300049591 Bacteria 2133
521 Ga0501075_0128406 3300049591 Bacteria 1930
522 Ga0501075_0172197 3300049591 Bacteria 1652
523 Ga0501076_0000785 3300049592 Bacteria 20486
524 Ga0501076_0034349 3300049592 Bacteria 3963
525 Ga0501076_0042413 3300049592 Bacteria 3582
526 Ga0501076_0358237 3300049592 Bacteria 1198
527 Ga0501076_0468933 3300049592 Bacteria 1037
528 Ga0501077_0025536 3300049593 Bacteria 3752
529 Ga0501077_0055842 3300049593 Bacteria 2507
530 Ga0501077_0062655 3300049593 Bacteria 2359
531 Ga0501077_0139500 3300049593 Bacteria 1537
532 Ga0501077_0449462 3300049593 Unclassified 825
533 Ga0501079_0010017 3300049741 Bacteria 7194
534 Ga0501079_0020541 3300049741 Bacteria 5049
535 Ga0501079_0023804 3300049741 Bacteria 4699
536 Ga0501079_0024704 3300049741 Bacteria 4611
537 Ga0501079_0041038 3300049741 Bacteria 3571
538 Ga0501079_0079324 3300049741 Bacteria 2539
539 Ga0501079_0406252 3300049741 Unclassified 1068
540 Ga0501080_0039975 3300049742 Bacteria 4377
541 Ga0501080_0080802 3300049742 Bacteria 3021
542 Ga0501080_0375094 3300049742 Bacteria 1282
543 Ga0501081_0004301 3300049743 Bacteria 9125
544 Ga0501081_0015548 3300049743 Bacteria 5023
545 Ga0501081_0376861 3300049743 Bacteria 1048
546 Ga0501081_0714799 3300049743 Unclassified 752
547 Ga0501044_0159661 3300049823 Bacteria 2232
548 Ga0501045_0014808 3300049824 Bacteria 5530
549 Ga0501045_0017373 3300049824 Bacteria 5106
550 Ga0501045_0027453 3300049824 Bacteria 4103
551 Ga0501045_0039389 3300049824 Bacteria 3439
552 Ga0501045_0044246 3300049824 Bacteria 3242
553 Ga0501045_0425328 3300049824 Bacteria 988
554 nmdc:mga0yw44_86053_c1 3300050492 Bacteria 1979
555 nmdc:mga05p37_122021_c1 3300050507 Bacteria 3200
556 nmdc:mga05p37_193426_c1 3300050507 Bacteria 2468
557 nmdc:mga05p37_78430_c1 3300050507 Bacteria 4067
558 nmdc:mga05p37_7_c1 3300050507 Bacteria 154761
559 nmdc:mga06r32_98085_c1 3300050510 Bacteria 2872
560 nmdc:mga08y16_104865_c1 3300050511 Bacteria 2943
561 nmdc:mga08y16_244503_c1 3300050511 Bacteria 1854
562 nmdc:mga08y16_255803_c1 3300050511 Bacteria 1809
563 nmdc:mga08y16_279256_c1 3300050511 Bacteria 1723
564 nmdc:mga08y16_64784_c1 3300050511 Bacteria 3815
565 nmdc:mga0n895_263723_c1 3300050512 Bacteria 1748
566 nmdc:mga0n895_359161_c1 3300050512 Bacteria 1475
567 nmdc:mga0n895_49964_c1 3300050512 Bacteria 4099
568 nmdc:mga0n895_567851_c1 3300050512 Bacteria 1139
569 nmdc:mga0rr50_104412_c1 3300050513 Bacteria 2232
570 nmdc:mga0rr50_109639_c1 3300050513 Bacteria 2182
571 nmdc:mga0rr50_141148_c1 3300050513 Bacteria 1938
572 nmdc:mga0rr50_326678_c1 3300050513 Bacteria 1287
573 nmdc:mga0rr50_826055_c1 3300050513 Bacteria 790
574 nmdc:mga08x19_106897_c1 3300050514 Bacteria 1862
575 nmdc:mga08x19_238722_c1 3300050514 Bacteria 1252
576 nmdc:mga08x19_336839_c1 3300050514 Bacteria 1052
577 nmdc:mga0a205_10879_c1 3300050515 Bacteria 8371
578 nmdc:mga0a205_112884_c1 3300050515 Bacteria 2616
579 nmdc:mga0a205_300824_c1 3300050515 Bacteria 1477
580 nmdc:mga0a205_559936_c1 3300050515 Bacteria 998
581 nmdc:mga0a205_9412_c1 3300050515 Bacteria 8932
582 Ga0495601_0095948 3300053077 Bacteria 1912
583 Ga0495601_0251721 3300053077 Bacteria 1153
584 Ga0495612_0399414 3300053078 Unclassified 624
585 Ga0495595_0093615 3300053084 Bacteria 1444
586 Ga0495619_0037419 3300053085 Bacteria 3162
587 Ga0501084_0006717 3300054114 Bacteria 9456
588 Ga0501084_0024150 3300054114 Bacteria 5071
589 Ga0501084_0028832 3300054114 Bacteria 4640
590 Ga0501084_0038323 3300054114 Bacteria 4007
591 Ga0501084_0147030 3300054114 Bacteria 1985
592 Ga0501084_0324585 3300054114 Bacteria 1300
593 Ga0590075_022586 3300059424 Bacteria 1575
594 Ga0501082_0032123 3300060353 Bacteria 4528
595 Ga0501082_0084276 3300060353 Bacteria 2741
596 Ga0501082_0135629 3300060353 Bacteria 2135
597 Ga0501082_0233652 3300060353 Bacteria 1600
598 Ga0501082_0912233 3300060353 Bacteria 768
599 Ga0530510_0027902 3300061734 Bacteria 4046
600 Ga0530510_0028869 3300061734 Bacteria 3978
601 Ga0530510_0071032 3300061734 Bacteria 2527
602 Ga0530510_0134853 3300061734 Bacteria 1817
603 Ga0530510_0152449 3300061734 Bacteria 1707
604 Ga0530510_0314355 3300061734 Bacteria 1173
605 Ga0530510_0383544 3300061734 Unclassified 1058
606 Ga0530510_0467832 3300061734 Bacteria 954

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041413 Ga0439465_0082078 Ga0439465_0082078_40_585 158
2 3300028577 Ga0265318_10082705 Ga0265318_100827052 161
3 3300006844 Ga0075428_100000081 Ga0075428_10000008162 162
4 3300009147 Ga0114129_10000286 Ga0114129_1000028659 162
5 3300049741 Ga0501079_0406252 Ga0501079_0406252_168_665 162
6 3300050507 nmdc:mga05p37_7_c1 nmdc:mga05p37_7_c1_126166_126663 162
7 3300005530 Ga0070679_100336819 Ga0070679_1003368193 163
8 3300014968 Ga0157379_10271208 Ga0157379_102712083 163
9 3300049575 Ga0501039_0127359 Ga0501039_0127359_842_1381 163
10 3300049578 Ga0501042_0232769 Ga0501042_0232769_365_904 163
11 3300049582 Ga0501048_0221811 Ga0501048_0221811_301_840 163
12 3300049588 Ga0501072_0048206 Ga0501072_0048206_569_1108 163
13 3300049590 Ga0501074_0275086 Ga0501074_0275086_371_910 163
14 3300049592 Ga0501076_0358237 Ga0501076_0358237_242_781 163
15 3300054114 Ga0501084_0024150 Ga0501084_0024150_2309_2878 163
16 3300060353 Ga0501082_0233652 Ga0501082_0233652_315_884 163
17 3300025937 Ga0207669_10520165 Ga0207669_105201652 164
18 3300026075 Ga0207708_10468849 Ga0207708_104688492 164
19 3300036401 Ga0373937_0494551 Ga0373937_0494551_634_1140 164
20 3300041512 Ga0451853_1213754 Ga0451853_1213754_64_570 164
21 3300042115 Ga0450911_020949 Ga0450911_020949_185_790 164
22 3300046454 Ga0495592_0549053 Ga0495592_0549053_78_584 164
23 3300046462 Ga0495651_0047296 Ga0495651_0047296_2196_2702 164
24 3300046477 Ga0495664_0192875 Ga0495664_0192875_470_976 164
25 3300046511 Ga0495608_0152425 Ga0495608_0152425_447_953 164
26 3300046517 Ga0495630_0053962 Ga0495630_0053962_1770_2276 164
27 3300046529 Ga0495652_0347776 Ga0495652_0347776_61_567 164
28 3300046533 Ga0495640_0040555 Ga0495640_0040555_746_1252 164
29 3300046536 Ga0495587_0494275 Ga0495587_0494275_104_610 164
30 3300046663 Ga0495635_0235747 Ga0495635_0235747_251_757 164
31 3300046675 Ga0495657_0209464 Ga0495657_0209464_558_1064 164
32 3300046678 Ga0495599_0089943 Ga0495599_0089943_538_1044 164
33 3300046689 Ga0495613_0456666 Ga0495613_0456666_104_610 164
34 3300047319 Ga0495674_0039941 Ga0495674_0039941_2001_2507 164
35 3300047321 Ga0495676_0297437 Ga0495676_0297437_216_722 164
36 3300047322 Ga0495680_0142532 Ga0495680_0142532_311_817 164
37 3300047471 Ga0495684_0440179 Ga0495684_0440179_271_777 164
38 3300053077 Ga0495601_0251721 Ga0495601_0251721_527_1033 164
39 3300053078 Ga0495612_0399414 Ga0495612_0399414_100_606 164
40 3300053084 Ga0495595_0093615 Ga0495595_0093615_470_976 164
41 3300005536 Ga0070697_100327810 Ga0070697_1003278102 165
42 3300005546 Ga0070696_100063837 Ga0070696_1000638372 165
43 3300005618 Ga0068864_100642633 Ga0068864_1006426331 165
44 3300025981 Ga0207640_10119471 Ga0207640_101194713 165
45 3300035091 Ga0373951_0037198 Ga0373951_0037198_165_737 165
46 3300047317 Ga0495604_0308538 Ga0495604_0308538_44_553 165
47 3300048915 Ga0496112_0038239 Ga0496112_0038239_3191_3820 165
48 3300049577 Ga0501041_0499807 Ga0501041_0499807_43_567 165
49 3300050514 nmdc:mga08x19_238722_c1 nmdc:mga08x19_238722_c1_21_623 165
50 3300005343 Ga0070687_100136247 Ga0070687_1001362472 166
51 3300005356 Ga0070674_100029435 Ga0070674_1000294352 166
52 3300005367 Ga0070667_100915633 Ga0070667_1009156331 166
53 3300005467 Ga0070706_100030262 Ga0070706_1000302626 166
54 3300005468 Ga0070707_100011609 Ga0070707_1000116094 166
55 3300005471 Ga0070698_100036854 Ga0070698_1000368542 166
56 3300005545 Ga0070695_100438942 Ga0070695_1004389422 166
57 3300005546 Ga0070696_100044409 Ga0070696_1000444095 166
58 3300005617 Ga0068859_100386817 Ga0068859_1003868172 166
59 3300005618 Ga0068864_100055123 Ga0068864_1000551234 166
60 3300006931 Ga0097620_100386817 Ga0097620_1003868172 166
61 3300010375 Ga0105239_10226337 Ga0105239_102263372 166
62 3300013306 Ga0163162_10285585 Ga0163162_102855852 166
63 3300017792 Ga0163161_10032714 Ga0163161_100327141 166
64 3300025910 Ga0207684_10026076 Ga0207684_100260764 166
65 3300025922 Ga0207646_10019084 Ga0207646_100190846 166
66 3300025933 Ga0207706_10830141 Ga0207706_108301412 166
67 3300025936 Ga0207670_10654469 Ga0207670_106544692 166
68 3300025937 Ga0207669_10082158 Ga0207669_100821582 166
69 3300025938 Ga0207704_11293995 Ga0207704_112939951 166
70 3300025940 Ga0207691_10607353 Ga0207691_106073532 166
71 3300025960 Ga0207651_10204713 Ga0207651_102047131 166
72 3300026035 Ga0207703_10179464 Ga0207703_101794643 166
73 3300026035 Ga0207703_10238115 Ga0207703_102381152 166
74 3300026075 Ga0207708_10489307 Ga0207708_104893073 166
75 3300026095 Ga0207676_10226715 Ga0207676_102267152 166
76 3300026142 Ga0207698_11557966 Ga0207698_115579661 166
77 3300028381 Ga0268264_10838524 Ga0268264_108385242 166
78 3300031995 Ga0307409_100196417 Ga0307409_1001964172 166
79 3300039437 Ga0436365_0424093 Ga0436365_0424093_1340_1858 166
80 3300042119 Ga0450915_001242 Ga0450915_001242_498_1025 166
81 3300042122 Ga0450920_029980 Ga0450920_029980_253_780 166
82 3300042147 Ga0450910_008348 Ga0450910_008348_859_1386 166
83 3300044901 Ga0466960_0657101 Ga0466960_0657101_26_538 166
84 3300046455 Ga0495603_0284019 Ga0495603_0284019_127_702 166
85 3300048914 Ga0496111_0281756 Ga0496111_0281756_526_1095 166
86 3300048916 Ga0496113_0226107 Ga0496113_0226107_437_1006 166
87 3300049593 Ga0501077_0449462 Ga0501077_0449462_189_722 166
88 3300054114 Ga0501084_0324585 Ga0501084_0324585_579_1130 166
89 3300059424 Ga0590075_022586 Ga0590075_022586_732_1280 166
90 3300005355 Ga0070671_100516905 Ga0070671_1005169052 167
91 3300005356 Ga0070674_101205706 Ga0070674_1012057061 167
92 3300009093 Ga0105240_11398120 Ga0105240_113981201 167
93 3300009101 Ga0105247_10490050 Ga0105247_104900502 167
94 3300026121 Ga0207683_10082807 Ga0207683_100828074 167
95 3300027614 Ga0209970_1015682 Ga0209970_10156822 167
96 3300049568 Ga0501031_0011173 Ga0501031_0011173_3626_4237 167
97 3300049573 Ga0501037_0379183 Ga0501037_0379183_259_870 167
98 3300049575 Ga0501039_0041137 Ga0501039_0041137_632_1243 167
99 3300049577 Ga0501041_0070533 Ga0501041_0070533_49_660 167
100 3300049580 Ga0501046_0071021 Ga0501046_0071021_1984_2595 167
101 3300049582 Ga0501048_0079344 Ga0501048_0079344_1040_1651 167
102 3300049587 Ga0501071_0049051 Ga0501071_0049051_1645_2256 167
103 3300049588 Ga0501072_0094579 Ga0501072_0094579_844_1455 167
104 3300049589 Ga0501073_0094558 Ga0501073_0094558_974_1585 167
105 3300049590 Ga0501074_0111028 Ga0501074_0111028_1229_1840 167
106 3300049591 Ga0501075_0085279 Ga0501075_0085279_114_635 167
107 3300049591 Ga0501075_0172197 Ga0501075_0172197_632_1243 167
108 3300049592 Ga0501076_0034349 Ga0501076_0034349_2650_3261 167
109 3300049741 Ga0501079_0023804 Ga0501079_0023804_797_1408 167
110 3300049741 Ga0501079_0079324 Ga0501079_0079324_399_920 167
111 3300049742 Ga0501080_0080802 Ga0501080_0080802_727_1338 167
112 3300049743 Ga0501081_0714799 Ga0501081_0714799_123_734 167
113 3300049824 Ga0501045_0014808 Ga0501045_0014808_2174_2785 167
114 3300054114 Ga0501084_0038323 Ga0501084_0038323_808_1419 167
115 3300060353 Ga0501082_0912233 Ga0501082_0912233_48_611 167
116 3300061734 Ga0530510_0027902 Ga0530510_0027902_2739_3260 167
117 3300061734 Ga0530510_0314355 Ga0530510_0314355_136_747 167
118 3300003320 rootH2_10207323 rootH2_102073232 168
119 3300005334 Ga0068869_100090240 Ga0068869_1000902404 168
120 3300005336 Ga0070680_100000134 Ga0070680_1000001342 168
121 3300005445 Ga0070708_100091190 Ga0070708_1000911902 168
122 3300005467 Ga0070706_100882344 Ga0070706_1008823442 168
123 3300005468 Ga0070707_100050041 Ga0070707_1000500413 168
124 3300005471 Ga0070698_100255838 Ga0070698_1002558382 168
125 3300005543 Ga0070672_101658258 Ga0070672_1016582581 168
126 3300005544 Ga0070686_100019781 Ga0070686_1000197812 168
127 3300005577 Ga0068857_100079008 Ga0068857_1000790085 168
128 3300005578 Ga0068854_100468983 Ga0068854_1004689832 168
129 3300005615 Ga0070702_100352072 Ga0070702_1003520721 168
130 3300005615 Ga0070702_100623450 Ga0070702_1006234502 168
131 3300005843 Ga0068860_100377112 Ga0068860_1003771122 168
132 3300006852 Ga0075433_10162650 Ga0075433_101626502 168
133 3300006852 Ga0075433_10175246 Ga0075433_101752462 168
134 3300006871 Ga0075434_100434777 Ga0075434_1004347772 168
135 3300006881 Ga0068865_101107214 Ga0068865_1011072142 168
136 3300006914 Ga0075436_100124453 Ga0075436_1001244532 168
137 3300007076 Ga0075435_100230734 Ga0075435_1002307342 168
138 3300007076 Ga0075435_100283074 Ga0075435_1002830742 168
139 3300009098 Ga0105245_10300560 Ga0105245_103005603 168
140 3300009098 Ga0105245_10552256 Ga0105245_105522562 168
141 3300009148 Ga0105243_10331590 Ga0105243_103315902 168
142 3300009176 Ga0105242_10920577 Ga0105242_109205772 168
143 3300010375 Ga0105239_10064710 Ga0105239_100647103 168
144 3300025910 Ga0207684_10032815 Ga0207684_100328153 168
145 3300025917 Ga0207660_10000003 Ga0207660_10000003187 168
146 3300025918 Ga0207662_10004376 Ga0207662_1000437611 168
147 3300025922 Ga0207646_10053500 Ga0207646_100535003 168
148 3300025923 Ga0207681_10849101 Ga0207681_108491012 168
149 3300025927 Ga0207687_10077918 Ga0207687_100779183 168
150 3300025932 Ga0207690_10177968 Ga0207690_101779682 168
151 3300025933 Ga0207706_10549884 Ga0207706_105498842 168
152 3300025935 Ga0207709_10595435 Ga0207709_105954352 168
153 3300025938 Ga0207704_10347697 Ga0207704_103476972 168
154 3300025961 Ga0207712_10728292 Ga0207712_107282922 168
155 3300025981 Ga0207640_10467679 Ga0207640_104676792 168
156 3300026075 Ga0207708_10447363 Ga0207708_104473632 168
157 3300026089 Ga0207648_10448162 Ga0207648_104481622 168
158 3300026116 Ga0207674_10103007 Ga0207674_101030074 168
159 3300028381 Ga0268264_10204597 Ga0268264_102045973 168
160 3300044673 Ga0453683_0158171 Ga0453683_0158171_854_1387 168
161 3300048904 Ga0496101_0281032 Ga0496101_0281032_534_1064 168
162 3300048905 Ga0496102_0406828 Ga0496102_0406828_149_676 168
163 3300048909 Ga0496106_0140947 Ga0496106_0140947_1144_1671 168
164 3300048910 Ga0496107_0093075 Ga0496107_0093075_1240_1785 168
165 3300048910 Ga0496107_0184924 Ga0496107_0184924_728_1258 168
166 3300048910 Ga0496107_0281039 Ga0496107_0281039_42_572 168
167 3300049590 Ga0501074_0138837 Ga0501074_0138837_1114_1626 168
168 3300049592 Ga0501076_0468933 Ga0501076_0468933_294_818 168
169 3300049593 Ga0501077_0055842 Ga0501077_0055842_1924_2436 168
170 3300050512 nmdc:mga0n895_49964_c1 nmdc:mga0n895_49964_c1_3380_3901 168
171 3300050512 nmdc:mga0n895_567851_c1 nmdc:mga0n895_567851_c1_281_808 168
172 3300050513 nmdc:mga0rr50_104412_c1 nmdc:mga0rr50_104412_c1_880_1407 168
173 3300050513 nmdc:mga0rr50_109639_c1 nmdc:mga0rr50_109639_c1_847_1374 168
174 3300050513 nmdc:mga0rr50_826055_c1 nmdc:mga0rr50_826055_c1_175_696 168
175 3300050514 nmdc:mga08x19_336839_c1 nmdc:mga08x19_336839_c1_260_787 168
176 3300050515 nmdc:mga0a205_10879_c1 nmdc:mga0a205_10879_c1_5139_5660 168
177 3300050515 nmdc:mga0a205_9412_c1 nmdc:mga0a205_9412_c1_3071_3598 168
178 3300061734 Ga0530510_0467832 Ga0530510_0467832_293_817 168
179 3300005329 Ga0070683_100103595 Ga0070683_1001035953 169
180 3300005354 Ga0070675_100065348 Ga0070675_1000653482 169
181 3300005535 Ga0070684_100007895 Ga0070684_1000078955 169
182 3300005564 Ga0070664_100081220 Ga0070664_1000812202 169
183 3300005841 Ga0068863_100441043 Ga0068863_1004410432 169
184 3300013296 Ga0157374_10359075 Ga0157374_103590752 169
185 3300025918 Ga0207662_10197463 Ga0207662_101974632 169
186 3300025926 Ga0207659_10035808 Ga0207659_100358084 169
187 3300025944 Ga0207661_10318641 Ga0207661_103186412 169
188 3300025945 Ga0207679_10137652 Ga0207679_101376522 169
189 3300048911 Ga0496108_0129818 Ga0496108_0129818_935_1504 169
190 3300049568 Ga0501031_0116706 Ga0501031_0116706_652_1167 169
191 3300049568 Ga0501031_0226065 Ga0501031_0226065_384_899 169
192 3300049569 Ga0501032_0305233 Ga0501032_0305233_116_631 169
193 3300049570 Ga0501033_0368178 Ga0501033_0368178_270_785 169
194 3300049574 Ga0501038_0473903 Ga0501038_0473903_144_659 169
195 3300049575 Ga0501039_0033869 Ga0501039_0033869_675_1190 169
196 3300049576 Ga0501040_0406533 Ga0501040_0406533_273_788 169
197 3300049577 Ga0501041_0165902 Ga0501041_0165902_98_613 169
198 3300049578 Ga0501042_0014139 Ga0501042_0014139_836_1351 169
199 3300049579 Ga0501043_0234766 Ga0501043_0234766_535_1050 169
200 3300049582 Ga0501048_0051271 Ga0501048_0051271_1758_2273 169
201 3300049587 Ga0501071_0305443 Ga0501071_0305443_630_1145 169
202 3300049588 Ga0501072_0049552 Ga0501072_0049552_830_1345 169
203 3300049588 Ga0501072_0341827 Ga0501072_0341827_347_862 169
204 3300049589 Ga0501073_0089665 Ga0501073_0089665_715_1230 169
205 3300049591 Ga0501075_0128406 Ga0501075_0128406_580_1095 169
206 3300049592 Ga0501076_0000785 Ga0501076_0000785_19027_19542 169
207 3300049593 Ga0501077_0025536 Ga0501077_0025536_561_1076 169
208 3300049741 Ga0501079_0010017 Ga0501079_0010017_6536_7051 169
209 3300049743 Ga0501081_0004301 Ga0501081_0004301_2650_3165 169
210 3300049824 Ga0501045_0027453 Ga0501045_0027453_696_1211 169
211 3300060353 Ga0501082_0135629 Ga0501082_0135629_972_1487 169
212 3300005459 Ga0068867_100761677 Ga0068867_1007616772 170
213 3300005471 Ga0070698_100017220 Ga0070698_10001722011 170
214 3300005518 Ga0070699_100015507 Ga0070699_1000155076 170
215 3300005518 Ga0070699_100185896 Ga0070699_1001858963 170
216 3300009147 Ga0114129_10427475 Ga0114129_104274753 170
217 3300026089 Ga0207648_10745271 Ga0207648_107452712 170
218 3300037068 Ga0373925_0028631 Ga0373925_0028631_2260_2877 170
219 3300046459 Ga0495629_0201271 Ga0495629_0201271_31_648 170
220 3300046517 Ga0495630_0777716 Ga0495630_0777716_92_709 170
221 3300049569 Ga0501032_0114856 Ga0501032_0114856_908_1468 170
222 3300049570 Ga0501033_0020094 Ga0501033_0020094_2665_3225 170
223 3300049571 Ga0501034_0398710 Ga0501034_0398710_603_1163 170
224 3300049572 Ga0501036_0045777 Ga0501036_0045777_1274_1834 170
225 3300049572 Ga0501036_0845709 Ga0501036_0845709_121_636 170
226 3300049573 Ga0501037_0059061 Ga0501037_0059061_1467_2027 170
227 3300049574 Ga0501038_0046990 Ga0501038_0046990_2473_3033 170
228 3300049575 Ga0501039_0038276 Ga0501039_0038276_2439_2999 170
229 3300049576 Ga0501040_0036607 Ga0501040_0036607_1832_2392 170
230 3300049577 Ga0501041_0030262 Ga0501041_0030262_1680_2240 170
231 3300049578 Ga0501042_0006802 Ga0501042_0006802_2034_2594 170
232 3300049579 Ga0501043_0034388 Ga0501043_0034388_2995_3555 170
233 3300049580 Ga0501046_0057418 Ga0501046_0057418_659_1219 170
234 3300049582 Ga0501048_0041492 Ga0501048_0041492_729_1289 170
235 3300049584 Ga0501068_0031266 Ga0501068_0031266_662_1222 170
236 3300049585 Ga0501069_0101002 Ga0501069_0101002_740_1300 170
237 3300049590 Ga0501074_0025446 Ga0501074_0025446_616_1176 170
238 3300049591 Ga0501075_0039532 Ga0501075_0039532_1276_1836 170
239 3300049593 Ga0501077_0139500 Ga0501077_0139500_211_771 170
240 3300049741 Ga0501079_0020541 Ga0501079_0020541_1677_2237 170
241 3300049742 Ga0501080_0039975 Ga0501080_0039975_2789_3349 170
242 3300049743 Ga0501081_0015548 Ga0501081_0015548_1601_2161 170
243 3300049823 Ga0501044_0159661 Ga0501044_0159661_871_1431 170
244 3300049824 Ga0501045_0044246 Ga0501045_0044246_1033_1593 170
245 3300050507 nmdc:mga05p37_122021_c1 nmdc:mga05p37_122021_c1_2038_2598 170
246 3300054114 Ga0501084_0028832 Ga0501084_0028832_2607_3167 170
247 3300060353 Ga0501082_0032123 Ga0501082_0032123_713_1273 170
248 3300061734 Ga0530510_0134853 Ga0530510_0134853_314_874 170
249 3300005441 Ga0070700_100541110 Ga0070700_1005411101 171
250 3300005444 Ga0070694_100374560 Ga0070694_1003745602 171
251 3300005467 Ga0070706_100281590 Ga0070706_1002815902 171
252 3300005615 Ga0070702_101061753 Ga0070702_1010617531 171
253 3300005842 Ga0068858_100368171 Ga0068858_1003681712 171
254 3300005981 Ga0081538_10058578 Ga0081538_100585782 171
255 3300006871 Ga0075434_101355402 Ga0075434_1013554021 171
256 3300009094 Ga0111539_10206461 Ga0111539_102064613 171
257 3300009098 Ga0105245_10219520 Ga0105245_102195202 171
258 3300009098 Ga0105245_11093589 Ga0105245_110935892 171
259 3300009176 Ga0105242_10174326 Ga0105242_101743262 171
260 3300009553 Ga0105249_10310654 Ga0105249_103106542 171
261 3300013306 Ga0163162_10293228 Ga0163162_102932282 171
262 3300013308 Ga0157375_10239640 Ga0157375_102396402 171
263 3300014325 Ga0163163_10413938 Ga0163163_104139382 171
264 3300014326 Ga0157380_10468457 Ga0157380_104684572 171
265 3300014326 Ga0157380_10667330 Ga0157380_106673301 171
266 3300025910 Ga0207684_10373721 Ga0207684_103737212 171
267 3300025927 Ga0207687_10018276 Ga0207687_100182762 171
268 3300025934 Ga0207686_10163013 Ga0207686_101630132 171
269 3300025961 Ga0207712_10248658 Ga0207712_102486582 171
270 3300026023 Ga0207677_10445396 Ga0207677_104453962 171
271 3300026035 Ga0207703_10259901 Ga0207703_102599012 171
272 3300026088 Ga0207641_10607110 Ga0207641_106071102 171
273 3300026118 Ga0207675_100135988 Ga0207675_1001359883 171
274 3300026142 Ga0207698_10941219 Ga0207698_109412191 171
275 3300028563 Ga0265319_1031935 Ga0265319_10319352 171
276 3300028577 Ga0265318_10030041 Ga0265318_100300412 171
277 3300032133 Ga0316583_10054123 Ga0316583_100541232 171
278 3300041512 Ga0451853_3877138 Ga0451853_3877138_662_1231 171
279 3300046683 Ga0495658_0154799 Ga0495658_0154799_193_747 171
280 3300048905 Ga0496102_0171552 Ga0496102_0171552_1091_1633 171
281 3300048905 Ga0496102_0309375 Ga0496102_0309375_304_906 171
282 3300048907 Ga0496104_0244608 Ga0496104_0244608_1099_1638 171
283 3300048908 Ga0496105_0164536 Ga0496105_0164536_66_605 171
284 3300048911 Ga0496108_0102209 Ga0496108_0102209_1196_1765 171
285 3300048911 Ga0496108_0126390 Ga0496108_0126390_1402_1944 171
286 3300048911 Ga0496108_0271642 Ga0496108_0271642_247_825 171
287 3300048915 Ga0496112_1029318 Ga0496112_1029318_129_698 171
288 3300048916 Ga0496113_0151054 Ga0496113_0151054_381_950 171
289 3300048917 Ga0496114_0306903 Ga0496114_0306903_121_666 171
290 3300049578 Ga0501042_0101600 Ga0501042_0101600_543_1085 171
291 3300049580 Ga0501046_0008570 Ga0501046_0008570_1483_2025 171
292 3300049582 Ga0501048_0288852 Ga0501048_0288852_514_1056 171
293 3300049590 Ga0501074_0052080 Ga0501074_0052080_2362_2904 171
294 3300049591 Ga0501075_0106284 Ga0501075_0106284_53_595 171
295 3300049592 Ga0501076_0042413 Ga0501076_0042413_1501_2043 171
296 3300049741 Ga0501079_0041038 Ga0501079_0041038_2675_3217 171
297 3300050511 nmdc:mga08y16_279256_c1 nmdc:mga08y16_279256_c1_558_1136 171
298 3300060353 Ga0501082_0084276 Ga0501082_0084276_888_1430 171
299 3300005436 Ga0070713_101522688 Ga0070713_1015226881 172
300 3300005457 Ga0070662_101027549 Ga0070662_1010275491 172
301 3300006881 Ga0068865_100268411 Ga0068865_1002684113 172
302 3300009098 Ga0105245_10306333 Ga0105245_103063332 172
303 3300013296 Ga0157374_10440776 Ga0157374_104407762 172
304 3300014326 Ga0157380_10052058 Ga0157380_100520584 172
305 3300025927 Ga0207687_10454604 Ga0207687_104546042 172
306 3300025933 Ga0207706_10497484 Ga0207706_104974842 172
307 3300025939 Ga0207665_10149488 Ga0207665_101494882 172
308 3300035113 Ga0373936_0174989 Ga0373936_0174989_181_744 172
309 3300046514 Ga0495618_0508301 Ga0495618_0508301_67_630 172
310 3300048908 Ga0496105_0256949 Ga0496105_0256949_329_877 172
311 3300048911 Ga0496108_0011005 Ga0496108_0011005_2925_3527 172
312 3300048912 Ga0496109_0022099 Ga0496109_0022099_4288_4890 172
313 3300048913 Ga0496110_0057303 Ga0496110_0057303_2480_3082 172
314 3300048915 Ga0496112_0053720 Ga0496112_0053720_233_835 172
315 3300048916 Ga0496113_0006477 Ga0496113_0006477_1299_1901 172
316 3300048917 Ga0496114_0055700 Ga0496114_0055700_1784_2386 172
317 3300050513 nmdc:mga0rr50_141148_c1 nmdc:mga0rr50_141148_c1_156_758 172
318 3300050515 nmdc:mga0a205_559936_c1 nmdc:mga0a205_559936_c1_15_617 172
319 3300053077 Ga0495601_0095948 Ga0495601_0095948_910_1473 172
320 3300053085 Ga0495619_0037419 Ga0495619_0037419_1565_2128 172
321 3300005365 Ga0070688_100136398 Ga0070688_1001363982 173
322 3300005438 Ga0070701_10249210 Ga0070701_102492102 173
323 3300005441 Ga0070700_100371532 Ga0070700_1003715321 173
324 3300005466 Ga0070685_10347410 Ga0070685_103474102 173
325 3300005617 Ga0068859_100122105 Ga0068859_1001221053 173
326 3300005843 Ga0068860_100478649 Ga0068860_1004786492 173
327 3300006931 Ga0097620_100122105 Ga0097620_1001221053 173
328 3300009094 Ga0111539_10640243 Ga0111539_106402432 173
329 3300026075 Ga0207708_10192731 Ga0207708_101927312 173
330 3300027876 Ga0209974_10031044 Ga0209974_100310442 173
331 3300031852 Ga0307410_10275799 Ga0307410_102757992 173
332 3300031903 Ga0307407_10241213 Ga0307407_102412131 173
333 3300031995 Ga0307409_100056392 Ga0307409_1000563923 173
334 3300041413 Ga0439465_0057052 Ga0439465_0057052_274_798 173
335 3300048911 Ga0496108_0576704 Ga0496108_0576704_82_621 173
336 3300048912 Ga0496109_1143428 Ga0496109_1143428_161_700 173
337 3300050511 nmdc:mga08y16_244503_c1 nmdc:mga08y16_244503_c1_110_649 173
338 3300005330 Ga0070690_100062959 Ga0070690_1000629593 174
339 3300005335 Ga0070666_10105858 Ga0070666_101058583 174
340 3300005364 Ga0070673_100424277 Ga0070673_1004242772 174
341 3300005440 Ga0070705_100094532 Ga0070705_1000945321 174
342 3300005456 Ga0070678_101186919 Ga0070678_1011869191 174
343 3300005518 Ga0070699_100176520 Ga0070699_1001765203 174
344 3300005578 Ga0068854_100292859 Ga0068854_1002928591 174
345 3300005615 Ga0070702_100020277 Ga0070702_1000202774 174
346 3300014969 Ga0157376_10302259 Ga0157376_103022592 174
347 3300025918 Ga0207662_10238478 Ga0207662_102384782 174
348 3300025934 Ga0207686_10659442 Ga0207686_106594422 174
349 3300025981 Ga0207640_10367279 Ga0207640_103672792 174
350 3300026121 Ga0207683_10776000 Ga0207683_107760002 174
351 3300031731 Ga0307405_10006860 Ga0307405_100068603 174
352 3300031901 Ga0307406_10734946 Ga0307406_107349462 174
353 3300031911 Ga0307412_10055787 Ga0307412_100557872 174
354 3300032002 Ga0307416_100008438 Ga0307416_1000084385 174
355 3300032126 Ga0307415_100000485 Ga0307415_1000004857 174
356 3300041405 Ga0439438_046608 Ga0439438_046608_132_659 174
357 3300046518 Ga0495631_0199061 Ga0495631_0199061_138_677 174
358 3300048905 Ga0496102_0395383 Ga0496102_0395383_394_963 174
359 3300048912 Ga0496109_0332416 Ga0496109_0332416_65_604 174
360 3300048917 Ga0496114_0682866 Ga0496114_0682866_233_772 174
361 3300049575 Ga0501039_0226855 Ga0501039_0226855_761_1297 174
362 3300049576 Ga0501040_0195231 Ga0501040_0195231_512_1048 174
363 3300049580 Ga0501046_0485416 Ga0501046_0485416_153_689 174
364 3300049588 Ga0501072_0726942 Ga0501072_0726942_165_701 174
365 3300049590 Ga0501074_0398974 Ga0501074_0398974_230_766 174
366 3300049591 Ga0501075_0021921 Ga0501075_0021921_3684_4220 174
367 3300049741 Ga0501079_0024704 Ga0501079_0024704_2269_2805 174
368 3300049742 Ga0501080_0375094 Ga0501080_0375094_161_697 174
369 3300049743 Ga0501081_0376861 Ga0501081_0376861_268_804 174
370 3300049824 Ga0501045_0039389 Ga0501045_0039389_816_1352 174
371 3300054114 Ga0501084_0147030 Ga0501084_0147030_1335_1871 174
372 3300061734 Ga0530510_0028869 Ga0530510_0028869_271_807 174
373 3300005444 Ga0070694_100142946 Ga0070694_1001429463 175
374 3300005467 Ga0070706_100310277 Ga0070706_1003102771 175
375 3300005471 Ga0070698_100065056 Ga0070698_1000650562 175
376 3300005518 Ga0070699_100003754 Ga0070699_1000037547 175
377 3300005536 Ga0070697_100188744 Ga0070697_1001887442 175
378 3300005545 Ga0070695_100021196 Ga0070695_1000211963 175
379 3300005546 Ga0070696_100001444 Ga0070696_1000014447 175
380 3300005615 Ga0070702_100635603 Ga0070702_1006356032 175
381 3300026121 Ga0207683_10101982 Ga0207683_101019822 175
382 3300037418 Ga0395900_0193037 Ga0395900_0193037_227_793 175
383 3300048906 Ga0496103_0154369 Ga0496103_0154369_645_1178 175
384 3300005329 Ga0070683_100137670 Ga0070683_1001376703 176
385 3300005335 Ga0070666_10158427 Ga0070666_101584273 176
386 3300005347 Ga0070668_100060988 Ga0070668_1000609882 176
387 3300005440 Ga0070705_100517526 Ga0070705_1005175262 176
388 3300005456 Ga0070678_100712803 Ga0070678_1007128032 176
389 3300005530 Ga0070679_100336869 Ga0070679_1003368692 176
390 3300005546 Ga0070696_100162227 Ga0070696_1001622272 176
391 3300005547 Ga0070693_100134014 Ga0070693_1001340142 176
392 3300005578 Ga0068854_100377908 Ga0068854_1003779081 176
393 3300005618 Ga0068864_100407001 Ga0068864_1004070012 176
394 3300005842 Ga0068858_100110747 Ga0068858_1001107473 176
395 3300009101 Ga0105247_10079062 Ga0105247_100790622 176
396 3300010375 Ga0105239_10263175 Ga0105239_102631751 176
397 3300013297 Ga0157378_10126946 Ga0157378_101269462 176
398 3300014325 Ga0163163_10192559 Ga0163163_101925593 176
399 3300025900 Ga0207710_10188032 Ga0207710_101880321 176
400 3300025921 Ga0207652_11309259 Ga0207652_113092591 176
401 3300025972 Ga0207668_10016757 Ga0207668_100167575 176
402 3300025981 Ga0207640_10182175 Ga0207640_101821752 176
403 3300026023 Ga0207677_10166417 Ga0207677_101664172 176
404 3300026035 Ga0207703_10233372 Ga0207703_102333722 176
405 3300026095 Ga0207676_10429308 Ga0207676_104293082 176
406 3300048904 Ga0496101_0394618 Ga0496101_0394618_391_960 176
407 3300048908 Ga0496105_0010353 Ga0496105_0010353_5302_5871 176
408 3300048909 Ga0496106_0379419 Ga0496106_0379419_163_732 176
409 3300048911 Ga0496108_0583406 Ga0496108_0583406_352_921 176
410 3300048912 Ga0496109_0092920 Ga0496109_0092920_1054_1623 176
411 3300048914 Ga0496111_0014039 Ga0496111_0014039_3019_3588 176
412 3300048916 Ga0496113_0006880 Ga0496113_0006880_2602_3171 176
413 3300005549 Ga0070704_100918778 Ga0070704_1009187781 177
414 3300025907 Ga0207645_10515822 Ga0207645_105158222 177
415 3300048906 Ga0496103_0107972 Ga0496103_0107972_748_1350 177
416 3300049572 Ga0501036_0080425 Ga0501036_0080425_204_815 177
417 3300049578 Ga0501042_0269550 Ga0501042_0269550_158_769 177
418 3300005366 Ga0070659_100430448 Ga0070659_1004304481 178
419 3300005440 Ga0070705_100003133 Ga0070705_1000031333 178
420 3300005440 Ga0070705_100530750 Ga0070705_1005307501 178
421 3300005444 Ga0070694_100360603 Ga0070694_1003606032 178
422 3300005471 Ga0070698_100348786 Ga0070698_1003487863 178
423 3300005518 Ga0070699_100151924 Ga0070699_1001519243 178
424 3300005518 Ga0070699_100224972 Ga0070699_1002249723 178
425 3300005536 Ga0070697_100510676 Ga0070697_1005106762 178
426 3300005545 Ga0070695_100007766 Ga0070695_1000077663 178
427 3300005545 Ga0070695_100036123 Ga0070695_1000361232 178
428 3300005546 Ga0070696_100016959 Ga0070696_1000169592 178
429 3300005549 Ga0070704_100051727 Ga0070704_1000517272 178
430 3300006852 Ga0075433_10027393 Ga0075433_100273932 178
431 3300009148 Ga0105243_10400705 Ga0105243_104007053 178
432 3300013297 Ga0157378_10117992 Ga0157378_101179923 178
433 3300025910 Ga0207684_10529101 Ga0207684_105291012 178
434 3300025917 Ga0207660_10038715 Ga0207660_100387154 178
435 3300025919 Ga0207657_10288103 Ga0207657_102881032 178
436 3300025932 Ga0207690_10115899 Ga0207690_101158992 178
437 3300025934 Ga0207686_10333246 Ga0207686_103332462 178
438 3300026023 Ga0207677_10585810 Ga0207677_105858102 178
439 3300046615 Ga0495656_0067581 Ga0495656_0067581_710_1249 178
440 3300048905 Ga0496102_0217576 Ga0496102_0217576_867_1493 178
441 3300049824 Ga0501045_0425328 Ga0501045_0425328_284_823 178
442 3300002155 JGI24033J26618_1043090 JGI24033J26618_10430901 179
443 3300005290 Ga0065712_10310632 Ga0065712_103106322 179
444 3300005329 Ga0070683_100064436 Ga0070683_1000644364 179
445 3300005330 Ga0070690_100081815 Ga0070690_1000818153 179
446 3300005331 Ga0070670_100066032 Ga0070670_1000660323 179
447 3300005334 Ga0068869_100178432 Ga0068869_1001784322 179
448 3300005335 Ga0070666_10147333 Ga0070666_101473332 179
449 3300005338 Ga0068868_100094516 Ga0068868_1000945163 179
450 3300005339 Ga0070660_100142006 Ga0070660_1001420063 179
451 3300005340 Ga0070689_100052797 Ga0070689_1000527973 179
452 3300005341 Ga0070691_10047426 Ga0070691_100474262 179
453 3300005341 Ga0070691_10206828 Ga0070691_102068282 179
454 3300005343 Ga0070687_100044368 Ga0070687_1000443682 179
455 3300005344 Ga0070661_100052224 Ga0070661_1000522242 179
456 3300005345 Ga0070692_10070762 Ga0070692_100707623 179
457 3300005347 Ga0070668_100399613 Ga0070668_1003996132 179
458 3300005354 Ga0070675_100029483 Ga0070675_1000294836 179
459 3300005356 Ga0070674_100002297 Ga0070674_1000022976 179
460 3300005364 Ga0070673_100220038 Ga0070673_1002200383 179
461 3300005365 Ga0070688_100028645 Ga0070688_1000286454 179
462 3300005366 Ga0070659_100107774 Ga0070659_1001077742 179
463 3300005367 Ga0070667_100144574 Ga0070667_1001445743 179
464 3300005438 Ga0070701_10031190 Ga0070701_100311903 179
465 3300005440 Ga0070705_100209235 Ga0070705_1002092353 179
466 3300005441 Ga0070700_100032112 Ga0070700_1000321123 179
467 3300005444 Ga0070694_100249423 Ga0070694_1002494232 179
468 3300005455 Ga0070663_100341494 Ga0070663_1003414942 179
469 3300005456 Ga0070678_100051942 Ga0070678_1000519422 179
470 3300005457 Ga0070662_100130990 Ga0070662_1001309903 179
471 3300005459 Ga0068867_100035743 Ga0068867_1000357433 179
472 3300005459 Ga0068867_100527744 Ga0068867_1005277442 179
473 3300005466 Ga0070685_10032323 Ga0070685_100323232 179
474 3300005547 Ga0070693_100030766 Ga0070693_1000307663 179
475 3300005549 Ga0070704_100092410 Ga0070704_1000924103 179
476 3300005564 Ga0070664_100028977 Ga0070664_1000289773 179
477 3300005577 Ga0068857_100120634 Ga0068857_1001206342 179
478 3300005578 Ga0068854_100186395 Ga0068854_1001863952 179
479 3300005615 Ga0070702_100058743 Ga0070702_1000587432 179
480 3300005616 Ga0068852_100127979 Ga0068852_1001279792 179
481 3300005617 Ga0068859_100130071 Ga0068859_1001300712 179
482 3300005618 Ga0068864_100136550 Ga0068864_1001365503 179
483 3300005719 Ga0068861_100155266 Ga0068861_1001552662 179
484 3300005840 Ga0068870_10317247 Ga0068870_103172472 179
485 3300005842 Ga0068858_100166459 Ga0068858_1001664593 179
486 3300005843 Ga0068860_100066580 Ga0068860_1000665803 179
487 3300006852 Ga0075433_10580392 Ga0075433_105803922 179
488 3300006871 Ga0075434_100189333 Ga0075434_1001893334 179
489 3300006881 Ga0068865_100034661 Ga0068865_1000346614 179
490 3300006931 Ga0097620_100130064 Ga0097620_1001300642 179
491 3300007076 Ga0075435_100198867 Ga0075435_1001988672 179
492 3300009094 Ga0111539_10075232 Ga0111539_100752325 179
493 3300009094 Ga0111539_10167123 Ga0111539_101671233 179
494 3300009094 Ga0111539_10180335 Ga0111539_101803353 179
495 3300009098 Ga0105245_10065283 Ga0105245_100652833 179
496 3300009147 Ga0114129_10059198 Ga0114129_100591985 179
497 3300009147 Ga0114129_10112316 Ga0114129_101123164 179
498 3300009147 Ga0114129_10227632 Ga0114129_102276322 179
499 3300009148 Ga0105243_10103364 Ga0105243_101033642 179
500 3300009176 Ga0105242_10040949 Ga0105242_100409494 179
501 3300009177 Ga0105248_10347350 Ga0105248_103473502 179
502 3300009553 Ga0105249_10016351 Ga0105249_100163516 179
503 3300009553 Ga0105249_10786594 Ga0105249_107865941 179
504 3300010375 Ga0105239_10117374 Ga0105239_101173743 179
505 3300011119 Ga0105246_10968191 Ga0105246_109681911 179
506 3300013296 Ga0157374_10197069 Ga0157374_101970692 179
507 3300013297 Ga0157378_10020444 Ga0157378_100204445 179
508 3300013307 Ga0157372_11037979 Ga0157372_110379792 179
509 3300013308 Ga0157375_10100546 Ga0157375_101005463 179
510 3300014325 Ga0163163_10029494 Ga0163163_100294943 179
511 3300014326 Ga0157380_10123663 Ga0157380_101236632 179
512 3300014745 Ga0157377_10001869 Ga0157377_100018693 179
513 3300014968 Ga0157379_10100475 Ga0157379_101004753 179
514 3300014969 Ga0157376_10267104 Ga0157376_102671042 179
515 3300017792 Ga0163161_10084468 Ga0163161_100844682 179
516 3300025899 Ga0207642_10162570 Ga0207642_101625701 179
517 3300025901 Ga0207688_10041112 Ga0207688_100411123 179
518 3300025903 Ga0207680_10239073 Ga0207680_102390732 179
519 3300025904 Ga0207647_10491508 Ga0207647_104915082 179
520 3300025907 Ga0207645_10211078 Ga0207645_102110782 179
521 3300025908 Ga0207643_10013222 Ga0207643_100132223 179
522 3300025908 Ga0207643_10296911 Ga0207643_102969112 179
523 3300025917 Ga0207660_10221634 Ga0207660_102216342 179
524 3300025918 Ga0207662_10013277 Ga0207662_100132773 179
525 3300025919 Ga0207657_10038787 Ga0207657_100387874 179
526 3300025920 Ga0207649_10153341 Ga0207649_101533412 179
527 3300025925 Ga0207650_10077144 Ga0207650_100771443 179
528 3300025926 Ga0207659_10032745 Ga0207659_100327454 179
529 3300025927 Ga0207687_10053690 Ga0207687_100536903 179
530 3300025931 Ga0207644_10624973 Ga0207644_106249731 179
531 3300025932 Ga0207690_10047921 Ga0207690_100479213 179
532 3300025933 Ga0207706_10128590 Ga0207706_101285903 179
533 3300025934 Ga0207686_10149658 Ga0207686_101496583 179
534 3300025935 Ga0207709_10095031 Ga0207709_100950312 179
535 3300025936 Ga0207670_10089705 Ga0207670_100897053 179
536 3300025937 Ga0207669_10006962 Ga0207669_100069625 179
537 3300025938 Ga0207704_10125313 Ga0207704_101253133 179
538 3300025944 Ga0207661_10057431 Ga0207661_100574313 179
539 3300025945 Ga0207679_10041494 Ga0207679_100414944 179
540 3300025960 Ga0207651_10151420 Ga0207651_101514201 179
541 3300025961 Ga0207712_10016523 Ga0207712_100165233 179
542 3300025981 Ga0207640_10143857 Ga0207640_101438572 179
543 3300025986 Ga0207658_10337393 Ga0207658_103373932 179
544 3300026035 Ga0207703_10039077 Ga0207703_100390774 179
545 3300026041 Ga0207639_10052867 Ga0207639_100528673 179
546 3300026067 Ga0207678_10009134 Ga0207678_100091343 179
547 3300026075 Ga0207708_10020062 Ga0207708_100200623 179
548 3300026089 Ga0207648_10027240 Ga0207648_100272403 179
549 3300026095 Ga0207676_10046017 Ga0207676_100460174 179
550 3300026116 Ga0207674_10163409 Ga0207674_101634093 179
551 3300026118 Ga0207675_100816390 Ga0207675_1008163902 179
552 3300026121 Ga0207683_10059592 Ga0207683_100595922 179
553 3300026142 Ga0207698_10086979 Ga0207698_100869792 179
554 3300027876 Ga0209974_10125852 Ga0209974_101258521 179
555 3300027907 Ga0207428_10136644 Ga0207428_101366441 179
556 3300034957 Ga0373938_0037889 Ga0373938_0037889_235_774 179
557 3300038443 Ga0395901_0258517 Ga0395901_0258517_895_1524 179
558 3300048903 Ga0496100_0142595 Ga0496100_0142595_235_774 179
559 3300048904 Ga0496101_0070103 Ga0496101_0070103_803_1849 179
560 3300048904 Ga0496101_0090494 Ga0496101_0090494_893_1432 179
561 3300048905 Ga0496102_0102003 Ga0496102_0102003_1656_2195 179
562 3300048905 Ga0496102_0117047 Ga0496102_0117047_1168_2199 179
563 3300048907 Ga0496104_0014646 Ga0496104_0014646_806_1837 179
564 3300048908 Ga0496105_0012161 Ga0496105_0012161_549_1580 179
565 3300048909 Ga0496106_0029255 Ga0496106_0029255_1809_2348 179
566 3300048909 Ga0496106_0070989 Ga0496106_0070989_1082_2128 179
567 3300048910 Ga0496107_0045040 Ga0496107_0045040_896_1435 179
568 3300048911 Ga0496108_0006475 Ga0496108_0006475_7605_8636 179
569 3300048911 Ga0496108_0052532 Ga0496108_0052532_2519_3058 179
570 3300048912 Ga0496109_0014960 Ga0496109_0014960_2740_3279 179
571 3300048913 Ga0496110_0001806 Ga0496110_0001806_13771_14802 179
572 3300048913 Ga0496110_0178401 Ga0496110_0178401_712_1251 179
573 3300048914 Ga0496111_0012580 Ga0496111_0012580_166_1197 179
574 3300048914 Ga0496111_0182853 Ga0496111_0182853_395_934 179
575 3300048916 Ga0496113_0153732 Ga0496113_0153732_238_777 179
576 3300048917 Ga0496114_0003659 Ga0496114_0003659_10151_11197 179
577 3300048917 Ga0496114_0312005 Ga0496114_0312005_365_904 179
578 3300049576 Ga0501040_0638028 Ga0501040_0638028_93_704 179
579 3300049577 Ga0501041_0300635 Ga0501041_0300635_370_912 179
580 3300049582 Ga0501048_0303129 Ga0501048_0303129_102_644 179
581 3300049583 Ga0501067_0004598 Ga0501067_0004598_685_1230 179
582 3300049583 Ga0501067_0005790 Ga0501067_0005790_3578_4252 179
583 3300049584 Ga0501068_0036470 Ga0501068_0036470_1354_1899 179
584 3300049585 Ga0501069_0013770 Ga0501069_0013770_1421_1966 179
585 3300049585 Ga0501069_0210864 Ga0501069_0210864_340_1014 179
586 3300049586 Ga0501070_0655658 Ga0501070_0655658_207_752 179
587 3300049588 Ga0501072_0110187 Ga0501072_0110187_1549_2091 179
588 3300049593 Ga0501077_0062655 Ga0501077_0062655_1520_2062 179
589 3300049824 Ga0501045_0017373 Ga0501045_0017373_1322_1864 179
590 3300050492 nmdc:mga0yw44_86053_c1 nmdc:mga0yw44_86053_c1_979_1521 179
591 3300050507 nmdc:mga05p37_193426_c1 nmdc:mga05p37_193426_c1_62_604 179
592 3300050507 nmdc:mga05p37_78430_c1 nmdc:mga05p37_78430_c1_2824_3381 179
593 3300050510 nmdc:mga06r32_98085_c1 nmdc:mga06r32_98085_c1_1558_2112 179
594 3300050511 nmdc:mga08y16_104865_c1 nmdc:mga08y16_104865_c1_940_1479 179
595 3300050511 nmdc:mga08y16_255803_c1 nmdc:mga08y16_255803_c1_818_1360 179
596 3300050511 nmdc:mga08y16_64784_c1 nmdc:mga08y16_64784_c1_1364_1906 179
597 3300050512 nmdc:mga0n895_263723_c1 nmdc:mga0n895_263723_c1_301_891 179
598 3300050512 nmdc:mga0n895_359161_c1 nmdc:mga0n895_359161_c1_284_823 179
599 3300050513 nmdc:mga0rr50_326678_c1 nmdc:mga0rr50_326678_c1_382_972 179
600 3300050514 nmdc:mga08x19_106897_c1 nmdc:mga08x19_106897_c1_1147_1737 179
601 3300050515 nmdc:mga0a205_112884_c1 nmdc:mga0a205_112884_c1_405_962 179
602 3300050515 nmdc:mga0a205_300824_c1 nmdc:mga0a205_300824_c1_622_1161 179
603 3300054114 Ga0501084_0006717 Ga0501084_0006717_5621_6163 179
604 3300061734 Ga0530510_0071032 Ga0530510_0071032_608_1150 179
605 3300061734 Ga0530510_0152449 Ga0530510_0152449_16_561 179
606 3300061734 Ga0530510_0383544 Ga0530510_0383544_352_1026 179

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02254

TrkA_N

TrkA-N domain

3

119

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zov-assembly2.cif.gz_B crystal structure of monomeric sarcosine oxidase from bacillus sp. ns-129 0.9909 2 31
2r9z-assembly1.cif.gz_B glutathione amide reductase from chromatium gracile 0.9902 2 32
3bhk-assembly1.cif.gz_A crystal structure of r49k mutant of monomeric sarcosine oxidase crystallized in phosphate as precipitant 0.9898 2 31
5vn0-assembly2.cif.gz_D water-forming nadh oxidase from lactobacillus brevis (lbnox) bound to nadh. 0.9806 3 31
4czz-assembly1.cif.gz_A histone demethylase lsd1(kdm1a)-corest3 complex 0.9748 2 31
ID Description Score Start End Superfamily
af_Q54BK7_6_401_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 1.006 3 32 3.50.50.60
af_I1M4B4_72_260_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9863 2 31 3.50.50.60
1naaA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9851 3 32 3.50.50.60
af_A0A144A3W0_47_229_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9843 3 32 3.50.50.60
af_P37631_5_390_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9821 3 33 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1F8N4L8-F1-model_v4 Potassium transporter TrkA 0.9924 1 112 GO:0005886
GO:0015079
AF-A0A6J4VNH4-F1-model_v4 TrkA-like protein 0.992 1 95 GO:0005886
GO:0015079
AF-A0A1M5FFR6-F1-model_v4 Trk system potassium uptake protein TrkA 0.9884 1 130 GO:0005886
GO:0015079
AF-A0A533RRF8-F1-model_v4 TrkA family potassium uptake protein 0.9877 1 118 GO:0005886
GO:0015079
AF-B9KZK9-F1-model_v4 Trk system potassium uptake protein trkA 0.9871 1 130 GO:0005886
GO:0015079

Feature Viewer

pLDDT pTM Quality
86.92 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map