metagRoot

F468549

General Info

Members	Datasets	Scaffolds	Average Seq Length
606	267	596	215

Family's Representative Sequence

Representative Sequence	3300003792\|Ga0055540_1010111\|Ga0055540_10101112
Length	234
Sequence	MTKDLVETTDDPCPYSAGVVAQITSGTAFDKHGRPFRRRNYIPGVVVLVALGVVALIVWVVAFNQTPDVRQLVACNPPPPMADATQTALGEPVTPATMMDVAPAKLADTKIRVLNASGQGGQAGEVAGALRDLGYAPPTAGNDTVYENTRLECQGQIRFGPSGRAAAAALWLVAPCTELFQDQRPDDTVDLAIGTEFSDVSHNDDIDAVLASLRPDATQPADTALIKKIHTAAC

Samples

	Sample ID	Description	Type	Environment
1	2643221687	Mycobacterium sp. Root135	Isolate	Unclassified
2	2643221715	Mycobacterium sp. Root265	Isolate	Unclassified
3	2738541264	Mycobacterium sp. OK889	Isolate	Unclassified
4	2738541356	Mycobacterium sp. OK887	Isolate	Unclassified
5	2902792274	Mycolicibacterium sp. P9-64	Isolate	Unclassified
6	2902799365	Mycolicibacterium sp. P1-5	Isolate	Unclassified
7	2902810491	Mycolicibacterium sp. P9-22	Isolate	Unclassified
8	2902837492	Mycolicibacterium sp. P1-18	Isolate	Unclassified
9	2929212328	Mycolicibacterium sp. R-73050 Hybrid assembly	Isolate	Unclassified
10	2939582691	Mycolicibacterium sp. 624	Isolate	Rhizosphere
11	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
12	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
13	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
14	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
15	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
16	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
17	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
18	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
19	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
20	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
21	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
22	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
23	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
24	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
25	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
26	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
27	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
28	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
29	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
30	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
31	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
32	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
33	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
34	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
35	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
36	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
37	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
38	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
39	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
40	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
41	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
42	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
43	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
44	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
45	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
46	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
47	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
48	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
49	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
50	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
51	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
52	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
53	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
54	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
55	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
56	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
57	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
58	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
59	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
60	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
61	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
62	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
63	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
64	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
65	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
66	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
67	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
68	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
69	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
70	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
71	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
72	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
73	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
74	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
75	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
76	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
77	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
78	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
79	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
80	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
81	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
82	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
83	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
84	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
85	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
86	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
87	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
88	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
89	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
90	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
91	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
92	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
93	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
94	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
95	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
96	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
97	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
98	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
99	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
100	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
101	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
102	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
103	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
104	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
105	3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Metagenome	Unclassified
106	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
107	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
108	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
109	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
155	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
159	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
160	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
161	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
162	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
163	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
164	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
165	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
166	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
167	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
168	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
169	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
170	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
171	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
172	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
173	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
174	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
175	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
176	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
177	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
178	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
179	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
180	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
181	3300042002	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616	Metagenome	Rhizosphere
182	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
183	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
184	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
185	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
186	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
187	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
188	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
189	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
190	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
191	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
192	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
193	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
194	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
195	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
196	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
197	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
198	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
199	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
200	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
201	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
202	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
203	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
204	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
205	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
206	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
207	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
208	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
209	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
210	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
211	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
212	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
213	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
214	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
215	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
216	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
217	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
218	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
219	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
220	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
221	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
222	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
223	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
224	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
225	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
226	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
227	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
228	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
229	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
230	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
231	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
232	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
233	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
234	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
235	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
236	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
237	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
238	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
239	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
240	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
241	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
242	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
243	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
244	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
245	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
246	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
247	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
248	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
249	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
250	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
251	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
252	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
253	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
254	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
255	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
256	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
257	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
258	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
259	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
260	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
261	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
262	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
263	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
264	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
265	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
266	3300053727	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere	Metagenome	Endosphere
267	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	98.35
Metatranscriptomes	0
Isolates	1.65

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	12.87
Nodule	0
Rhizoplane	12.87
Rhizosphere	65.02
Stem	0
Stem Tuber	0
Unclassified	9.24

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24744J21845_10000190	3300002077	Bacteria	9428
2	JGI24742J22300_10002749	3300002244	Bacteria	2833
3	rootH2_10139749	3300003320	Bacteria	1535
4	rootH1_10181653	3300003323	Bacteria	1125
5	Ga0055540_1000065	3300003792	Bacteria	126812
6	Ga0055540_1000655	3300003792	Bacteria	24288
7	Ga0055540_1004782	3300003792	Bacteria	5961
8	Ga0055540_1010111	3300003792	Bacteria	3171
9	Ga0070676_10006152	3300005328	Bacteria	6410
10	Ga0070683_100211996	3300005329	Bacteria	1840
11	Ga0070690_100118740	3300005330	Bacteria	1773
12	Ga0068869_100039011	3300005334	Bacteria	3388
13	Ga0070666_10053484	3300005335	Bacteria	2723
14	Ga0070682_100007645	3300005337	Bacteria	6090
15	Ga0070682_100104823	3300005337	Bacteria	1873
16	Ga0070682_100307986	3300005337	Bacteria	1165
17	Ga0068868_100020554	3300005338	Bacteria	4964
18	Ga0068868_100774890	3300005338	Bacteria	863
19	Ga0070691_10018171	3300005341	Bacteria	3240
20	Ga0070687_100100887	3300005343	Bacteria	1616
21	Ga0070687_100243703	3300005343	Bacteria	1113
22	Ga0070692_10095324	3300005345	Bacteria	1624
23	Ga0070668_100000513	3300005347	Bacteria	25668
24	Ga0070668_100337375	3300005347	Bacteria	1273
25	Ga0070668_100434120	3300005347	Bacteria	1126
26	Ga0070669_100009169	3300005353	Bacteria	7052
27	Ga0070671_100000408	3300005355	Bacteria	29702
28	Ga0070671_100079841	3300005355	Bacteria	2735
29	Ga0070671_100444210	3300005355	Bacteria	1112
30	Ga0070671_100472761	3300005355	Bacteria	1077
31	Ga0070674_100015488	3300005356	Bacteria	4760
32	Ga0070674_100051984	3300005356	Bacteria	2825
33	Ga0070688_100028739	3300005365	Bacteria	3323
34	Ga0070688_100162220	3300005365	Bacteria	1536
35	Ga0070659_100027790	3300005366	Bacteria	4362
36	Ga0070659_100168960	3300005366	Bacteria	1791
37	Ga0070667_100000252	3300005367	Bacteria	60780
38	Ga0070667_100000462	3300005367	Bacteria	41814
39	Ga0070667_100012611	3300005367	Bacteria	6990
40	Ga0070667_100165127	3300005367	Bacteria	1952
41	Ga0070709_10017791	3300005434	Bacteria	4084
42	Ga0070709_10053284	3300005434	Bacteria	2547
43	Ga0070714_100025952	3300005435	Bacteria	4839
44	Ga0070714_100034453	3300005435	Bacteria	4240
45	Ga0070714_100120141	3300005435	Bacteria	2337
46	Ga0070713_100101856	3300005436	Bacteria	2489
47	Ga0070713_100155344	3300005436	Bacteria	2039
48	Ga0070713_100586449	3300005436	Bacteria	1058
49	Ga0070710_10004693	3300005437	Bacteria	6463
50	Ga0070710_10051846	3300005437	Bacteria	2305
51	Ga0070701_10004523	3300005438	Bacteria	5647
52	Ga0070711_100018330	3300005439	Bacteria	4466
53	Ga0070705_100841600	3300005440	Bacteria	733
54	Ga0070700_100144560	3300005441	Bacteria	1620
55	Ga0070694_100066837	3300005444	Bacteria	2467
56	Ga0070663_100044248	3300005455	Bacteria	3137
57	Ga0070663_100049748	3300005455	Bacteria	2979
58	Ga0070663_100050253	3300005455	Bacteria	2965
59	Ga0070663_100132835	3300005455	Bacteria	1892
60	Ga0070663_100426166	3300005455	Bacteria	1089
61	Ga0070678_100025402	3300005456	Bacteria	3984
62	Ga0070678_100119442	3300005456	Bacteria	2076
63	Ga0070678_100169628	3300005456	Bacteria	1776
64	Ga0070662_100038629	3300005457	Bacteria	3391
65	Ga0070662_100404104	3300005457	Bacteria	1128
66	Ga0068867_100019830	3300005459	Bacteria	4791
67	Ga0070685_10094476	3300005466	Bacteria	1816
68	Ga0070685_10109112	3300005466	Bacteria	1702
69	Ga0068853_100003261	3300005539	Bacteria	12403
70	Ga0068853_100755402	3300005539	Bacteria	929
71	Ga0068853_100901408	3300005539	Bacteria	849
72	Ga0070672_100102786	3300005543	Bacteria	2320
73	Ga0070672_100116745	3300005543	Bacteria	2181
74	Ga0070695_100025967	3300005545	Bacteria	3621
75	Ga0070696_100023915	3300005546	Bacteria	4152
76	Ga0070693_100012525	3300005547	Bacteria	4293
77	Ga0070665_100004564	3300005548	Bacteria	14511
78	Ga0070665_100007417	3300005548	Bacteria	11155
79	Ga0070665_100033203	3300005548	Bacteria	5192
80	Ga0070665_100078429	3300005548	Bacteria	3309
81	Ga0070665_100366873	3300005548	Bacteria	1446
82	Ga0070704_100026611	3300005549	Bacteria	3825
83	Ga0070704_100679661	3300005549	Bacteria	911
84	Ga0068855_100044500	3300005563	Bacteria	5252
85	Ga0068855_100242350	3300005563	Bacteria	2014
86	Ga0068854_100000639	3300005578	Bacteria	20736
87	Ga0068854_100165766	3300005578	Bacteria	1715
88	Ga0068856_100216653	3300005614	Bacteria	1930
89	Ga0070702_100035558	3300005615	Bacteria	2752
90	Ga0068859_100000837	3300005617	Bacteria	31230
91	Ga0068859_100001567	3300005617	Bacteria	23316
92	Ga0068861_100023429	3300005719	Bacteria	4452
93	Ga0068861_100104200	3300005719	Bacteria	2263
94	Ga0068861_100142358	3300005719	Bacteria	1958
95	Ga0068861_100734751	3300005719	Bacteria	920
96	Ga0068863_100028479	3300005841	Bacteria	5334
97	Ga0068863_100130497	3300005841	Bacteria	2399
98	Ga0068863_100556631	3300005841	Bacteria	1133
99	Ga0068858_100003465	3300005842	Bacteria	15640
100	Ga0068858_100080784	3300005842	Bacteria	3021
101	Ga0068860_100000287	3300005843	Bacteria	71871
102	Ga0068860_100001844	3300005843	Bacteria	22572
103	Ga0068860_100151684	3300005843	Bacteria	2232
104	Ga0068862_100000296	3300005844	Bacteria	54630
105	Ga0068862_100060470	3300005844	Bacteria	3254
106	Ga0068862_100227013	3300005844	Bacteria	1692
107	Ga0081455_10016212	3300005937	Bacteria	7202
108	Ga0081455_10055276	3300005937	Bacteria	3377
109	Ga0070717_10069194	3300006028	Bacteria	2939
110	Ga0075365_10008580	3300006038	Bacteria	5817
111	Ga0075365_10052536	3300006038	Bacteria	2696
112	Ga0075365_10100413	3300006038	Bacteria	1981
113	Ga0075365_10232630	3300006038	Bacteria	1294
114	Ga0075368_10003911	3300006042	Bacteria	5015
115	Ga0075363_100001282	3300006048	Bacteria	9351
116	Ga0075363_100001470	3300006048	Bacteria	8956
117	Ga0075363_100002854	3300006048	Bacteria	7193
118	Ga0075363_100012989	3300006048	Bacteria	4023
119	Ga0075363_100014542	3300006048	Bacteria	3849
120	Ga0075363_100101852	3300006048	Bacteria	1590
121	Ga0075364_10001632	3300006051	Bacteria	12291
122	Ga0075364_10009424	3300006051	Bacteria	5857
123	Ga0075364_10013625	3300006051	Bacteria	5005
124	Ga0075364_10019245	3300006051	Bacteria	4283
125	Ga0075364_10204807	3300006051	Bacteria	1338
126	Ga0075364_10266956	3300006051	Bacteria	1164
127	Ga0070715_10003894	3300006163	Bacteria	4827
128	Ga0070716_100002910	3300006173	Bacteria	7975
129	Ga0070716_100019018	3300006173	Bacteria	3586
130	Ga0070712_100019206	3300006175	Bacteria	4453
131	Ga0070712_100019380	3300006175	Bacteria	4437
132	Ga0070712_100137351	3300006175	Bacteria	1861
133	Ga0075362_10155810	3300006177	Bacteria	1098
134	Ga0075367_10028312	3300006178	Bacteria	3195
135	Ga0075367_10034150	3300006178	Bacteria	2936
136	Ga0075367_10293579	3300006178	Bacteria	1023
137	Ga0075369_10000311	3300006186	Bacteria	14509
138	Ga0075369_10020488	3300006186	Bacteria	2708
139	Ga0075369_10090680	3300006186	Bacteria	1364
140	Ga0075369_10119552	3300006186	Bacteria	1192
141	Ga0075369_10119786	3300006186	Bacteria	1191
142	Ga0075369_10188962	3300006186	Bacteria	949
143	Ga0075366_10059820	3300006195	Bacteria	2263
144	Ga0097621_100058420	3300006237	Bacteria	3155
145	Ga0075370_10006335	3300006353	Bacteria	5943
146	Ga0075370_10023068	3300006353	Bacteria	3424
147	Ga0075370_10044541	3300006353	Bacteria	2509
148	Ga0068871_100218341	3300006358	Bacteria	1651
149	Ga0068871_100350579	3300006358	Bacteria	1306
150	Ga0075430_100247572	3300006846	Bacteria	1477
151	Ga0075431_100055852	3300006847	Bacteria	4073
152	Ga0068865_100016648	3300006881	Bacteria	4710
153	Ga0097620_100000837	3300006931	Bacteria	31230
154	Ga0097620_100001567	3300006931	Bacteria	23316
155	Ga0097620_100266225	3300006931	Bacteria	1806
156	Ga0105245_10001575	3300009098	Bacteria	20704
157	Ga0105247_10000134	3300009101	Bacteria	71986
158	Ga0105247_10000857	3300009101	Bacteria	23031
159	Ga0105247_10086490	3300009101	Bacteria	1984
160	Ga0114129_10024907	3300009147	Bacteria	8484
161	Ga0105243_10001317	3300009148	Bacteria	22131
162	Ga0105242_10003943	3300009176	Bacteria	11529
163	Ga0105242_10059069	3300009176	Bacteria	3146
164	Ga0105248_10000181	3300009177	Bacteria	73501
165	Ga0105248_10038566	3300009177	Bacteria	5348
166	Ga0105248_10220883	3300009177	Bacteria	2133
167	Ga0105237_10007707	3300009545	Bacteria	11759
168	Ga0105237_10038308	3300009545	Bacteria	4842
169	Ga0105237_10673472	3300009545	Bacteria	1041
170	Ga0105238_10412151	3300009551	Bacteria	1345
171	Ga0105238_10432051	3300009551	Bacteria	1312
172	Ga0105249_10000189	3300009553	Bacteria	70627
173	Ga0105249_10020676	3300009553	Bacteria	5885
174	Ga0105249_10022875	3300009553	Bacteria	5603
175	Ga0105249_10459111	3300009553	Bacteria	1313
176	Ga0105239_10040522	3300010375	Bacteria	5103
177	Ga0105239_10043967	3300010375	Bacteria	4898
178	Ga0105239_10056909	3300010375	Bacteria	4289
179	Ga0105239_10195255	3300010375	Bacteria	2266
180	Ga0105239_10491181	3300010375	Bacteria	1395
181	Ga0105239_11142509	3300010375	Bacteria	897
182	Ga0157369_10032915	3300013105	Bacteria	5697
183	Ga0157369_10088030	3300013105	Bacteria	3315
184	Ga0157378_10011124	3300013297	Bacteria	7876
185	Ga0163162_10016580	3300013306	Bacteria	7201
186	Ga0163162_10083555	3300013306	Bacteria	3267
187	Ga0163162_10167110	3300013306	Bacteria	2324
188	Ga0163162_10227704	3300013306	Bacteria	1994
189	Ga0157372_10024412	3300013307	Bacteria	6566
190	Ga0157372_10232689	3300013307	Bacteria	2136
191	Ga0157375_10014587	3300013308	Bacteria	7016
192	Ga0157375_10484777	3300013308	Bacteria	1401
193	Ga0163163_10036486	3300014325	Bacteria	4776
194	Ga0157380_10122566	3300014326	Bacteria	2204
195	Ga0157377_10074496	3300014745	Bacteria	1970
196	Ga0157379_10011823	3300014968	Bacteria	7623
197	Ga0157379_10124213	3300014968	Bacteria	2322
198	Ga0157379_10204616	3300014968	Bacteria	1785
199	Ga0157376_10509236	3300014969	Bacteria	1184
200	Ga0163161_10008754	3300017792	Bacteria	6996
201	Ga0163161_10030846	3300017792	Bacteria	3817
202	Ga0163161_10121107	3300017792	Bacteria	1966
203	Ga0213874_10072505	3300021377	Bacteria	1101
204	Ga0213876_10005721	3300021384	Bacteria	6813
205	Ga0213876_10040713	3300021384	Bacteria	2455
206	Ga0213876_10093169	3300021384	Bacteria	1596
207	Ga0209673_1028702	3300025273	Bacteria	1785
208	Ga0209673_1077808	3300025273	Bacteria	769
209	Ga0209051_1000042	3300025303	Bacteria	308486
210	Ga0209051_1000612	3300025303	Bacteria	41270
211	Ga0209051_1000905	3300025303	Bacteria	29540
212	Ga0209051_1003327	3300025303	Bacteria	10629
213	Ga0207692_10001645	3300025898	Bacteria	8448
214	Ga0207692_10008539	3300025898	Bacteria	4243
215	Ga0207642_10010638	3300025899	Bacteria	3253
216	Ga0207642_10021666	3300025899	Bacteria	2534
217	Ga0207710_10000163	3300025900	Bacteria	70646
218	Ga0207710_10001489	3300025900	Bacteria	11576
219	Ga0207710_10195291	3300025900	Bacteria	998
220	Ga0207688_10001501	3300025901	Bacteria	12249
221	Ga0207688_10019459	3300025901	Bacteria	3700
222	Ga0207688_10167204	3300025901	Bacteria	1306
223	Ga0207680_10050831	3300025903	Bacteria	2476
224	Ga0207647_10067953	3300025904	Bacteria	2158
225	Ga0207685_10014025	3300025905	Bacteria	2498
226	Ga0207699_10022768	3300025906	Bacteria	3400
227	Ga0207699_10053381	3300025906	Bacteria	2396
228	Ga0207645_10008996	3300025907	Bacteria	6935
229	Ga0207693_10005173	3300025915	Bacteria	10917
230	Ga0207693_10009189	3300025915	Bacteria	8068
231	Ga0207693_10180671	3300025915	Bacteria	1660
232	Ga0207663_10009642	3300025916	Bacteria	5109
233	Ga0207663_10189309	3300025916	Bacteria	1476
234	Ga0207662_10048414	3300025918	Bacteria	2518
235	Ga0207657_10185212	3300025919	Bacteria	1682
236	Ga0207681_10007164	3300025923	Bacteria	6841
237	Ga0207681_10053956	3300025923	Bacteria	2731
238	Ga0207650_10148421	3300025925	Bacteria	1849
239	Ga0207687_10000807	3300025927	Bacteria	21161
240	Ga0207687_10171058	3300025927	Bacteria	1676
241	Ga0207700_10064821	3300025928	Bacteria	2784
242	Ga0207664_10096132	3300025929	Bacteria	2438
243	Ga0207664_10160305	3300025929	Bacteria	1918
244	Ga0207664_10566411	3300025929	Bacteria	1020
245	Ga0207644_10011853	3300025931	Bacteria	5776
246	Ga0207690_10035473	3300025932	Bacteria	3222
247	Ga0207690_10236421	3300025932	Bacteria	1405
248	Ga0207706_10006892	3300025933	Bacteria	10507
249	Ga0207706_10065444	3300025933	Bacteria	3201
250	Ga0207686_10010526	3300025934	Bacteria	5039
251	Ga0207686_10071280	3300025934	Bacteria	2236
252	Ga0207709_10001513	3300025935	Bacteria	16052
253	Ga0207709_10075816	3300025935	Bacteria	2151
254	Ga0207669_10000307	3300025937	Bacteria	22365
255	Ga0207669_10073232	3300025937	Bacteria	2160
256	Ga0207669_10155117	3300025937	Bacteria	1609
257	Ga0207704_10003260	3300025938	Bacteria	7363
258	Ga0207665_10002990	3300025939	Bacteria	11345
259	Ga0207665_10014627	3300025939	Bacteria	5166
260	Ga0207691_10135399	3300025940	Bacteria	2173
261	Ga0207691_10215434	3300025940	Bacteria	1667
262	Ga0207711_10000214	3300025941	Bacteria	62139
263	Ga0207711_10151313	3300025941	Bacteria	2094
264	Ga0207689_10050977	3300025942	Bacteria	3412
265	Ga0207661_10164624	3300025944	Bacteria	1926
266	Ga0207667_10129804	3300025949	Bacteria	2596
267	Ga0207667_10256759	3300025949	Bacteria	1788
268	Ga0207712_10000006	3300025961	Bacteria	573204
269	Ga0207712_10008981	3300025961	Bacteria	6321
270	Ga0207712_10058792	3300025961	Bacteria	2718
271	Ga0207712_10736231	3300025961	Bacteria	863
272	Ga0207668_10006381	3300025972	Bacteria	6968
273	Ga0207668_10019244	3300025972	Bacteria	4311
274	Ga0207668_10388868	3300025972	Bacteria	1176
275	Ga0207640_10008792	3300025981	Bacteria	5619
276	Ga0207658_10009070	3300025986	Bacteria	6746
277	Ga0207658_10014343	3300025986	Bacteria	5427
278	Ga0207658_10136039	3300025986	Bacteria	1981
279	Ga0207658_10228611	3300025986	Bacteria	1569
280	Ga0207677_10002345	3300026023	Bacteria	9932
281	Ga0207677_10174373	3300026023	Bacteria	1685
282	Ga0207703_10007071	3300026035	Bacteria	8930
283	Ga0207703_10080178	3300026035	Bacteria	2718
284	Ga0207639_10004970	3300026041	Bacteria	8956
285	Ga0207639_10028899	3300026041	Bacteria	4053
286	Ga0207639_10065009	3300026041	Bacteria	2830
287	Ga0207678_10006467	3300026067	Bacteria	10396
288	Ga0207678_10168431	3300026067	Bacteria	1871
289	Ga0207708_10041083	3300026075	Bacteria	3526
290	Ga0207702_10093548	3300026078	Bacteria	2636
291	Ga0207641_10055538	3300026088	Bacteria	3363
292	Ga0207641_10056069	3300026088	Bacteria	3347
293	Ga0207641_10265373	3300026088	Bacteria	1609
294	Ga0207641_10532111	3300026088	Bacteria	1144
295	Ga0207648_10007257	3300026089	Bacteria	10927
296	Ga0207648_10100040	3300026089	Bacteria	2539
297	Ga0207675_100008491	3300026118	Bacteria	9670
298	Ga0207675_100152457	3300026118	Bacteria	2200
299	Ga0207683_10005423	3300026121	Bacteria	10927
300	Ga0207683_10073938	3300026121	Bacteria	3015
301	Ga0209813_10142621	3300027866	Bacteria	852
302	Ga0268266_10006413	3300028379	Bacteria	10779
303	Ga0268266_10029976	3300028379	Bacteria	4623
304	Ga0268266_10367018	3300028379	Bacteria	1355
305	Ga0268266_10546951	3300028379	Bacteria	1109
306	Ga0268266_11355064	3300028379	Bacteria	687
307	Ga0268265_10000192	3300028380	Bacteria	71772
308	Ga0268265_10010664	3300028380	Bacteria	6206
309	Ga0268265_10186599	3300028380	Bacteria	1787
310	Ga0268265_10548237	3300028380	Bacteria	1097
311	Ga0268264_10000339	3300028381	Bacteria	71891
312	Ga0268264_10002354	3300028381	Bacteria	16689
313	Ga0268264_10121144	3300028381	Bacteria	2305
314	Ga0268264_10312877	3300028381	Bacteria	1482
315	Ga0265327_10015358	3300031251	Bacteria	4947
316	Ga0307405_10399771	3300031731	Bacteria	1075
317	Ga0307413_10956690	3300031824	Bacteria	731
318	Ga0307410_10207896	3300031852	Bacteria	1498
319	Ga0307406_10061822	3300031901	Bacteria	2420
320	Ga0307406_10348495	3300031901	Bacteria	1156
321	Ga0307412_10362444	3300031911	Bacteria	1168
322	Ga0307409_100154838	3300031995	Bacteria	1996
323	Ga0307409_100163262	3300031995	Bacteria	1951
324	Ga0307416_100051755	3300032002	Bacteria	3283
325	Ga0307411_10086321	3300032005	Bacteria	2177
326	Ga0307411_10358988	3300032005	Bacteria	1191
327	Ga0307411_10964955	3300032005	Bacteria	761
328	Ga0307415_100208398	3300032126	Bacteria	1557
329	Ga0307415_100332585	3300032126	Bacteria	1272
330	Ga0373929_0004400	3300035085	Bacteria	2527
331	Ga0373951_0043202	3300035091	Bacteria	1092
332	Ga0373932_0106119	3300035112	Bacteria	920
333	Ga0373931_0012021	3300035691	Bacteria	4190
334	Ga0436364_0388127	3300037853	Bacteria	9951
335	Ga0436364_0858783	3300037853	Bacteria	6972
336	Ga0436365_0244635	3300039437	Bacteria	24180
337	Ga0436365_0742534	3300039437	Bacteria	12122
338	Ga0436365_0863130	3300039437	Bacteria	48169
339	Ga0436360_1159704	3300039438	Bacteria	1047
340	Ga0436361_0082527	3300039447	Bacteria	905
341	Ga0436363_0040238	3300039450	Bacteria	2148
342	Ga0436363_0147846	3300039450	Bacteria	2553
343	Ga0436363_0593333	3300039450	Bacteria	1007
344	Ga0436363_1392710	3300039450	Bacteria	3955
345	Ga0439466_0021185	3300041411	Bacteria	2308
346	Ga0439465_0042277	3300041413	Bacteria	1476
347	Ga0451795_1364933	3300041456	Bacteria	1426
348	Ga0451795_1616838	3300041456	Bacteria	967
349	Ga0439431_0000156	3300041997	Bacteria	12630
350	Ga0439442_077413	3300042002	Bacteria	710
351	Ga0439445_0004263	3300042004	Bacteria	3234
352	Ga0439445_0046796	3300042004	Bacteria	1160
353	Ga0439448_0032956	3300042005	Bacteria	1650
354	Ga0439434_0024294	3300042435	Bacteria	1828
355	Ga0466969_0032081	3300044656	Bacteria	2672
356	Ga0466972_0021212	3300044658	Bacteria	3241
357	Ga0466972_0045668	3300044658	Bacteria	2122
358	Ga0466972_0119901	3300044658	Bacteria	1241
359	Ga0466965_0002376	3300044683	Bacteria	7975
360	Ga0466965_0006916	3300044683	Bacteria	5190
361	Ga0466965_0152221	3300044683	Bacteria	1209
362	Ga0466965_0197297	3300044683	Bacteria	1066
363	Ga0466966_0004211	3300044684	Bacteria	9491
364	Ga0466966_0022657	3300044684	Bacteria	4120
365	Ga0466966_0071978	3300044684	Bacteria	2165
366	Ga0466966_0187580	3300044684	Bacteria	1253
367	Ga0466961_0006483	3300044693	Bacteria	7435
368	Ga0466961_0026191	3300044693	Bacteria	3751
369	Ga0466963_0052430	3300044694	Bacteria	2707
370	Ga0466963_0054295	3300044694	Bacteria	2662
371	Ga0466963_0128488	3300044694	Bacteria	1749
372	Ga0466963_0653291	3300044694	Bacteria	742
373	Ga0466971_0006004	3300044719	Bacteria	5284
374	Ga0466971_0010912	3300044719	Bacteria	3972
375	Ga0466971_0029380	3300044719	Bacteria	2459
376	Ga0466971_0176513	3300044719	Bacteria	1003
377	Ga0466968_0015439	3300044735	Bacteria	3026
378	Ga0466968_0036641	3300044735	Bacteria	2056
379	Ga0466968_0039579	3300044735	Bacteria	1985
380	Ga0466970_0017656	3300044765	Bacteria	3687
381	Ga0466970_0043683	3300044765	Bacteria	2385
382	Ga0466970_0104038	3300044765	Bacteria	1548
383	Ga0466957_0002255	3300044842	Bacteria	10331
384	Ga0466957_0010851	3300044842	Bacteria	5238
385	Ga0466957_0015240	3300044842	Bacteria	4489
386	Ga0466957_0244850	3300044842	Bacteria	1191
387	Ga0466960_0001134	3300044901	Bacteria	9561
388	Ga0466960_0001560	3300044901	Bacteria	8383
389	Ga0466960_0011428	3300044901	Bacteria	3714
390	Ga0466960_0095594	3300044901	Bacteria	1522
391	Ga0466959_0013447	3300045049	Bacteria	5931
392	Ga0466959_0070165	3300045049	Bacteria	2538
393	Ga0466958_0006292	3300045836	Bacteria	6451
394	Ga0466958_0034664	3300045836	Bacteria	3012
395	Ga0466958_0115073	3300045836	Bacteria	1681
396	Ga0466958_0282402	3300045836	Bacteria	1064
397	Ga0466967_0050131	3300045976	Bacteria	3655
398	Ga0466967_0065960	3300045976	Bacteria	3224
399	Ga0466967_0122809	3300045976	Bacteria	2402
400	Ga0466967_0124960	3300045976	Bacteria	2382
401	Ga0466967_0126617	3300045976	Bacteria	2367
402	Ga0466967_0373488	3300045976	Bacteria	1383
403	Ga0466967_0576310	3300045976	Bacteria	1109
404	Ga0466967_0617625	3300045976	Bacteria	1070
405	Ga0466967_0643634	3300045976	Bacteria	1048
406	Ga0495638_0005478	3300046460	Bacteria	9437
407	Ga0495648_0000665	3300046524	Bacteria	36750
408	Ga0495654_0044151	3300046530	Bacteria	2206
409	Ga0495649_0377305	3300046694	Bacteria	714
410	Ga0495672_0003273	3300047320	Bacteria	14020
411	Ga0495673_0000721	3300047469	Bacteria	31896
412	Ga0495686_0014272	3300047472	Bacteria	5472
413	Ga0496100_0000025	3300048903	Bacteria	115919
414	Ga0496100_0002570	3300048903	Bacteria	9244
415	Ga0496100_0007679	3300048903	Bacteria	5967
416	Ga0496100_0114306	3300048903	Bacteria	1880
417	Ga0496100_0240466	3300048903	Bacteria	1335
418	Ga0496101_0000068	3300048904	Bacteria	120985
419	Ga0496101_0000078	3300048904	Bacteria	108113
420	Ga0496101_0000389	3300048904	Bacteria	28799
421	Ga0496101_0001943	3300048904	Bacteria	12518
422	Ga0496101_0007705	3300048904	Bacteria	6995
423	Ga0496101_0017570	3300048904	Bacteria	4852
424	Ga0496101_0041072	3300048904	Bacteria	3297
425	Ga0496102_0000056	3300048905	Bacteria	172707
426	Ga0496102_0000841	3300048905	Bacteria	29462
427	Ga0496102_0007765	3300048905	Bacteria	9169
428	Ga0496102_0013428	3300048905	Bacteria	7094
429	Ga0496102_0034186	3300048905	Bacteria	4572
430	Ga0496102_0034233	3300048905	Bacteria	4568
431	Ga0496102_0048456	3300048905	Bacteria	3863
432	Ga0496102_0094092	3300048905	Bacteria	2776
433	Ga0496102_0231730	3300048905	Bacteria	1741
434	Ga0496102_0256550	3300048905	Bacteria	1648
435	Ga0496103_0000040	3300048906	Bacteria	172148
436	Ga0496103_0000639	3300048906	Bacteria	26650
437	Ga0496103_0000809	3300048906	Bacteria	22964
438	Ga0496103_0003673	3300048906	Bacteria	9335
439	Ga0496103_0044311	3300048906	Bacteria	2741
440	Ga0496103_0087377	3300048906	Bacteria	1965
441	Ga0496103_0137230	3300048906	Bacteria	1563
442	Ga0496104_0023925	3300048907	Bacteria	5618
443	Ga0496104_0196880	3300048907	Bacteria	1927
444	Ga0496104_0671951	3300048907	Bacteria	944
445	Ga0496105_0007442	3300048908	Bacteria	8476
446	Ga0496105_0038199	3300048908	Bacteria	3955
447	Ga0496105_0391255	3300048908	Bacteria	1105
448	Ga0496106_0001853	3300048909	Bacteria	15825
449	Ga0496106_0003193	3300048909	Bacteria	12262
450	Ga0496106_0022214	3300048909	Bacteria	4712
451	Ga0496106_0206659	3300048909	Bacteria	1563
452	Ga0496106_0382784	3300048909	Bacteria	1130
453	Ga0496107_0000775	3300048910	Bacteria	18484
454	Ga0496107_0005027	3300048910	Bacteria	9012
455	Ga0496107_0007713	3300048910	Bacteria	7432
456	Ga0496107_0062489	3300048910	Bacteria	2698
457	Ga0496107_0088517	3300048910	Bacteria	2260
458	Ga0496107_0547848	3300048910	Bacteria	857
459	Ga0496108_0015081	3300048911	Bacteria	6309
460	Ga0496108_0086968	3300048911	Bacteria	2654
461	Ga0496108_0278844	3300048911	Bacteria	1455
462	Ga0496108_0545356	3300048911	Bacteria	1012
463	Ga0496109_0000175	3300048912	Bacteria	63767
464	Ga0496109_0015322	3300048912	Bacteria	6678
465	Ga0496109_0067976	3300048912	Bacteria	3265
466	Ga0496109_0085741	3300048912	Bacteria	2908
467	Ga0496109_0293548	3300048912	Bacteria	1533
468	Ga0496110_0000855	3300048913	Bacteria	21465
469	Ga0496110_0051621	3300048913	Bacteria	3614
470	Ga0496110_0972626	3300048913	Bacteria	756
471	Ga0496111_0066631	3300048914	Bacteria	2615
472	Ga0496111_0137129	3300048914	Bacteria	1813
473	Ga0496112_0010793	3300048915	Bacteria	8309
474	Ga0496112_0097475	3300048915	Bacteria	2911
475	Ga0496112_0136391	3300048915	Bacteria	2424
476	Ga0496112_0152096	3300048915	Bacteria	2281
477	Ga0496112_0294911	3300048915	Bacteria	1567
478	Ga0496113_0001736	3300048916	Bacteria	12338
479	Ga0496113_0177453	3300048916	Bacteria	1688
480	Ga0496113_0475029	3300048916	Bacteria	1004
481	Ga0496114_0001037	3300048917	Bacteria	20905
482	Ga0496114_0002044	3300048917	Bacteria	15364
483	Ga0496114_0008476	3300048917	Bacteria	8146
484	Ga0496115_0001320	3300048918	Bacteria	17679
485	Ga0496115_0020486	3300048918	Bacteria	5102
486	Ga0496115_0042503	3300048918	Bacteria	3620
487	Ga0496115_0275710	3300048918	Bacteria	1381
488	Ga0496115_0450200	3300048918	Bacteria	1040
489	Ga0496116_0000056	3300048919	Bacteria	282554
490	Ga0496116_0002553	3300048919	Bacteria	19018
491	Ga0496116_0028367	3300048919	Bacteria	4056
492	Ga0496117_0000003	3300048920	Bacteria	1881097
493	Ga0496117_0000874	3300048920	Bacteria	46484
494	Ga0496117_0043217	3300048920	Bacteria	3279
495	Ga0496118_0000001	3300048921	Bacteria	1881100
496	Ga0496118_0001040	3300048921	Bacteria	43213
497	Ga0496118_0001451	3300048921	Bacteria	35702
498	Ga0496118_0007434	3300048921	Bacteria	11612
499	Ga0496119_0000263	3300048922	Bacteria	74497
500	Ga0496119_0004171	3300048922	Bacteria	14512
501	Ga0496119_0004435	3300048922	Bacteria	13971
502	Ga0496120_0000318	3300048923	Bacteria	79637
503	Ga0496120_0004468	3300048923	Bacteria	11718
504	Ga0496120_0020965	3300048923	Bacteria	4138
505	Ga0496120_0186767	3300048923	Bacteria	1013
506	Ga0496121_0000023	3300048924	Bacteria	463448
507	Ga0496121_0000121	3300048924	Bacteria	172480
508	Ga0496121_0005689	3300048924	Bacteria	15845
509	Ga0496122_0000038	3300048925	Bacteria	295624
510	Ga0496122_0053748	3300048925	Bacteria	3032
511	Ga0496123_0007288	3300048926	Bacteria	10495
512	Ga0496123_0054433	3300048926	Bacteria	2634
513	Ga0496124_0000014	3300048927	Bacteria	463448
514	Ga0496124_0314444	3300048927	Bacteria	1124
515	Ga0496125_0000020	3300048928	Bacteria	463448
516	Ga0496125_0008237	3300048928	Bacteria	10951
517	Ga0496126_0000023	3300048929	Bacteria	463448
518	Ga0496126_0000837	3300048929	Bacteria	54604
519	Ga0496126_0006513	3300048929	Bacteria	12996
520	Ga0496126_0547265	3300048929	Bacteria	919
521	Ga0501032_0000516	3300049569	Bacteria	31374
522	Ga0501032_0006467	3300049569	Bacteria	8615
523	Ga0501033_0053325	3300049570	Bacteria	2995
524	Ga0501034_0003109	3300049571	Bacteria	19140
525	Ga0501034_0005269	3300049571	Bacteria	14191
526	Ga0501034_0071212	3300049571	Bacteria	3487
527	Ga0501034_0094696	3300049571	Bacteria	2983
528	Ga0501034_0121455	3300049571	Bacteria	2599
529	Ga0501036_0049233	3300049572	Bacteria	3568
530	Ga0501036_0133145	3300049572	Bacteria	2098
531	Ga0501037_0000165	3300049573	Bacteria	62545
532	Ga0501037_0022713	3300049573	Bacteria	4638
533	Ga0501038_0000292	3300049574	Bacteria	42699
534	Ga0501039_0000485	3300049575	Bacteria	28766
535	Ga0501043_0003108	3300049579	Bacteria	13761
536	Ga0501043_0030690	3300049579	Bacteria	4226
537	Ga0501046_0013826	3300049580	Bacteria	6819
538	Ga0501047_0003048	3300049581	Bacteria	15901
539	Ga0501047_0009188	3300049581	Bacteria	9333
540	Ga0501047_0038758	3300049581	Bacteria	4610
541	Ga0501047_0408791	3300049581	Bacteria	1190
542	Ga0501048_0011023	3300049582	Bacteria	6745
543	Ga0501067_0075137	3300049583	Bacteria	1872
544	Ga0501070_0000573	3300049586	Bacteria	33479
545	Ga0501070_0003192	3300049586	Bacteria	14259
546	Ga0501070_0017567	3300049586	Bacteria	6004
547	Ga0501072_0438837	3300049588	Bacteria	1034
548	Ga0501073_0038568	3300049589	Bacteria	3388
549	Ga0501080_0064168	3300049742	Bacteria	3417
550	Ga0501080_0210470	3300049742	Bacteria	1782
551	Ga0501083_0097207	3300049744	Bacteria	1943
552	Ga0501083_0306218	3300049744	Bacteria	1033
553	Ga0501044_0000239	3300049823	Bacteria	69462
554	Ga0501044_0001384	3300049823	Bacteria	28445
555	Ga0501044_0010131	3300049823	Bacteria	10243
556	Ga0501044_0816655	3300049823	Bacteria	811
557	nmdc:mga03683_24619_c1	3300050489	Bacteria	2357
558	nmdc:mga03n38_11746_c1	3300050490	Bacteria	3273
559	nmdc:mga03n38_212340_c1	3300050490	Bacteria	1006
560	nmdc:mga03n38_254556_c1	3300050490	Bacteria	929
561	nmdc:mga03n38_33403_c1	3300050490	Bacteria	2189
562	nmdc:mga03n38_3494_c1	3300050490	Bacteria	5058
563	nmdc:mga03n38_36105_c1	3300050490	Bacteria	2123
564	nmdc:mga03n38_57951_c1	3300050490	Bacteria	1753
565	nmdc:mga00v17_18806_c1	3300050491	Bacteria	3931
566	nmdc:mga00v17_215033_c1	3300050491	Bacteria	1244
567	nmdc:mga00v17_2538_c1	3300050491	Bacteria	9348
568	nmdc:mga00v17_278_c1	3300050491	Bacteria	17754
569	nmdc:mga00v17_31159_c1	3300050491	Bacteria	3143
570	nmdc:mga00v17_4381_c1	3300050491	Bacteria	7337
571	nmdc:mga00v17_58250_c1	3300050491	Bacteria	2366
572	nmdc:mga0yw44_301569_c1	3300050492	Bacteria	1073
573	nmdc:mga0yw44_42851_c1	3300050492	Bacteria	2700
574	nmdc:mga0yw44_446534_c1	3300050492	Bacteria	876
575	nmdc:mga0yw44_46310_c1	3300050492	Bacteria	2611
576	nmdc:mga0yw44_68100_c1	3300050492	Bacteria	2201
577	nmdc:mga0yw44_68204_c1	3300050492	Bacteria	2200
578	nmdc:mga0k408_103066_c1	3300050493	Bacteria	1683
579	nmdc:mga04h51_67779_c1	3300050495	Bacteria	1239
580	nmdc:mga06r32_80655_c1	3300050510	Bacteria	3167
581	nmdc:mga0sz30_253208_c1	3300050516	Bacteria	784
582	nmdc:mga0sz30_2672_c5	3300050516	Bacteria	2008
583	nmdc:mga0sz30_284_c2	3300050516	Bacteria	16571
584	nmdc:mga0sz30_5486_c1	3300050516	Bacteria	4658
585	nmdc:mga0sz30_64596_c1	3300050516	Bacteria	1568
586	Ga0500610_0008952	3300053079	Bacteria	4398
587	Ga0495655_0002728	3300053083	Bacteria	2835
588	Ga0500643_009663	3300053087	Bacteria	3664
589	Ga0500646_0025634	3300053090	Bacteria	1594
590	Ga0500556_0002590	3300053104	Bacteria	5701
591	Ga0500642_0058602	3300053130	Bacteria	1722
592	Ga0500616_0019734	3300053153	Bacteria	3796
593	Ga0500616_0023057	3300053153	Bacteria	3471
594	Ga0500611_081597	3300053727	Bacteria	808
595	Ga0466962_0008477	3300061719	Bacteria	4925
596	Ga0466962_0016905	3300061719	Bacteria	3515

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300006186	Ga0075369_10119552	Ga0075369_101195521	183
2	3300031731	Ga0307405_10399771	Ga0307405_103997711	184
3	3300031901	Ga0307406_10061822	Ga0307406_100618223	184
4	3300031995	Ga0307409_100154838	Ga0307409_1001548383	184
5	3300032005	Ga0307411_10964955	Ga0307411_109649552	184
6	3300041997	Ga0439431_0000156	Ga0439431_0000156_9630_10283	184
7	3300042004	Ga0439445_0004263	Ga0439445_0004263_425_1078	184
8	3300039450	Ga0436363_0593333	Ga0436363_0593333_362_928	188
9	3300006051	Ga0075364_10009424	Ga0075364_100094246	190
10	3300025901	Ga0207688_10167204	Ga0207688_101672042	190
11	3300031901	Ga0307406_10348495	Ga0307406_103484951	190
12	3300050491	nmdc:mga00v17_2538_c1	nmdc:mga00v17_2538_c1_3448_4101	190
13	3300006846	Ga0075430_100247572	Ga0075430_1002475722	191
14	3300006847	Ga0075431_100055852	Ga0075431_1000558523	191
15	3300009147	Ga0114129_10024907	Ga0114129_1002490712	191
16	3300041411	Ga0439466_0021185	Ga0439466_0021185_258_833	191
17	3300042002	Ga0439442_077413	Ga0439442_077413_33_608	191
18	3300050510	nmdc:mga06r32_80655_c1	nmdc:mga06r32_80655_c1_455_1111	191
19	3300025972	Ga0207668_10388868	Ga0207668_103888681	192
20	3300046694	Ga0495649_0377305	Ga0495649_0377305_85_672	193
21	3300005367	Ga0070667_100000462	Ga0070667_10000046224	194
22	3300005548	Ga0070665_100004564	Ga0070665_10000456414	194
23	3300005617	Ga0068859_100000837	Ga0068859_10000083732	194
24	3300005843	Ga0068860_100000287	Ga0068860_10000028752	194
25	3300006931	Ga0097620_100000837	Ga0097620_1000008374	194
26	3300009177	Ga0105248_10000181	Ga0105248_1000018153	194
27	3300025941	Ga0207711_10000214	Ga0207711_1000021424	194
28	3300028379	Ga0268266_10006413	Ga0268266_100064134	194
29	3300028381	Ga0268264_10000339	Ga0268264_1000033952	194
30	3300048905	Ga0496102_0000841	Ga0496102_0000841_20522_21172	194
31	3300048906	Ga0496103_0003673	Ga0496103_0003673_5752_6402	194
32	3300048920	Ga0496117_0000874	Ga0496117_0000874_25317_25967	194
33	3300048921	Ga0496118_0001451	Ga0496118_0001451_2980_3630	194
34	3300006186	Ga0075369_10188962	Ga0075369_101889622	199
35	3300005435	Ga0070714_100025952	Ga0070714_1000259524	200
36	3300039437	Ga0436365_0863130	Ga0436365_0863130_37218_37871	203
37	3300048905	Ga0496102_0231730	Ga0496102_0231730_339_989	203
38	3300048906	Ga0496103_0137230	Ga0496103_0137230_496_1146	203
39	3300048921	Ga0496118_0001040	Ga0496118_0001040_27968_28618	203
40	3300005353	Ga0070669_100009169	Ga0070669_1000091694	204
41	3300006042	Ga0075368_10003911	Ga0075368_100039114	204
42	3300006048	Ga0075363_100002854	Ga0075363_1000028544	204
43	3300006178	Ga0075367_10034150	Ga0075367_100341504	204
44	3300006195	Ga0075366_10059820	Ga0075366_100598203	204
45	3300006353	Ga0075370_10023068	Ga0075370_100230682	204
46	3300009101	Ga0105247_10000134	Ga0105247_1000013452	204
47	3300014968	Ga0157379_10124213	Ga0157379_101242134	204
48	3300025900	Ga0207710_10000163	Ga0207710_1000016324	204
49	3300025923	Ga0207681_10007164	Ga0207681_100071644	204
50	3300026035	Ga0207703_10007071	Ga0207703_1000707112	204
51	3300027866	Ga0209813_10142621	Ga0209813_101426211	204
52	3300048903	Ga0496100_0240466	Ga0496100_0240466_140_790	204
53	3300048904	Ga0496101_0001943	Ga0496101_0001943_9317_9967	204
54	3300048910	Ga0496107_0088517	Ga0496107_0088517_1302_1952	204
55	3300048922	Ga0496119_0004435	Ga0496119_0004435_2086_2736	204
56	3300048923	Ga0496120_0004468	Ga0496120_0004468_2876_3526	204
57	3300048924	Ga0496121_0005689	Ga0496121_0005689_4689_5339	204
58	3300048927	Ga0496124_0314444	Ga0496124_0314444_413_1063	204
59	3300048928	Ga0496125_0008237	Ga0496125_0008237_8828_9478	204
60	3300048929	Ga0496126_0006513	Ga0496126_0006513_10861_11511	204
61	3300049586	Ga0501070_0017567	Ga0501070_0017567_4547_5206	204
62	3300049588	Ga0501072_0438837	Ga0501072_0438837_61_720	204
63	3300049742	Ga0501080_0210470	Ga0501080_0210470_859_1518	204
64	3300049744	Ga0501083_0306218	Ga0501083_0306218_283_942	204
65	3300050490	nmdc:mga03n38_212340_c1	nmdc:mga03n38_212340_c1_68_724	204
66	3300050490	nmdc:mga03n38_3494_c1	nmdc:mga03n38_3494_c1_3497_4153	204
67	3300050491	nmdc:mga00v17_58250_c1	nmdc:mga00v17_58250_c1_1290_1946	204
68	3300050492	nmdc:mga0yw44_68204_c1	nmdc:mga0yw44_68204_c1_1457_2113	204
69	3300050493	nmdc:mga0k408_103066_c1	nmdc:mga0k408_103066_c1_307_963	204
70	3300050495	nmdc:mga04h51_67779_c1	nmdc:mga04h51_67779_c1_69_725	204
71	3300006048	Ga0075363_100012989	Ga0075363_1000129894	205
72	3300050490	nmdc:mga03n38_33403_c1	nmdc:mga03n38_33403_c1_529_1185	205
73	3300050492	nmdc:mga0yw44_68100_c1	nmdc:mga0yw44_68100_c1_1402_2058	205
74	3300006038	Ga0075365_10232630	Ga0075365_102326302	206
75	3300050492	nmdc:mga0yw44_301569_c1	nmdc:mga0yw44_301569_c1_264_920	206
76	3300006186	Ga0075369_10090680	Ga0075369_100906802	207
77	3300050516	nmdc:mga0sz30_64596_c1	nmdc:mga0sz30_64596_c1_539_1192	207
78	3300044694	Ga0466963_0128488	Ga0466963_0128488_119_769	208
79	3300045976	Ga0466967_0065960	Ga0466967_0065960_356_1006	208
80	3300039447	Ga0436361_0082527	Ga0436361_0082527_78_725	209
81	3300005347	Ga0070668_100337375	Ga0070668_1003373751	210
82	3300005719	Ga0068861_100142358	Ga0068861_1001423583	210
83	3300013306	Ga0163162_10083555	Ga0163162_100835552	210
84	3300017792	Ga0163161_10121107	Ga0163161_101211072	210
85	3300026118	Ga0207675_100152457	Ga0207675_1001524573	210
86	3300044683	Ga0466965_0152221	Ga0466965_0152221_55_705	210
87	3300044684	Ga0466966_0022657	Ga0466966_0022657_3036_3686	210
88	3300044719	Ga0466971_0176513	Ga0466971_0176513_178_828	210
89	3300044842	Ga0466957_0002255	Ga0466957_0002255_2435_3085	210
90	3300045836	Ga0466958_0034664	Ga0466958_0034664_17_667	210
91	iso_pu_bacteria	2902799365	2902801412	211
92	3300005355	Ga0070671_100000408	Ga0070671_10000040832	212
93	3300005367	Ga0070667_100165127	Ga0070667_1001651272	212
94	3300005548	Ga0070665_100007417	Ga0070665_10000741710	212
95	3300005841	Ga0068863_100130497	Ga0068863_1001304972	212
96	3300014325	Ga0163163_10036486	Ga0163163_100364863	212
97	3300025925	Ga0207650_10148421	Ga0207650_101484212	212
98	3300025931	Ga0207644_10011853	Ga0207644_100118537	212
99	3300025986	Ga0207658_10136039	Ga0207658_101360391	212
100	3300026088	Ga0207641_10056069	Ga0207641_100560695	212
101	3300028379	Ga0268266_10029976	Ga0268266_100299761	212
102	3300048903	Ga0496100_0114306	Ga0496100_0114306_1007_1663	212
103	3300048905	Ga0496102_0094092	Ga0496102_0094092_1532_2188	212
104	3300048908	Ga0496105_0007442	Ga0496105_0007442_1450_2106	212
105	3300048913	Ga0496110_0051621	Ga0496110_0051621_2899_3555	212
106	3300048915	Ga0496112_0136391	Ga0496112_0136391_457_1113	212
107	iso_pu_bacteria	2643221715	2644637601	212
108	iso_pu_bacteria	2738541264	2738666752	212
109	iso_pu_bacteria	2738541356	2739145596	212
110	iso_pu_bacteria	2902792274	2902796441	212
111	iso_pu_bacteria	2902810491	2902815305	212
112	iso_pu_bacteria	2902837492	2902840327	212
113	iso_pu_bacteria	2939582691	2939587554	212
114	3300003323	rootH1_10181653	rootH1_101816531	213
115	3300044658	Ga0466972_0119901	Ga0466972_0119901_402_1058	213
116	3300044901	Ga0466960_0095594	Ga0466960_0095594_725_1381	213
117	iso_pu_bacteria	2929212328	2929215178	213
118	3300045976	Ga0466967_0050131	Ga0466967_0050131_2068_2727	214
119	3300044656	Ga0466969_0032081	Ga0466969_0032081_222_869	215
120	3300044684	Ga0466966_0004211	Ga0466966_0004211_3652_4299	215
121	3300044693	Ga0466961_0026191	Ga0466961_0026191_326_973	215
122	3300044765	Ga0466970_0043683	Ga0466970_0043683_619_1266	215
123	3300045049	Ga0466959_0013447	Ga0466959_0013447_3270_3917	215
124	3300045836	Ga0466958_0282402	Ga0466958_0282402_32_679	215
125	3300003320	rootH2_10139749	rootH2_101397492	216
126	3300003792	Ga0055540_1000065	Ga0055540_1000065141	216
127	3300003792	Ga0055540_1000655	Ga0055540_100065524	216
128	3300003792	Ga0055540_1004782	Ga0055540_10047824	216
129	3300003792	Ga0055540_1010111	Ga0055540_10101112	216
130	3300005329	Ga0070683_100211996	Ga0070683_1002119962	216
131	3300005337	Ga0070682_100007645	Ga0070682_1000076451	216
132	3300005355	Ga0070671_100444210	Ga0070671_1004442102	216
133	3300005356	Ga0070674_100051984	Ga0070674_1000519843	216
134	3300005367	Ga0070667_100000252	Ga0070667_10000025236	216
135	3300005435	Ga0070714_100034453	Ga0070714_1000344534	216
136	3300005436	Ga0070713_100101856	Ga0070713_1001018561	216
137	3300005436	Ga0070713_100586449	Ga0070713_1005864491	216
138	3300005440	Ga0070705_100841600	Ga0070705_1008416001	216
139	3300005455	Ga0070663_100050253	Ga0070663_1000502535	216
140	3300005455	Ga0070663_100132835	Ga0070663_1001328353	216
141	3300005455	Ga0070663_100426166	Ga0070663_1004261661	216
142	3300005456	Ga0070678_100169628	Ga0070678_1001696282	216
143	3300005466	Ga0070685_10094476	Ga0070685_100944762	216
144	3300005539	Ga0068853_100901408	Ga0068853_1009014081	216
145	3300005549	Ga0070704_100679661	Ga0070704_1006796611	216
146	3300005563	Ga0068855_100044500	Ga0068855_1000445008	216
147	3300005578	Ga0068854_100165766	Ga0068854_1001657663	216
148	3300005841	Ga0068863_100028479	Ga0068863_1000284796	216
149	3300005844	Ga0068862_100000296	Ga0068862_1000002964	216
150	3300005937	Ga0081455_10055276	Ga0081455_100552762	216
151	3300006028	Ga0070717_10069194	Ga0070717_100691943	216
152	3300006048	Ga0075363_100001282	Ga0075363_10000128212	216
153	3300006048	Ga0075363_100001470	Ga0075363_1000014704	216
154	3300006051	Ga0075364_10013625	Ga0075364_100136254	216
155	3300006186	Ga0075369_10020488	Ga0075369_100204884	216
156	3300006186	Ga0075369_10119786	Ga0075369_101197862	216
157	3300006358	Ga0068871_100218341	Ga0068871_1002183413	216
158	3300006931	Ga0097620_100266225	Ga0097620_1002662253	216
159	3300009177	Ga0105248_10220883	Ga0105248_102208834	216
160	3300009545	Ga0105237_10007707	Ga0105237_1000770713	216
161	3300009545	Ga0105237_10673472	Ga0105237_106734721	216
162	3300009551	Ga0105238_10432051	Ga0105238_104320512	216
163	3300009553	Ga0105249_10000189	Ga0105249_1000018952	216
164	3300010375	Ga0105239_10043967	Ga0105239_100439678	216
165	3300010375	Ga0105239_10056909	Ga0105239_100569096	216
166	3300010375	Ga0105239_10491181	Ga0105239_104911812	216
167	3300013105	Ga0157369_10032915	Ga0157369_100329159	216
168	3300021377	Ga0213874_10072505	Ga0213874_100725051	216
169	3300021384	Ga0213876_10005721	Ga0213876_1000572111	216
170	3300021384	Ga0213876_10040713	Ga0213876_100407132	216
171	3300021384	Ga0213876_10093169	Ga0213876_100931692	216
172	3300025273	Ga0209673_1028702	Ga0209673_10287022	216
173	3300025273	Ga0209673_1077808	Ga0209673_10778081	216
174	3300025303	Ga0209051_1000042	Ga0209051_1000042141	216
175	3300025303	Ga0209051_1000612	Ga0209051_100061227	216
176	3300025303	Ga0209051_1000905	Ga0209051_100090518	216
177	3300025303	Ga0209051_1003327	Ga0209051_100332712	216
178	3300025928	Ga0207700_10064821	Ga0207700_100648214	216
179	3300025929	Ga0207664_10160305	Ga0207664_101603053	216
180	3300025937	Ga0207669_10155117	Ga0207669_101551172	216
181	3300025941	Ga0207711_10151313	Ga0207711_101513131	216
182	3300025944	Ga0207661_10164624	Ga0207661_101646242	216
183	3300025949	Ga0207667_10256759	Ga0207667_102567591	216
184	3300025961	Ga0207712_10000006	Ga0207712_10000006544	216
185	3300025972	Ga0207668_10006381	Ga0207668_1000638110	216
186	3300025986	Ga0207658_10009070	Ga0207658_100090702	216
187	3300026041	Ga0207639_10028899	Ga0207639_100288993	216
188	3300026067	Ga0207678_10006467	Ga0207678_100064676	216
189	3300026067	Ga0207678_10168431	Ga0207678_101684313	216
190	3300026088	Ga0207641_10055538	Ga0207641_100555383	216
191	3300028379	Ga0268266_11355064	Ga0268266_113550641	216
192	3300028380	Ga0268265_10000192	Ga0268265_1000019252	216
193	3300031251	Ga0265327_10015358	Ga0265327_100153583	216
194	3300031824	Ga0307413_10956690	Ga0307413_109566901	216
195	3300031852	Ga0307410_10207896	Ga0307410_102078962	216
196	3300032005	Ga0307411_10358988	Ga0307411_103589881	216
197	3300032126	Ga0307415_100332585	Ga0307415_1003325852	216
198	3300037853	Ga0436364_0388127	Ga0436364_0388127_2440_3090	216
199	3300037853	Ga0436364_0858783	Ga0436364_0858783_238_888	216
200	3300039437	Ga0436365_0244635	Ga0436365_0244635_17605_18255	216
201	3300039437	Ga0436365_0742534	Ga0436365_0742534_3508_4158	216
202	3300039438	Ga0436360_1159704	Ga0436360_1159704_241_891	216
203	3300039450	Ga0436363_0040238	Ga0436363_0040238_819_1469	216
204	3300039450	Ga0436363_0147846	Ga0436363_0147846_150_806	216
205	3300039450	Ga0436363_1392710	Ga0436363_1392710_186_836	216
206	3300041413	Ga0439465_0042277	Ga0439465_0042277_637_1290	216
207	3300041456	Ga0451795_1364933	Ga0451795_1364933_577_1227	216
208	3300041456	Ga0451795_1616838	Ga0451795_1616838_169_864	216
209	3300042005	Ga0439448_0032956	Ga0439448_0032956_874_1524	216
210	3300044658	Ga0466972_0045668	Ga0466972_0045668_1129_1779	216
211	3300044683	Ga0466965_0002376	Ga0466965_0002376_7218_7868	216
212	3300044683	Ga0466965_0006916	Ga0466965_0006916_4387_5037	216
213	3300044683	Ga0466965_0197297	Ga0466965_0197297_349_999	216
214	3300044684	Ga0466966_0187580	Ga0466966_0187580_102_752	216
215	3300044694	Ga0466963_0052430	Ga0466963_0052430_1884_2534	216
216	3300044694	Ga0466963_0054295	Ga0466963_0054295_592_1242	216
217	3300044694	Ga0466963_0653291	Ga0466963_0653291_58_708	216
218	3300044719	Ga0466971_0029380	Ga0466971_0029380_449_1099	216
219	3300044735	Ga0466968_0015439	Ga0466968_0015439_1275_1925	216
220	3300044735	Ga0466968_0039579	Ga0466968_0039579_469_1119	216
221	3300044765	Ga0466970_0017656	Ga0466970_0017656_2505_3155	216
222	3300044765	Ga0466970_0104038	Ga0466970_0104038_99_749	216
223	3300044842	Ga0466957_0015240	Ga0466957_0015240_1567_2217	216
224	3300044842	Ga0466957_0244850	Ga0466957_0244850_498_1148	216
225	3300044901	Ga0466960_0001134	Ga0466960_0001134_2405_3055	216
226	3300044901	Ga0466960_0001560	Ga0466960_0001560_1807_2457	216
227	3300044901	Ga0466960_0011428	Ga0466960_0011428_2379_3029	216
228	3300045049	Ga0466959_0070165	Ga0466959_0070165_645_1295	216
229	3300045836	Ga0466958_0115073	Ga0466958_0115073_330_980	216
230	3300045976	Ga0466967_0122809	Ga0466967_0122809_332_982	216
231	3300045976	Ga0466967_0373488	Ga0466967_0373488_279_929	216
232	3300045976	Ga0466967_0576310	Ga0466967_0576310_16_666	216
233	3300045976	Ga0466967_0617625	Ga0466967_0617625_360_1010	216
234	3300045976	Ga0466967_0643634	Ga0466967_0643634_159_809	216
235	3300046460	Ga0495638_0005478	Ga0495638_0005478_5249_5899	216
236	3300046524	Ga0495648_0000665	Ga0495648_0000665_25318_25968	216
237	3300046530	Ga0495654_0044151	Ga0495654_0044151_865_1515	216
238	3300047320	Ga0495672_0003273	Ga0495672_0003273_5505_6155	216
239	3300047469	Ga0495673_0000721	Ga0495673_0000721_25614_26264	216
240	3300047472	Ga0495686_0014272	Ga0495686_0014272_662_1366	216
241	3300048903	Ga0496100_0000025	Ga0496100_0000025_66584_67234	216
242	3300048903	Ga0496100_0002570	Ga0496100_0002570_2267_2917	216
243	3300048904	Ga0496101_0000068	Ga0496101_0000068_5783_6433	216
244	3300048904	Ga0496101_0000078	Ga0496101_0000078_93476_94126	216
245	3300048904	Ga0496101_0000389	Ga0496101_0000389_2147_2797	216
246	3300048904	Ga0496101_0017570	Ga0496101_0017570_1583_2233	216
247	3300048904	Ga0496101_0041072	Ga0496101_0041072_2177_2836	216
248	3300048905	Ga0496102_0000056	Ga0496102_0000056_92472_93122	216
249	3300048905	Ga0496102_0013428	Ga0496102_0013428_960_1619	216
250	3300048905	Ga0496102_0034233	Ga0496102_0034233_3175_3825	216
251	3300048906	Ga0496103_0000040	Ga0496103_0000040_79569_80219	216
252	3300048906	Ga0496103_0000809	Ga0496103_0000809_10623_11273	216
253	3300048907	Ga0496104_0023925	Ga0496104_0023925_4022_4672	216
254	3300048907	Ga0496104_0671951	Ga0496104_0671951_230_889	216
255	3300048908	Ga0496105_0038199	Ga0496105_0038199_1531_2181	216
256	3300048908	Ga0496105_0391255	Ga0496105_0391255_373_1032	216
257	3300048909	Ga0496106_0001853	Ga0496106_0001853_2240_2890	216
258	3300048909	Ga0496106_0022214	Ga0496106_0022214_1204_1854	216
259	3300048909	Ga0496106_0382784	Ga0496106_0382784_55_714	216
260	3300048910	Ga0496107_0005027	Ga0496107_0005027_4401_5051	216
261	3300048910	Ga0496107_0007713	Ga0496107_0007713_4514_5164	216
262	3300048911	Ga0496108_0015081	Ga0496108_0015081_79_735	216
263	3300048911	Ga0496108_0545356	Ga0496108_0545356_340_996	216
264	3300048912	Ga0496109_0000175	Ga0496109_0000175_22490_23140	216
265	3300048912	Ga0496109_0293548	Ga0496109_0293548_172_828	216
266	3300048913	Ga0496110_0000855	Ga0496110_0000855_17697_18347	216
267	3300048913	Ga0496110_0972626	Ga0496110_0972626_58_714	216
268	3300048914	Ga0496111_0066631	Ga0496111_0066631_1216_1866	216
269	3300048915	Ga0496112_0010793	Ga0496112_0010793_2088_2744	216
270	3300048915	Ga0496112_0294911	Ga0496112_0294911_221_871	216
271	3300048916	Ga0496113_0001736	Ga0496113_0001736_2893_3543	216
272	3300048917	Ga0496114_0001037	Ga0496114_0001037_7974_8624	216
273	3300048917	Ga0496114_0002044	Ga0496114_0002044_3366_4016	216
274	3300048918	Ga0496115_0001320	Ga0496115_0001320_13200_13850	216
275	3300048918	Ga0496115_0020486	Ga0496115_0020486_2681_3331	216
276	3300048918	Ga0496115_0450200	Ga0496115_0450200_270_929	216
277	3300048919	Ga0496116_0000056	Ga0496116_0000056_79586_80236	216
278	3300048919	Ga0496116_0002553	Ga0496116_0002553_3676_4326	216
279	3300048919	Ga0496116_0028367	Ga0496116_0028367_2624_3274	216
280	3300048920	Ga0496117_0000003	Ga0496117_0000003_1800862_1801512	216
281	3300048920	Ga0496117_0043217	Ga0496117_0043217_979_1629	216
282	3300048921	Ga0496118_0000001	Ga0496118_0000001_1800865_1801515	216
283	3300048921	Ga0496118_0007434	Ga0496118_0007434_10759_11409	216
284	3300048922	Ga0496119_0000263	Ga0496119_0000263_61327_61977	216
285	3300048922	Ga0496119_0004171	Ga0496119_0004171_10309_10959	216
286	3300048923	Ga0496120_0000318	Ga0496120_0000318_17789_18439	216
287	3300048923	Ga0496120_0020965	Ga0496120_0020965_2178_2828	216
288	3300048923	Ga0496120_0186767	Ga0496120_0186767_259_909	216
289	3300048924	Ga0496121_0000023	Ga0496121_0000023_48396_49046	216
290	3300048924	Ga0496121_0000121	Ga0496121_0000121_79585_80235	216
291	3300048925	Ga0496122_0000038	Ga0496122_0000038_48396_49046	216
292	3300048925	Ga0496122_0053748	Ga0496122_0053748_2067_2717	216
293	3300048926	Ga0496123_0007288	Ga0496123_0007288_6156_6806	216
294	3300048926	Ga0496123_0054433	Ga0496123_0054433_100_750	216
295	3300048927	Ga0496124_0000014	Ga0496124_0000014_48396_49046	216
296	3300048928	Ga0496125_0000020	Ga0496125_0000020_414403_415053	216
297	3300048929	Ga0496126_0000023	Ga0496126_0000023_48396_49046	216
298	3300048929	Ga0496126_0000837	Ga0496126_0000837_21692_22342	216
299	3300049569	Ga0501032_0000516	Ga0501032_0000516_9805_10455	216
300	3300049569	Ga0501032_0006467	Ga0501032_0006467_4738_5388	216
301	3300049570	Ga0501033_0053325	Ga0501033_0053325_71_721	216
302	3300049571	Ga0501034_0003109	Ga0501034_0003109_9168_9818	216
303	3300049571	Ga0501034_0005269	Ga0501034_0005269_13207_13857	216
304	3300049571	Ga0501034_0071212	Ga0501034_0071212_1548_2198	216
305	3300049571	Ga0501034_0094696	Ga0501034_0094696_2126_2776	216
306	3300049572	Ga0501036_0049233	Ga0501036_0049233_1728_2378	216
307	3300049572	Ga0501036_0133145	Ga0501036_0133145_1056_1706	216
308	3300049573	Ga0501037_0000165	Ga0501037_0000165_12635_13285	216
309	3300049573	Ga0501037_0022713	Ga0501037_0022713_1423_2073	216
310	3300049574	Ga0501038_0000292	Ga0501038_0000292_31318_31968	216
311	3300049575	Ga0501039_0000485	Ga0501039_0000485_15857_16507	216
312	3300049579	Ga0501043_0003108	Ga0501043_0003108_3633_4283	216
313	3300049579	Ga0501043_0030690	Ga0501043_0030690_2639_3289	216
314	3300049580	Ga0501046_0013826	Ga0501046_0013826_5029_5679	216
315	3300049581	Ga0501047_0003048	Ga0501047_0003048_4201_4851	216
316	3300049581	Ga0501047_0009188	Ga0501047_0009188_6559_7209	216
317	3300049581	Ga0501047_0038758	Ga0501047_0038758_2232_2882	216
318	3300049582	Ga0501048_0011023	Ga0501048_0011023_3400_4050	216
319	3300049583	Ga0501067_0075137	Ga0501067_0075137_1070_1720	216
320	3300049586	Ga0501070_0000573	Ga0501070_0000573_23634_24284	216
321	3300049586	Ga0501070_0003192	Ga0501070_0003192_2080_2730	216
322	3300049589	Ga0501073_0038568	Ga0501073_0038568_841_1491	216
323	3300049742	Ga0501080_0064168	Ga0501080_0064168_430_1080	216
324	3300049744	Ga0501083_0097207	Ga0501083_0097207_258_908	216
325	3300049823	Ga0501044_0000239	Ga0501044_0000239_31144_31794	216
326	3300049823	Ga0501044_0001384	Ga0501044_0001384_2576_3226	216
327	3300049823	Ga0501044_0010131	Ga0501044_0010131_7972_8622	216
328	3300049823	Ga0501044_0816655	Ga0501044_0816655_58_708	216
329	3300050490	nmdc:mga03n38_36105_c1	nmdc:mga03n38_36105_c1_1057_1707	216
330	3300050491	nmdc:mga00v17_4381_c1	nmdc:mga00v17_4381_c1_3913_4563	216
331	3300053079	Ga0500610_0008952	Ga0500610_0008952_3232_3882	216
332	3300053083	Ga0495655_0002728	Ga0495655_0002728_1433_2089	216
333	3300053087	Ga0500643_009663	Ga0500643_009663_396_1046	216
334	3300053090	Ga0500646_0025634	Ga0500646_0025634_315_965	216
335	3300053104	Ga0500556_0002590	Ga0500556_0002590_2931_3581	216
336	3300053130	Ga0500642_0058602	Ga0500642_0058602_1050_1700	216
337	3300053153	Ga0500616_0019734	Ga0500616_0019734_952_1602	216
338	3300053153	Ga0500616_0023057	Ga0500616_0023057_35_685	216
339	3300053727	Ga0500611_081597	Ga0500611_081597_78_728	216
340	3300061719	Ga0466962_0016905	Ga0466962_0016905_2541_3191	216
341	iso_pu_bacteria	2643221687	2644486264	216
342	3300006038	Ga0075365_10052536	Ga0075365_100525365	217
343	3300006048	Ga0075363_100101852	Ga0075363_1001018522	217
344	3300006051	Ga0075364_10001632	Ga0075364_100016326	217
345	3300006186	Ga0075369_10000311	Ga0075369_1000031113	217
346	3300044719	Ga0466971_0006004	Ga0466971_0006004_2333_2986	217
347	3300045976	Ga0466967_0126617	Ga0466967_0126617_1394_2050	217
348	3300048905	Ga0496102_0034186	Ga0496102_0034186_2965_3618	217
349	3300048906	Ga0496103_0044311	Ga0496103_0044311_434_1087	217
350	3300048929	Ga0496126_0547265	Ga0496126_0547265_123_788	217
351	3300049581	Ga0501047_0408791	Ga0501047_0408791_355_1023	217
352	3300050490	nmdc:mga03n38_57951_c1	nmdc:mga03n38_57951_c1_604_1257	217
353	3300050491	nmdc:mga00v17_278_c1	nmdc:mga00v17_278_c1_8592_9245	217
354	3300050492	nmdc:mga0yw44_42851_c1	nmdc:mga0yw44_42851_c1_1570_2223	217
355	3300050516	nmdc:mga0sz30_284_c2	nmdc:mga0sz30_284_c2_9089_9742	217
356	3300002077	JGI24744J21845_10000190	JGI24744J21845_100001904	218
357	3300002244	JGI24742J22300_10002749	JGI24742J22300_100027495	218
358	3300005328	Ga0070676_10006152	Ga0070676_100061527	218
359	3300005330	Ga0070690_100118740	Ga0070690_1001187402	218
360	3300005334	Ga0068869_100039011	Ga0068869_1000390113	218
361	3300005335	Ga0070666_10053484	Ga0070666_100534844	218
362	3300005337	Ga0070682_100104823	Ga0070682_1001048231	218
363	3300005337	Ga0070682_100307986	Ga0070682_1003079861	218
364	3300005338	Ga0068868_100020554	Ga0068868_1000205543	218
365	3300005338	Ga0068868_100774890	Ga0068868_1007748901	218
366	3300005341	Ga0070691_10018171	Ga0070691_100181715	218
367	3300005343	Ga0070687_100100887	Ga0070687_1001008872	218
368	3300005343	Ga0070687_100243703	Ga0070687_1002437032	218
369	3300005345	Ga0070692_10095324	Ga0070692_100953242	218
370	3300005347	Ga0070668_100000513	Ga0070668_1000005134	218
371	3300005347	Ga0070668_100434120	Ga0070668_1004341202	218
372	3300005355	Ga0070671_100079841	Ga0070671_1000798411	218
373	3300005355	Ga0070671_100472761	Ga0070671_1004727611	218
374	3300005356	Ga0070674_100015488	Ga0070674_1000154883	218
375	3300005365	Ga0070688_100028739	Ga0070688_1000287393	218
376	3300005365	Ga0070688_100162220	Ga0070688_1001622203	218
377	3300005366	Ga0070659_100027790	Ga0070659_1000277903	218
378	3300005366	Ga0070659_100168960	Ga0070659_1001689602	218
379	3300005367	Ga0070667_100012611	Ga0070667_1000126116	218
380	3300005434	Ga0070709_10017791	Ga0070709_100177914	218
381	3300005434	Ga0070709_10053284	Ga0070709_100532842	218
382	3300005435	Ga0070714_100120141	Ga0070714_1001201413	218
383	3300005436	Ga0070713_100155344	Ga0070713_1001553441	218
384	3300005437	Ga0070710_10004693	Ga0070710_100046935	218
385	3300005437	Ga0070710_10051846	Ga0070710_100518463	218
386	3300005438	Ga0070701_10004523	Ga0070701_100045233	218
387	3300005439	Ga0070711_100018330	Ga0070711_1000183304	218
388	3300005441	Ga0070700_100144560	Ga0070700_1001445603	218
389	3300005444	Ga0070694_100066837	Ga0070694_1000668373	218
390	3300005455	Ga0070663_100044248	Ga0070663_1000442482	218
391	3300005455	Ga0070663_100049748	Ga0070663_1000497485	218
392	3300005456	Ga0070678_100025402	Ga0070678_1000254024	218
393	3300005456	Ga0070678_100119442	Ga0070678_1001194423	218
394	3300005457	Ga0070662_100038629	Ga0070662_1000386293	218
395	3300005457	Ga0070662_100404104	Ga0070662_1004041042	218
396	3300005459	Ga0068867_100019830	Ga0068867_1000198303	218
397	3300005466	Ga0070685_10109112	Ga0070685_101091122	218
398	3300005539	Ga0068853_100003261	Ga0068853_10000326112	218
399	3300005539	Ga0068853_100755402	Ga0068853_1007554021	218
400	3300005543	Ga0070672_100102786	Ga0070672_1001027862	218
401	3300005543	Ga0070672_100116745	Ga0070672_1001167454	218
402	3300005545	Ga0070695_100025967	Ga0070695_1000259674	218
403	3300005546	Ga0070696_100023915	Ga0070696_1000239154	218
404	3300005547	Ga0070693_100012525	Ga0070693_1000125256	218
405	3300005548	Ga0070665_100033203	Ga0070665_1000332034	218
406	3300005548	Ga0070665_100078429	Ga0070665_1000784293	218
407	3300005548	Ga0070665_100366873	Ga0070665_1003668732	218
408	3300005549	Ga0070704_100026611	Ga0070704_1000266112	218
409	3300005563	Ga0068855_100242350	Ga0068855_1002423502	218
410	3300005578	Ga0068854_100000639	Ga0068854_10000063920	218
411	3300005614	Ga0068856_100216653	Ga0068856_1002166532	218
412	3300005615	Ga0070702_100035558	Ga0070702_1000355583	218
413	3300005617	Ga0068859_100001567	Ga0068859_10000156720	218
414	3300005719	Ga0068861_100023429	Ga0068861_1000234294	218
415	3300005719	Ga0068861_100104200	Ga0068861_1001042003	218
416	3300005719	Ga0068861_100734751	Ga0068861_1007347511	218
417	3300005841	Ga0068863_100556631	Ga0068863_1005566311	218
418	3300005842	Ga0068858_100003465	Ga0068858_1000034653	218
419	3300005842	Ga0068858_100080784	Ga0068858_1000807842	218
420	3300005843	Ga0068860_100001844	Ga0068860_1000018444	218
421	3300005843	Ga0068860_100151684	Ga0068860_1001516842	218
422	3300005844	Ga0068862_100060470	Ga0068862_1000604703	218
423	3300005844	Ga0068862_100227013	Ga0068862_1002270133	218
424	3300005937	Ga0081455_10016212	Ga0081455_100162124	218
425	3300006038	Ga0075365_10008580	Ga0075365_100085807	218
426	3300006038	Ga0075365_10100413	Ga0075365_101004132	218
427	3300006048	Ga0075363_100014542	Ga0075363_1000145424	218
428	3300006051	Ga0075364_10019245	Ga0075364_100192454	218
429	3300006051	Ga0075364_10204807	Ga0075364_102048072	218
430	3300006051	Ga0075364_10266956	Ga0075364_102669561	218
431	3300006163	Ga0070715_10003894	Ga0070715_100038943	218
432	3300006173	Ga0070716_100002910	Ga0070716_10000291011	218
433	3300006173	Ga0070716_100019018	Ga0070716_1000190184	218
434	3300006175	Ga0070712_100019206	Ga0070712_1000192064	218
435	3300006175	Ga0070712_100019380	Ga0070712_1000193804	218
436	3300006175	Ga0070712_100137351	Ga0070712_1001373513	218
437	3300006177	Ga0075362_10155810	Ga0075362_101558102	218
438	3300006178	Ga0075367_10028312	Ga0075367_100283124	218
439	3300006178	Ga0075367_10293579	Ga0075367_102935791	218
440	3300006237	Ga0097621_100058420	Ga0097621_1000584202	218
441	3300006353	Ga0075370_10006335	Ga0075370_100063356	218
442	3300006353	Ga0075370_10044541	Ga0075370_100445412	218
443	3300006358	Ga0068871_100350579	Ga0068871_1003505792	218
444	3300006881	Ga0068865_100016648	Ga0068865_1000166483	218
445	3300006931	Ga0097620_100001567	Ga0097620_1000015674	218
446	3300009098	Ga0105245_10001575	Ga0105245_1000157519	218
447	3300009101	Ga0105247_10000857	Ga0105247_100008574	218
448	3300009101	Ga0105247_10086490	Ga0105247_100864902	218
449	3300009148	Ga0105243_10001317	Ga0105243_100013174	218
450	3300009176	Ga0105242_10003943	Ga0105242_1000394313	218
451	3300009176	Ga0105242_10059069	Ga0105242_100590696	218
452	3300009177	Ga0105248_10038566	Ga0105248_100385664	218
453	3300009545	Ga0105237_10038308	Ga0105237_100383081	218
454	3300009551	Ga0105238_10412151	Ga0105238_104121512	218
455	3300009553	Ga0105249_10020676	Ga0105249_100206764	218
456	3300009553	Ga0105249_10022875	Ga0105249_100228756	218
457	3300009553	Ga0105249_10459111	Ga0105249_104591112	218
458	3300010375	Ga0105239_10040522	Ga0105239_100405224	218
459	3300010375	Ga0105239_10195255	Ga0105239_101952554	218
460	3300010375	Ga0105239_11142509	Ga0105239_111425091	218
461	3300013105	Ga0157369_10088030	Ga0157369_100880303	218
462	3300013297	Ga0157378_10011124	Ga0157378_100111247	218
463	3300013306	Ga0163162_10016580	Ga0163162_100165809	218
464	3300013306	Ga0163162_10167110	Ga0163162_101671103	218
465	3300013306	Ga0163162_10227704	Ga0163162_102277044	218
466	3300013307	Ga0157372_10024412	Ga0157372_100244127	218
467	3300013307	Ga0157372_10232689	Ga0157372_102326893	218
468	3300013308	Ga0157375_10014587	Ga0157375_100145874	218
469	3300013308	Ga0157375_10484777	Ga0157375_104847772	218
470	3300014326	Ga0157380_10122566	Ga0157380_101225663	218
471	3300014745	Ga0157377_10074496	Ga0157377_100744962	218
472	3300014968	Ga0157379_10011823	Ga0157379_100118236	218
473	3300014968	Ga0157379_10204616	Ga0157379_102046163	218
474	3300014969	Ga0157376_10509236	Ga0157376_105092362	218
475	3300017792	Ga0163161_10008754	Ga0163161_100087544	218
476	3300017792	Ga0163161_10030846	Ga0163161_100308464	218
477	3300025898	Ga0207692_10001645	Ga0207692_100016455	218
478	3300025898	Ga0207692_10008539	Ga0207692_100085394	218
479	3300025899	Ga0207642_10010638	Ga0207642_100106384	218
480	3300025899	Ga0207642_10021666	Ga0207642_100216662	218
481	3300025900	Ga0207710_10001489	Ga0207710_100014899	218
482	3300025900	Ga0207710_10195291	Ga0207710_101952912	218
483	3300025901	Ga0207688_10001501	Ga0207688_100015014	218
484	3300025901	Ga0207688_10019459	Ga0207688_100194593	218
485	3300025903	Ga0207680_10050831	Ga0207680_100508312	218
486	3300025904	Ga0207647_10067953	Ga0207647_100679533	218
487	3300025905	Ga0207685_10014025	Ga0207685_100140251	218
488	3300025906	Ga0207699_10022768	Ga0207699_100227685	218
489	3300025906	Ga0207699_10053381	Ga0207699_100533814	218
490	3300025907	Ga0207645_10008996	Ga0207645_100089964	218
491	3300025915	Ga0207693_10005173	Ga0207693_1000517311	218
492	3300025915	Ga0207693_10009189	Ga0207693_100091894	218
493	3300025915	Ga0207693_10180671	Ga0207693_101806712	218
494	3300025916	Ga0207663_10009642	Ga0207663_100096424	218
495	3300025916	Ga0207663_10189309	Ga0207663_101893092	218
496	3300025918	Ga0207662_10048414	Ga0207662_100484144	218
497	3300025919	Ga0207657_10185212	Ga0207657_101852122	218
498	3300025923	Ga0207681_10053956	Ga0207681_100539562	218
499	3300025927	Ga0207687_10000807	Ga0207687_1000080720	218
500	3300025927	Ga0207687_10171058	Ga0207687_101710582	218
501	3300025929	Ga0207664_10096132	Ga0207664_100961322	218
502	3300025929	Ga0207664_10566411	Ga0207664_105664112	218
503	3300025932	Ga0207690_10035473	Ga0207690_100354733	218
504	3300025932	Ga0207690_10236421	Ga0207690_102364212	218
505	3300025933	Ga0207706_10006892	Ga0207706_100068923	218
506	3300025933	Ga0207706_10065444	Ga0207706_100654442	218
507	3300025934	Ga0207686_10010526	Ga0207686_100105264	218
508	3300025934	Ga0207686_10071280	Ga0207686_100712801	218
509	3300025935	Ga0207709_10001513	Ga0207709_1000151315	218
510	3300025935	Ga0207709_10075816	Ga0207709_100758163	218
511	3300025937	Ga0207669_10000307	Ga0207669_100003074	218
512	3300025937	Ga0207669_10073232	Ga0207669_100732322	218
513	3300025938	Ga0207704_10003260	Ga0207704_100032606	218
514	3300025939	Ga0207665_10002990	Ga0207665_100029904	218
515	3300025939	Ga0207665_10014627	Ga0207665_100146274	218
516	3300025940	Ga0207691_10135399	Ga0207691_101353992	218
517	3300025940	Ga0207691_10215434	Ga0207691_102154342	218
518	3300025942	Ga0207689_10050977	Ga0207689_100509773	218
519	3300025949	Ga0207667_10129804	Ga0207667_101298043	218
520	3300025961	Ga0207712_10008981	Ga0207712_100089814	218
521	3300025961	Ga0207712_10058792	Ga0207712_100587921	218
522	3300025961	Ga0207712_10736231	Ga0207712_107362311	218
523	3300025972	Ga0207668_10019244	Ga0207668_100192443	218
524	3300025981	Ga0207640_10008792	Ga0207640_100087926	218
525	3300025986	Ga0207658_10014343	Ga0207658_100143436	218
526	3300025986	Ga0207658_10228611	Ga0207658_102286112	218
527	3300026023	Ga0207677_10002345	Ga0207677_100023454	218
528	3300026023	Ga0207677_10174373	Ga0207677_101743732	218
529	3300026035	Ga0207703_10080178	Ga0207703_100801781	218
530	3300026041	Ga0207639_10004970	Ga0207639_100049703	218
531	3300026041	Ga0207639_10065009	Ga0207639_100650093	218
532	3300026075	Ga0207708_10041083	Ga0207708_100410834	218
533	3300026078	Ga0207702_10093548	Ga0207702_100935482	218
534	3300026088	Ga0207641_10265373	Ga0207641_102653731	218
535	3300026088	Ga0207641_10532111	Ga0207641_105321112	218
536	3300026089	Ga0207648_10007257	Ga0207648_1000725711	218
537	3300026089	Ga0207648_10100040	Ga0207648_101000402	218
538	3300026118	Ga0207675_100008491	Ga0207675_1000084914	218
539	3300026121	Ga0207683_10005423	Ga0207683_100054234	218
540	3300026121	Ga0207683_10073938	Ga0207683_100739384	218
541	3300028379	Ga0268266_10367018	Ga0268266_103670182	218
542	3300028379	Ga0268266_10546951	Ga0268266_105469512	218
543	3300028380	Ga0268265_10010664	Ga0268265_100106645	218
544	3300028380	Ga0268265_10186599	Ga0268265_101865992	218
545	3300028380	Ga0268265_10548237	Ga0268265_105482371	218
546	3300028381	Ga0268264_10002354	Ga0268264_100023544	218
547	3300028381	Ga0268264_10121144	Ga0268264_101211442	218
548	3300028381	Ga0268264_10312877	Ga0268264_103128771	218
549	3300031911	Ga0307412_10362444	Ga0307412_103624442	218
550	3300031995	Ga0307409_100163262	Ga0307409_1001632622	218
551	3300032002	Ga0307416_100051755	Ga0307416_1000517554	218
552	3300032005	Ga0307411_10086321	Ga0307411_100863211	218
553	3300032126	Ga0307415_100208398	Ga0307415_1002083981	218
554	3300035085	Ga0373929_0004400	Ga0373929_0004400_400_1056	218
555	3300035091	Ga0373951_0043202	Ga0373951_0043202_294_950	218
556	3300035112	Ga0373932_0106119	Ga0373932_0106119_63_719	218
557	3300035691	Ga0373931_0012021	Ga0373931_0012021_3024_3680	218
558	3300042004	Ga0439445_0046796	Ga0439445_0046796_412_1068	218
559	3300042435	Ga0439434_0024294	Ga0439434_0024294_424_1080	218
560	3300044658	Ga0466972_0021212	Ga0466972_0021212_2464_3120	218
561	3300044684	Ga0466966_0071978	Ga0466966_0071978_131_787	218
562	3300044693	Ga0466961_0006483	Ga0466961_0006483_2027_2683	218
563	3300044719	Ga0466971_0010912	Ga0466971_0010912_2966_3622	218
564	3300044735	Ga0466968_0036641	Ga0466968_0036641_104_760	218
565	3300044842	Ga0466957_0010851	Ga0466957_0010851_610_1266	218
566	3300045836	Ga0466958_0006292	Ga0466958_0006292_3551_4207	218
567	3300045976	Ga0466967_0124960	Ga0466967_0124960_585_1241	218
568	3300048903	Ga0496100_0007679	Ga0496100_0007679_2474_3130	218
569	3300048904	Ga0496101_0007705	Ga0496101_0007705_3594_4250	218
570	3300048905	Ga0496102_0007765	Ga0496102_0007765_725_1381	218
571	3300048905	Ga0496102_0048456	Ga0496102_0048456_317_973	218
572	3300048905	Ga0496102_0256550	Ga0496102_0256550_930_1586	218
573	3300048906	Ga0496103_0000639	Ga0496103_0000639_4519_5175	218
574	3300048906	Ga0496103_0087377	Ga0496103_0087377_145_801	218
575	3300048907	Ga0496104_0196880	Ga0496104_0196880_1232_1888	218
576	3300048909	Ga0496106_0003193	Ga0496106_0003193_3818_4474	218
577	3300048909	Ga0496106_0206659	Ga0496106_0206659_681_1337	218
578	3300048910	Ga0496107_0000775	Ga0496107_0000775_17093_17749	218
579	3300048910	Ga0496107_0062489	Ga0496107_0062489_1069_1725	218
580	3300048910	Ga0496107_0547848	Ga0496107_0547848_134_799	218
581	3300048911	Ga0496108_0086968	Ga0496108_0086968_1286_1951	218
582	3300048911	Ga0496108_0278844	Ga0496108_0278844_315_971	218
583	3300048912	Ga0496109_0015322	Ga0496109_0015322_4865_5521	218
584	3300048912	Ga0496109_0067976	Ga0496109_0067976_2197_2853	218
585	3300048912	Ga0496109_0085741	Ga0496109_0085741_1790_2455	218
586	3300048914	Ga0496111_0137129	Ga0496111_0137129_997_1653	218
587	3300048915	Ga0496112_0097475	Ga0496112_0097475_1294_1950	218
588	3300048915	Ga0496112_0152096	Ga0496112_0152096_47_703	218
589	3300048916	Ga0496113_0177453	Ga0496113_0177453_853_1509	218
590	3300048916	Ga0496113_0475029	Ga0496113_0475029_17_673	218
591	3300048917	Ga0496114_0008476	Ga0496114_0008476_3215_3871	218
592	3300048918	Ga0496115_0042503	Ga0496115_0042503_171_827	218
593	3300048918	Ga0496115_0275710	Ga0496115_0275710_525_1181	218
594	3300049571	Ga0501034_0121455	Ga0501034_0121455_1742_2398	218
595	3300050489	nmdc:mga03683_24619_c1	nmdc:mga03683_24619_c1_982_1638	218
596	3300050490	nmdc:mga03n38_11746_c1	nmdc:mga03n38_11746_c1_2448_3104	218
597	3300050490	nmdc:mga03n38_254556_c1	nmdc:mga03n38_254556_c1_244_900	218
598	3300050491	nmdc:mga00v17_18806_c1	nmdc:mga00v17_18806_c1_1859_2515	218
599	3300050491	nmdc:mga00v17_215033_c1	nmdc:mga00v17_215033_c1_74_730	218
600	3300050491	nmdc:mga00v17_31159_c1	nmdc:mga00v17_31159_c1_119_775	218
601	3300050492	nmdc:mga0yw44_446534_c1	nmdc:mga0yw44_446534_c1_192_848	218
602	3300050492	nmdc:mga0yw44_46310_c1	nmdc:mga0yw44_46310_c1_1032_1688	218
603	3300050516	nmdc:mga0sz30_253208_c1	nmdc:mga0sz30_253208_c1_47_703	218
604	3300050516	nmdc:mga0sz30_2672_c5	nmdc:mga0sz30_2672_c5_1018_1674	218
605	3300050516	nmdc:mga0sz30_5486_c1	nmdc:mga0sz30_5486_c1_1828_2484	218
606	3300061719	Ga0466962_0008477	Ga0466962_0008477_2383_3039	218

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13399

LytR_C

LytR cell envelope-related transcriptional attenuator

108

197

0.9 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6q10-assembly1.cif.gz_A	crystal structure of the soluble domain (residues 71-217) of a conserved hypothetical secreted protein (rv2700 ortholog) from mycobacterium marinum	0.9835	72	218
6q10-assembly1.cif.gz_A	crystal structure of the soluble domain (residues 71-217) of a conserved hypothetical secreted protein (rv2700 ortholog) from mycobacterium marinum	0.9704	72	218
4hnq-assembly1.cif.gz_A	crystal structure of the mutant q97a of vibrio cholerae chey3	0.7808	88	127
2id7-assembly1.cif.gz_A	1.75 a structure of t87i phosphono-chey	0.7684	93	127
1e6l-assembly1.cif.gz_A	two-component signal transduction system d13a mutant of chey	0.7214	93	132

ID	Description	Score	Start	End	Superfamily
af_I6Y1I5_90_179_3.30.70.2390	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;	1.004	92	181	3.30.70.2390
af_I6Y1I5_90_179_3.30.70.2390	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;	0.9932	92	181	3.30.70.2390
af_I6WZI4_556_638_3.30.70.2390	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;	0.8902	92	178	3.30.70.2390
af_I6WZI4_556_638_3.30.70.2390	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;	0.8702	92	178	3.30.70.2390
4jp1A00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.7642	92	127	3.40.50.2300

ID	Description	Score	Start	End
AF-A0A0H3LJG1-F1-model_v4	Secreted alanine rich protein	0.9935	83	218
AF-X8ARD6-F1-model_v4	deleted	0.9907	98	218
AF-A0A7G1IL94-F1-model_v4	LytR/CpsA/Psr regulator C-terminal domain-containing protein	0.9838	115	218
AF-A0A0H3LJG1-F1-model_v4	Secreted alanine rich protein	0.9792	83	218
AF-X8ARD6-F1-model_v4	deleted	0.9747	98	218

Feature Viewer

pLDDT	pTM	Quality
83.6	0.7	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F468549

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF13399

LytR_C

LytR cell envelope-related transcriptional attenuator

108

197

0.9

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map